HHsearch alignment for GI: 254781172 and conserved domain: TIGR01083

>TIGR01083 nth endonuclease III; InterPro: IPR005759 The spectrum of DNA damage caused by reactive oxygen species includes a wide variety of modifications of purine and pyrimidine bases. Among these modified bases, 7,8-dihydro-8-oxoguanine (8-oxoG) is an important mutagenic lesion. Base excision repair is a critical mechanism for preventing mutations by removing the oxidative lesion from the DNA. Escherichia coli Nth protein (endonuclease III) has an 8-oxoG DNA glycosylase/AP lyase activity which removes 8-oxoG preferentially from 8-oxoG/G mispairs. Human hNTH1 protein, a homolog of E. coli Nth protein, has similar DNA glycosylase/AP lyase activity that removes 8-oxoG from 8-oxoG/G mispairs . ; GO: 0003906 DNA-(apurinic or apyrimidinic site) lyase activity, 0006284 base-excision repair, 0005622 intracellular.
Probab=90.50  E-value=0.6  Score=26.52  Aligned_cols=74  Identities=23%  Similarity=0.355  Sum_probs=42.4

Q ss_pred             HHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH----HHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             555565305765404541011010677753100010001342100145689999----8752234666776301011116
Q gi|254781172|r  489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI----NKRRNISLERFIFSLGIRHVGA  564 (731)
Q Consensus       489 k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sI----e~sK~~~L~r~L~ALGI~~vG~  564 (731)
T Consensus        47 kaT~~LF~~------Y~tp~~~a~a~~eel-----------------~~~Ik~iGlYr~KAk~I---------------~   88 (192)
T TIGR01083        47 KATKKLFEV------YPTPQALAAAGLEEL-----------------EEYIKSIGLYRNKAKNI---------------I   88 (192)
T ss_pred             HCCHHHHHC------CCCHHHHHCCCHHHH-----------------HHHHHCCCCCHHHHHHH---------------H
T ss_conf             316786512------778689960893134-----------------77642258645689999---------------9


Q ss_pred             HHHHHHHHHCC-CHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHH
Q ss_conf             89999998829-989999978977612511778761388867899999999
Q gi|254781172|r  565 EIARSLAKYYL-SYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       565 ~~Ak~La~~f~-si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~  614 (731)
T Consensus        89 ~~~~~LvE~y~GeV--------------P~~~~eL~~LPGVGRKTANVVL~  125 (192)
T TIGR01083        89 ALCRKLVERYGGEV--------------PEDREELVKLPGVGRKTANVVLN  125 (192)
T ss_pred             HHHHHHHHHHCCCC--------------CCCHHHHHCCCCCCCHHHHHHHH
T ss_conf             99999999818987--------------75537661789987114562433