>TIGR01259 comE comEA protein; InterPro: IPR004787 The comE locus is obligatory for bacterial cell competence - the process of internalizing the exogenous added DNA. comEA and comEC are required for transformability, whereas the products of comEB and of the overlapping comER, which is transcribed in the reverse direction, are dispensable . ComEA has been shown to be an integral membrane protein, as predicted from hydropathy analysis, with its C-terminal domain outside the cytoplasmic membrane. This C-terminal domain possesses a sequence with similarity to those of several proteins known to be involved in nucleic acid transactions including UvrC and a human protein that binds to the replication origin of the Human herpesvirus 4 (Epstein-Barr virus) ..

Probab=94.89 E-value=0.034 Score=36.19 Aligned_cols=57 Identities=16% Similarity=0.256 Sum_probs=37.9 Q ss_pred HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHH Q ss_conf 987522346667763010111168999999882998999997897761251177876138886789999999996 Q gi|254781172|r 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616 (731) Q Consensus 542 Ie~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff 616 (731) T Consensus 66 lN~As~~EL~~l------~GiGP~kA~aIi~Y-------Re-----~nG~F~SvddL~kVsGIG~k~~eKLk~~~ 122 (124) T TIGR01259 66 LNKASLEELQAL------PGIGPAKAKAIIEY-------RE-----ENGAFKSVDDLTKVSGIGEKSLEKLKDYV 122 (124) T ss_pred HHHHHHHHHHHC------CCCCCHHHHHHHHH-------HH-----HCCCCCCHHHHHCCCCCCHHHHHHHHHCC T ss_conf 406789998636------99981337999999-------98-----56997775550035788546687420003

HHsearch alignment for GI: 254781172 and conserved domain: TIGR01259