HHsearch alignment for GI: 254781172 and conserved domain: PRK08434

>PRK08434 consensus.
Probab=93.93  E-value=0.07  Score=33.72  Aligned_cols=83  Identities=14%  Similarity=0.050  Sum_probs=42.9

Q ss_pred             HHHHHHHCCCCC------CCHHHHHHHHHHHHHHHHHCCHHHCC-CCCCCCCCCCCCCCC---------CC----CCEE-
Q ss_conf             998433177982------08789999999999998977203115-899996200364323---------57----7504-
Q gi|254781172|r   31 HDDCYYQYSKPI------ILDSEYDALKRRCDAIAHAFPDLARS-EDPNGPLNKIGGEMN---------LS----LFKV-   89 (731)
Q Consensus        31 ~~~~Yy~~~~p~------isD~eYD~L~~~L~~le~~~p~~~~~-~~p~spt~~Vg~~~~---------~~----~~kv-   89 (731)
T Consensus        13 ~fRAy~A~-~~l~t~~G~pTnAv~GF~~mL~kli~~~~P~~iavaFD~~~~TFRhe~y~~YKAnR~~~PedL~~Qip~i~   91 (887)
T PRK08434         13 FFRSYYAL-PPLKNSQGFPTGLLSGFANFIYSLKNEFKSDYIVFALDSKGKTFRSEIDPNYKANRPPPPEELLEQLPIAI   91 (887)
T ss_pred             HHHHHCCC-CCCCCCCCCEECHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             99997079-99879999880359999999999998659988999984959962210205752899999989999999999


Q ss_pred             ----ECCCCCCCHHHCCCHHHHHHHHHHHH
Q ss_conf             ----51664257021599999999999999
Q gi|254781172|r   90 ----THSIPTLSLEKIWNIEDLRKFITRIY  115 (731)
Q Consensus        90 ----~H~~pMlSL~k~~~~~el~~w~~~~~  115 (731)
T Consensus        92 e~l~algIp~~e~~G-yEADDiIgTla~~a  120 (887)
T PRK08434         92 EWIEKMGFKSLSQEG-YEADDIIASFVKFA  120 (887)
T ss_pred             HHHHHCCCCEECCCC-CCHHHHHHHHHHHH
T ss_conf             999987998845589-24999999999999