HHsearch results for GI: 254781172 and protein with PDBid: 2cou_A

>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=98.33  E-value=1.6e-07  Score=75.69  Aligned_cols=79  Identities=16%  Similarity=0.197  Sum_probs=69.9

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHCC
Q ss_conf             88216866999725889987899999998298499811163217997788886379899749917379999999988286
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT  723 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~~  723 (731)
                      -.+|.|.+||||| |....|.+++++|+.+||++...++.++++||+++..+.|+.+|.+.||+|++++.+.+=++...-
T Consensus        10 ~~~F~G~~i~~sG-~~~~~~~~l~~~i~~~GG~~~~~~~~~~THlI~~~~~~~k~~~a~~~~i~VV~~~Wl~ds~~~~~~   88 (109)
T 2cou_A           10 VPPFQDCILSFLG-FSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDAR   88 (109)
T ss_dssp             CCTTTTCBEEEES-SCHHHHHHHHHHHHHHTCBCCCTTCTTCSEEEECTTTCSSCSSCCCTTSEEECHHHHHHHHHTTSC
T ss_pred             CCCCCCCEEEECC-CCHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHCCCC
T ss_conf             8878982899858-986889999999998399997642898518997369847889888637866679999999983984