HHsearch alignment for GI: 254781172 and conserved domain: PRK09482

>PRK09482 xni exonuclease IX; Provisional.
Probab=94.82  E-value=0.042  Score=35.44  Aligned_cols=41  Identities=15%  Similarity=0.281  Sum_probs=29.9

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHH
Q ss_conf             0101111689999998829989999978977612511778761388867899999999
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~  614 (731)
T Consensus       185 PGV~GIG~KtA~~LL~~fgsle~i~~n~d-----------------~i~~k~~~~l~~  225 (256)
T PRK09482        185 PGVAGIGPKSAAELLNQFRSLEGIYESLD-----------------ALPEKWRKKLEE  225 (256)
T ss_pred             CCCCCCCHHHHHHHHHHHCCHHHHHHHHH-----------------HCCHHHHHHHHH
T ss_conf             99998588899999998550999998377-----------------556899999996