HHsearch alignment for GI: 254781172 and conserved domain: PRK08097

>PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed.
Probab=92.63  E-value=0.13  Score=31.68  Aligned_cols=109  Identities=15%  Similarity=0.164  Sum_probs=61.3

Q ss_pred             HHCCHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             63010111168999999882--9989999978977612511778761388867899999999966979999999999733
Q gi|254781172|r  555 FSLGIRHVGAEIARSLAKYY--LSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV  632 (731)
Q Consensus       555 ~ALGI~~vG~~~Ak~La~~f--~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~~  632 (731)
T Consensus       427 ~amdI~GLGek~i~~L~~~gli~~~~Dly~----------L~~~~L~~l~g~geKsa~nLl~aIe~SK~-~~l~r~l~aL  495 (563)
T PRK08097        427 QGLGLDGIGEGTWRALHQTGRFEHLFSWLA----------LTPEQLANTPGIGKARAAQLWHQFNLARQ-QPFTRWLKAL  495 (563)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCCHHHHHH----------CCHHHHHCCCCHHHHHHHHHHHHHHHHCC-CCHHHHHHHC
T ss_conf             415856769999999997588899799750----------89999855898578999999999999728-9999999986


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             8776543224688216866999725889987899999998298499811
Q gi|254781172|r  633 SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL  681 (731)
Q Consensus       633 ~~~~~~~~~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSV  681 (731)
T Consensus       496 GI~~vG~~--~a~~l~~-~~---~~L~~as~e~l~~-i~gIG~~~A~si  537 (563)
T PRK08097        496 GIPLTQAA--LNASLDR-SW---QQLLSRTEQQWQQ-LPGIGEGRARQL  537 (563)
T ss_pred             CCCCHHHH--HHHHHHC-CH---HHHHCCCHHHHHC-CCCCCHHHHHHH
T ss_conf             99508999--9999861-99---9997399989955-798489999999