HHsearch alignment for GI: 254781172 and conserved domain: TIGR00575

>TIGR00575 dnlj DNA ligase, NAD-dependent; InterPro: IPR001679 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalyzing the formation of an internucleotide ester bond between phosphate and deoxyribose. It is active during DNA replication, DNA repair and DNA recombination. There are two forms of DNA ligase: one requires ATP (6.5.1.1 from EC), the other NAD (6.5.1.2 from EC). This family is predominantly composed of NAD-dependent bacterial DNA ligases. They are proteins of about 75 to 85 Kd whose sequence is well conserved , . They also show similarity to yicF, an Escherichia coli hypothetical protein of 63 Kd.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair.
Probab=100.00  E-value=0  Score=1781.73  Aligned_cols=663  Identities=42%  Similarity=0.733  Sum_probs=619.6

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCC-CCEEECCCCCCCHHHCC
Q ss_conf             99999999984331779820878999999999999897720311589999620036432357-75045166425702159
Q gi|254781172|r   24 LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIW  102 (731)
Q Consensus        24 L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~~~~-~~kv~H~~pMlSL~k~~  102 (731)
T Consensus         1 L~~~i~~h~y~YYVld~P~i~D~~YD~L~~~L~~LE~~~PeL~---~pDSPTqrVG~~~~~~~F~~v~H~~PMLSLdNAF   77 (706)
T TIGR00575         1 LRKLIRKHDYRYYVLDEPSISDAEYDRLMRELQELEEKHPELI---TPDSPTQRVGAAPLSADFPKVRHSTPMLSLDNAF   77 (706)
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHCC
T ss_conf             9467776755134657798882888899999999865488853---6898642137600215787267776520132214


Q ss_pred             CHHHHHHHHHHHHHHHCCCCC--CCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCC-
Q ss_conf             999999999999986124677--76119999415818999998599899888659865566699977531024322335-
Q gi|254781172|r  103 NIEDLRKFITRIYRFWQKKDD--NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-  179 (731)
Q Consensus       103 ~~~el~~w~~~~~~~~~~~~~--~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~iP~~l~~-  179 (731)
T Consensus        78 ~~~el~~f~~R~~~~~~~~~~~~~~~~~~~EpKiDG~s~~L~Ye~G~L~~A~TRGDG~~GEDvT~NvrTI~~IP~~~~~~  157 (706)
T TIGR00575        78 DEDELRAFIKRIRRALGSKEKQEEKVEYVVEPKIDGLSISLTYENGVLVRAATRGDGTTGEDVTANVRTIRSIPLRLAGD  157 (706)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHCCCHHHCCCCCCCCCC
T ss_conf             88899999999998603335755460689702427157889983765898667488833751211302100244413588


Q ss_pred             ---CCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEEC--CCCCCC---
Q ss_conf             ---44550489999998520212345564314854334234567777523455553-011105664102--454332---
Q gi|254781172|r  180 ---NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLG--KTSEIF---  250 (731)
Q Consensus       180 ---~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~--~~~~~~---  250 (731)
T Consensus       158 ~~~n~p~~~EvRGEVf~~k~~F~~lN~~~~~~ge~~FANPRNaAAGsLRqlDp~ita~R~L~~~~Y~~G~~~~~~~~~~L  237 (706)
T TIGR00575       158 GVGNPPERLEVRGEVFMPKEDFEALNEERLEEGEKPFANPRNAAAGSLRQLDPRITAKRKLRFFAYGLGNAEGLELKGSL  237 (706)
T ss_pred             CCCCCCCEEEEEEEEEECHHHHHHHHHHHHHCCCCCCCCCCHHHCCCEECCCCCCEECCCCEEEEEECCCCCCCCCCCCC
T ss_conf             87664325898436885658999999999970889666841333130000473111116636898762554577777657


Q ss_pred             -CCCCHHHHHHHHHCCCC-CCCCEEEEE--CCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEE
Q ss_conf             -10000368999975996-654148874--03211345566553100112343763777311000111587656866312
Q gi|254781172|r  251 -AKGQYEMLQKMRCLGFP-VNNGVRQAN--TFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMI  326 (731)
Q Consensus       251 -~~~~~e~l~~L~~~GF~-v~~~~~~~~--~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~Prwai  326 (731)
T Consensus       238 ~~~t~~~~L~~L~~~GF~TV~~~~~~~~ln~~~eV~~~~~~~~~~R~~L~y~IDGvV~Kvd~l~~Q~~LG~t~k~PRWAi  317 (706)
T TIGR00575       238 PFRTQYEALAWLKKLGFPTVNPHIRLCKLNSIEEVLEYYEEIEKKRDSLPYEIDGVVVKVDDLALQEELGFTSKAPRWAI  317 (706)
T ss_pred             CCCCHHHHHHHHHHCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHCHHCCCCCHHH
T ss_conf             86778999999986388420125776303898899999999998752078730437898378799987111027860010


