HHsearch results for GI: 254781172 and protein with PDBid: 2nte_A

>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin ligase, antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A
Probab=96.58  E-value=0.0037  Score=41.95  Aligned_cols=73  Identities=18%  Similarity=0.061  Sum_probs=53.3

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCC---CCHHHHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             8669997258899878999999982984998111632179977888---8637989974991737999999998828
Q gi|254781172|r  649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP---GSKLEKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       649 gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~---gSKl~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      |..||.|| |+.=.+++++++++.+||++.++++.++++||++...   .-|+..|-..|++|++.+.+.+-+....
T Consensus         2 ~lv~~~sg-l~~~e~~~l~~~i~~lgg~~~~~~~~~~THli~~~~~~~rt~K~l~al~~g~~IV~~~Wl~~~~~~~~   77 (210)
T 2nte_A            2 PLVLIGSG-LSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKV   77 (210)
T ss_dssp             CCEEEESS-CCHHHHHHHHHHHHHTTCEEESSCCTTCCEEEESSSSCCCSHHHHHHHHTTCEEEETHHHHHHHHHTS
T ss_pred             CEEEEECC-CCHHHHHHHHHHHHHCCCEEECCCCCCCCEEEEECCCCCCCHHHHHHHHCCCEEEECHHHHHHHHCCC
T ss_conf             88999769-89899999999999829999485589988899807754342999999875993995318999987398