HHsearch alignment for GI: 254781172 and conserved domain: PRK08786

>PRK08786 consensus.
Probab=94.15  E-value=0.066  Score=33.93  Aligned_cols=46  Identities=11%  Similarity=0.114  Sum_probs=21.8

Q ss_pred             HHHHHHHCCCCCC------CHHHHHHHHHHHHHHHHHCCHHHC-CCCCCCCCCCC
Q ss_conf             9984331779820------878999999999999897720311-58999962003
Q gi|254781172|r   31 HDDCYYQYSKPII------LDSEYDALKRRCDAIAHAFPDLAR-SEDPNGPLNKI   78 (731)
Q Consensus        31 ~~~~Yy~~~~p~i------sD~eYD~L~~~L~~le~~~p~~~~-~~~p~spt~~V   78 (731)
T Consensus        13 ifRAy~A~-~~l~~~~G~pTnAv~GF~~-mL~kl~~e~p~~~~v~fD~~~~tfR~   65 (927)
T PRK08786         13 LYRAFHAL-PPLTNAQGEPTGALFGVVN-MLRATLKERPAYVAFVVDAPGKTFRD   65 (927)
T ss_pred             HHHHHCCC-CCCCCCCCCEECHHHHHHH-HHHHHHHHCCCEEEEEEECCCCCCCC
T ss_conf             99998079-9887999988207999999-99999987889899999695997451