Q ss_pred             EECCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEECCCEEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             31145621589987889940356225899997433302640001014898999750234543222468440768999835
Q gi|254781172|r  327 SHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRA  406 (731)
Q Consensus       327 A~Kf~~e~~~T~v~~I~wqvgRtG~itPva~~ePV~l~G~~V~ratlhN~~~I~~l~~~~~~~~~~~~I~iGd~V~I~Ra  406 (731)
T Consensus       318 AYKFpa~e~~T~L~dv~~qVGRTG~iTPvA~LePV~vaG~~Vs~ATLHN~D~I~~-----------kdiriGD~Vvv~kA  386 (706)
T TIGR00575       318 AYKFPAEEAQTKLLDVVVQVGRTGAITPVAKLEPVFVAGTTVSRATLHNEDEIEE-----------KDIRIGDTVVVRKA  386 (706)
T ss_pred             CCCCCCCCCCEEEEEEEEEECCEEEECCEEEECCEEECCEEEEEEEECCHHHHHC-----------CCCCCCCEEEEEEC
T ss_conf             2366743010089878998465677600367565587207862344016002420-----------27665888999844


Q ss_pred             CCCHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             87025665410123578730477704326577501033786544521010035434411446655332130123103541
Q gi|254781172|r  407 GEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL  486 (731)
Q Consensus       407 GdVIP~I~~Vi~~~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GL  486 (731)
T Consensus       387 GdVIP~vv~v~~~~R~~~~~~~~~P~~CP~C~s~lv~~~~e------~~~rC~Ng~~Cpa~~~e~i~hFaSr~AmdI~GL  460 (706)
T TIGR00575       387 GDVIPKVVEVLLEKRTGEERPIKFPTHCPSCGSPLVRIEEE------VDIRCTNGLNCPAQLVERIKHFASRNAMDIDGL  460 (706)
T ss_pred             CCCCHHHHHCCCCCCCCCCCEEECCCCCCCCCCEEECCCCC------EEEECCCCCCCHHHHHHHEEEEEEECCCCCCCC
T ss_conf             86253554102357888887034287188888331115787------216538876653676511023454110332222


Q ss_pred             HHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             0355556530576540454101101067775310001000134-210014568999987522346667763010111168
Q gi|254781172|r  487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILG-FGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE  565 (731)
Q Consensus       487 G~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~G-fgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~  565 (731)
T Consensus       461 G~~~I~~LfE~~----Lv~~~~DLY~L~~k----~~~Ll~le~~~g~~sa~nLl~aIe~sK~~pl~RlL~aLGIr~VG~~  532 (706)
T TIGR00575       461 GEKVIEQLFEEK----LVRSVADLYALKEK----LEDLLELEGKFGEKSAQNLLSAIEKSKKKPLARLLFALGIRHVGEV  532 (706)
T ss_pred             CHHHHHHHHHCC----CCCCHHHHHHHHHH----HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             389999998726----66785666577889----9998706403556889999999998521048999986286035799


Q ss_pred             HHHHHHHHCCCHHHHHHHHHH-HHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHH--------HHHHHHHHHCCCCC
Q ss_conf             999999882998999997897-761251177876138886789999999996697999--------99999997338776
Q gi|254781172|r  566 IARSLAKYYLSYQNFAQEINN-IIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNI--------CAVEALLKEVSPSI  636 (731)
Q Consensus       566 ~Ak~La~~f~si~~l~~~~~~-~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~--------~~i~~L~~~~~~~~  636 (731)
T Consensus       533 ~A~~La~~f~tl~~L~~A~~e~~~~~~~f~~s~L~~~~g~G~~vA~~~~~~F~~~~~~~~qPYRta~~~~~L~~~gv~~~  612 (706)
T TIGR00575       533 TAKLLAKHFGTLDKLKAASLETLESIYQFDRSELLSVEGVGPKVAESIVNFFHDPNNLSLQPYRTAELIEKLEELGVNME  612 (706)
T ss_pred             HHHHHHHHCCCHHHHHHCCHHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCH
T ss_conf             99999985588689985082167788751605564101402789999999871200013560468999999988316310


Q ss_pred             C----------CCC-----CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCC-HHHH
Q ss_conf             5----------432-----24688216866999725889987899999998298499811163217997788886-3798
Q gi|254781172|r  637 G----------RHE-----KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGS-KLEK  700 (731)
Q Consensus       637 ~----------~~~-----~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gS-Kl~K  700 (731)
T Consensus       613 ~~D~~~~LL~~~~~~~~~~~~~~~~~~GK~fVlTG~L~~~sR~~a~~~~~~lGgkv~sSVS~kTD~viaG~~aGs~Kl~k  692 (706)
T TIGR00575       613 SEDEFCRLLDQALKEKVEAELAGSPLAGKTFVLTGTLSQMSRDEAKELLEALGGKVASSVSKKTDYVIAGEKAGSRKLAK  692 (706)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCEEECCCEEEEEEEEEECCCCHHHHHH
T ss_conf             11357877764201100100057520277689951568888899999999809978004000440789855855468999


Q ss_pred             HHHCCCEEECHHHH
Q ss_conf             99749917379999
Q gi|254781172|r  701 AQQLGVKIMNEEQF  714 (731)
Q Consensus       701 A~~LgI~Ii~e~ef  714 (731)
T Consensus       693 A~~Lgi~il~Ee~l  706 (706)
T TIGR00575       693 AQELGIPILNEEEL  706 (706)
T ss_pred             HHHCCCCCCCCCCC
T ss_conf             99718942343149