HHsearch results for GI: 254781172 and protein with PDBid: 2a1j_B

>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5
Probab=98.94  E-value=6.8e-10  Score=94.01  Aligned_cols=74  Identities=16%  Similarity=0.201  Sum_probs=63.4

Q ss_pred             HHHHHHH-HHHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHH
Q ss_conf             5689999-8752234666776301-0111168999999882998999997897761251177876138886789999999
Q gi|254781172|r  536 TNLYDSI-NKRRNISLERFIFSLG-IRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV  613 (731)
Q Consensus       536 ~nL~~sI-e~sK~~~L~r~L~ALG-I~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~  613 (731)
                      +|--++| +++++..+++++++|| ||+||+..|+.|+++|++++++..          ++.++|.+|+|||+++|++|.
T Consensus        12 q~~~d~ike~~~~~~~~~~~~~L~~I~gIGk~~A~~L~~~F~Si~~l~~----------As~eeL~~i~GIG~~~A~~I~   81 (91)
T 2a1j_B           12 QDPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIA----------ASREDLALCPGLGPQKARRLF   81 (91)
T ss_dssp             -CCSHHHHHHHHHHHHHHHHHHHTTSTTCCHHHHHHHHHHHSSHHHHHS----------CCHHHHHTSSSCCSHHHHHHH
T ss_pred             CCCHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHH----------HHHHHHCCCCCCCHHHHHHHH
T ss_conf             4978999998737909999998646888599999999999588298999----------899975577996999999999


Q ss_pred             HHHCCH
Q ss_conf             996697
Q gi|254781172|r  614 EFYQNP  619 (731)
Q Consensus       614 ~ff~~~  619 (731)
                      +||++|
T Consensus        82 ~~f~~p   87 (91)
T 2a1j_B           82 DVLHEP   87 (91)
T ss_dssp             HHHHSC
T ss_pred             HHHHCC
T ss_conf             998481