HHsearch results for GI: 254781172 and protein with PDBid: 2nte_A

>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin ligase, antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A
Probab=97.49  E-value=0.00049  Score=48.67  Aligned_cols=80  Identities=16%  Similarity=0.126  Sum_probs=61.3

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC------------------------CEEEEEECCCCCCHH
Q ss_conf             68821686699972588998789999999829849981116------------------------321799778888637
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR------------------------KTDIIIVGDNPGSKL  698 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk------------------------kT~~LI~ge~~gSKl  698 (731)
                      ....|+|.+|+++|.+....|++++++|+..||++.++..+                        .+++++.........
T Consensus       101 ~~~lf~g~~~~~~~~~~~~~~~~l~~li~~~Gg~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~  180 (210)
T 2nte_A          101 LPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHP  180 (210)
T ss_dssp             CCCTTTTCEEEECSCCSSSCHHHHHHHHHHTTCEEESSCCCGGGCGGGSSCCCCTTSCTTCGGGTCCEEEEECSCSSCCC
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEEEEECCCCHHHH
T ss_conf             76433785899945888848999999999789999825666432234665325522457855344204776232224799


Q ss_pred             HHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             989974991737999999998828
Q gi|254781172|r  699 EKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       699 ~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      ..|...++++++.+.+.+=|..+.
T Consensus       181 ~~~~~~~~~~V~~~Wl~dcI~~~~  204 (210)
T 2nte_A          181 ERVRQGKVWKAPSSWFIDCVMSFE  204 (210)
T ss_dssp             SCSEETTEEEEEHHHHHHHHHHTS
T ss_pred             HHHHCCCCEEECHHHHHHHHHHCC
T ss_conf             999809997977999999999198