>pfam00533 BRCT BRCA1 C Terminus (BRCT) domain. The BRCT domain is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage. The BRCT domain of XRCC1 forms a homodimer in the crystal structure. This suggests that pairs of BRCT domains associate as homo- or heterodimers. BRCT domains are often found as tandem-repeat pairs. Structures of the BRCA1 BRCT domains revealed a basis for a widely utilized head-to-tail BRCT-BRCT oligomerisation mode. This conserved tandem BRCT architecture facilitates formation of the canonical BRCT phospho-peptide interaction cleft at a groove between the BRCT domains. Disease associated missense and nonsense mutations in the BRCA1 BRCT domains disrupt peptide binding by directly occluding this peptide binding groove, or by disrupting key conserved BRCT core folding determinants.

Probab=98.67 E-value=1.7e-07 Score=77.19 Aligned_cols=74 Identities=39% Similarity=0.589 Sum_probs=67.2 Q ss_pred CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC-CHHHHHHHCCCEEECHHHHHHHH Q ss_conf 8821686699972588998789999999829849981116321799778888-63798997499173799999999 Q gi|254781172|r 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQLGVKIMNEEQFLFLL 718 (731) Q Consensus 644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g-SKl~KA~~LgI~Ii~e~ef~~ll 718 (731) T Consensus 3 ~~~f~~~~~~i~~-~~~~~r~~l~~~i~~~Gg~~~~~~~~~~thli~~~~~~~~k~~~a~~~~i~iV~~~Wi~~ci 77 (77) T pfam00533 3 EKLFKGKTFVITG-LDSLEREELEELIEKLGGKVTDSLSKKTTHVIVGENAGTLKLLKAIALGIPIVTEEWLLDCI 77 (77) T ss_pred CCCCCCCEEEEEC-CCCCCHHHHHHHHHHHCCEEECCCCCCEEEEEECCCCCCHHHHHHHHCCCEEECHHHHHHHC T ss_conf 8537996899979-49849999999999959947164346678999828988479998886896795399999869

HHsearch alignment for GI: 254781172 and conserved domain: pfam00533