HHsearch results for GI: 254781172 and protein with PDBid: 3ef0_A

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}
Probab=98.55  E-value=2.5e-07  Score=74.20  Aligned_cols=79  Identities=19%  Similarity=0.308  Sum_probs=68.2

Q ss_pred             CCCCCCCCEEEEECCCC---CCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCC-CEEECHHHHHHHH
Q ss_conf             68821686699972588---9987899999998298499811163217997788886379899749-9173799999999
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQ---KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG-VKIMNEEQFLFLL  718 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~---~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~Lg-I~Ii~e~ef~~ll  718 (731)
                      ....|.|.+|||||.++   +..|.++..+++.+||+++++|+.+|++||+++..+.|..+|++.| |+|++.+.+..=+
T Consensus       279 r~~~L~g~~i~~Sg~~p~~~~~~~~~~~~~~~~~Ga~~~~~~~~~~THlV~~~~~t~K~~~A~~~~~i~iV~~~WL~~c~  358 (372)
T 3ef0_A          279 KQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESL  358 (372)
T ss_dssp             HTTTSTTCEEEEESSSCTTSCTTTSHHHHHHHHTTCEEESSSSSCCSEEEECSCCCHHHHHHHHSSSCCEEEHHHHHHHH
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCEEECCCCCCCCEEEECCCCCHHHHHHHHCCCCEEECHHHHHHHH
T ss_conf             00114896899477305899840649999999779999485699950899689997899999875998898899999999


Q ss_pred             HHH
Q ss_conf             882
Q gi|254781172|r  719 QQY  721 (731)
Q Consensus       719 ~~~  721 (731)
                      ...
T Consensus       359 ~~~  361 (372)
T 3ef0_A          359 SQW  361 (372)
T ss_dssp             HTT
T ss_pred             HHC
T ss_conf             968