HHsearch results for GI: 254781172 and protein with PDBid: 1kzy_C

>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B
Probab=97.32  E-value=0.0028  Score=42.84  Aligned_cols=81  Identities=16%  Similarity=0.112  Sum_probs=64.1

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC----------CEEEEEECCCC-CCHHHHHHHCCCEEEC
Q ss_conf             468821686699972588998789999999829849981116----------32179977888-8637989974991737
Q gi|254781172|r  642 NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR----------KTDIIIVGDNP-GSKLEKAQQLGVKIMN  710 (731)
Q Consensus       642 ~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk----------kT~~LI~ge~~-gSKl~KA~~LgI~Ii~  710 (731)
                      ....+|.|..|++++....-.++.+..+++..||++..+..+          +++++|+.... +.+..+|++.||+|++
T Consensus       151 ~~~~lf~g~~i~~~~~~~~~~~~~~~~li~~~Ga~~~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~i~iv~  230 (259)
T 1kzy_C          151 PRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVS  230 (259)
T ss_dssp             CCCCTTTTCEEEEEESCTTTTHHHHHHHHHHTTCSEEEEEESSSSCCCSCGGGCSEEEECTTCCHHHHHHHHHHTCCEEC
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEC
T ss_conf             46876689889997689864699999999978998945256533222246787529998489868999999877996988


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999998828
Q gi|254781172|r  711 EEQFLFLLQQYN  722 (731)
Q Consensus       711 e~ef~~ll~~~~  722 (731)
                      .+.+.+=|-...
T Consensus       231 ~eWl~~sii~g~  242 (259)
T 1kzy_C          231 QEWVIQCLIVGE  242 (259)
T ss_dssp             HHHHHHHHHHTS
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999998198