HHsearch results for GI: 254781172 and protein with PDBid: 3c65_A

>3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus}
Probab=97.21  E-value=4.1e-05  Score=57.03  Aligned_cols=50  Identities=22%  Similarity=0.260  Sum_probs=45.2

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0101111689999998829989999978977612511778761388867899999999966
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ  617 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~  617 (731)
                      ..|||||+++++.|.++|+|++++..+          +.++|.++ |||+++|+.|.+||+
T Consensus       176 d~I~GIG~~~~~~Ll~~Fgs~~~i~~A----------s~eeL~~v-gI~~~~A~~I~~~l~  225 (226)
T 3c65_A          176 DDIPGVGEKRKKALLNYFGSVKKMKEA----------TVEELQRA-NIPRAVAEKIYEKLH  225 (226)
T ss_dssp             -------------------------------------------------------------
T ss_pred             CCCCCCCHHHHHHHHHHCCCHHHHHHC----------CHHHHHHC-CCCHHHHHHHHHHHC
T ss_conf             026886999999999981899999738----------99999876-999999999999962