HHsearch results for GI: 254781172 and protein with PDBid: 2jw5_A

>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens}
Probab=96.77  E-value=0.0009  Score=46.68  Aligned_cols=79  Identities=11%  Similarity=0.180  Sum_probs=59.0

Q ss_pred             CCCCCCCCCEEEE--ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC-CHHHHHHH-----CCCEEECHHH
Q ss_conf             4688216866999--72588998789999999829849981116321799778888-63798997-----4991737999
Q gi|254781172|r  642 NVSSEIENKKLVF--TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQ-----LGVKIMNEEQ  713 (731)
Q Consensus       642 ~~~~~l~gk~vV~--TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g-SKl~KA~~-----LgI~Ii~e~e  713 (731)
                      .....|.+..+.|  || +..-+++.++++|+.+||++..+++.++++||+.+... .+..|+.+     -|++|++.+.
T Consensus         7 ~~~~~l~~~~~~i~~sG-~~~~~~~~l~~~i~~~GG~~~~~~~~~~ThvI~~~~~~~~~~~k~~~~~~~~~~i~vV~~~W   85 (106)
T 2jw5_A            7 EAEEWLSSLRAHVVRTG-IGRARAELFEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAW   85 (106)
T ss_dssp             CGGGCGGGSCCCBCTTT-CCSSSTTHHHHHHHHTTCCCCSTTCTTCCEEEECSSSCHHHHHHHTTCSSCCSSCEEEEHHH
T ss_pred             CHHHCCCCEEEEEEECC-CCHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEECHHH
T ss_conf             22340188089999579-98367999999999879999817658942999925876346899999864369947987169


Q ss_pred             HHHHHHHH
Q ss_conf             99999882
Q gi|254781172|r  714 FLFLLQQY  721 (731)
Q Consensus       714 f~~ll~~~  721 (731)
                      +.+=+.+.
T Consensus        86 l~dC~~~~   93 (106)
T 2jw5_A           86 LSLCLQER   93 (106)
T ss_dssp             HHHHHHTC
T ss_pred             HHHHHHHC
T ss_conf             99999829