HHsearch results for GI: 254781172 and protein with PDBid: 3l41_A

>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A*
Probab=96.80  E-value=0.00032  Score=50.16  Aligned_cols=84  Identities=12%  Similarity=0.100  Sum_probs=59.5

Q ss_pred             CCCCCCCCEEEEECCCCCC-CHHHHHHHHHHCCCEEEEEE----------ECCEEEEEECCCCC---CHHH--HHHHCCC
Q ss_conf             6882168669997258899-87899999998298499811----------16321799778888---6379--8997499
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKI-QRHKAQEYVTQLGAVVSAIL----------SRKTDIIIVGDNPG---SKLE--KAQQLGV  706 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~-~R~e~~~~ie~~Ggkv~sSV----------SkkT~~LI~ge~~g---SKl~--KA~~LgI  706 (731)
                      ....|.|.+|+++|..... ++++++.+|+..||++.+..          +..+.++|+.++..   .+..  .++..+|
T Consensus       110 ~~~lF~g~~~~i~~~~~~~~~~~~l~~li~~~Gg~v~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~~~~~i  189 (220)
T 3l41_A          110 GPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTI  189 (220)
T ss_dssp             CSCTTTTSEEEEETTSSCGGGHHHHHHHHHHTTCEEEEECSCCHHHHHHHHHCCEEEEECGGGHHHHTTTHHHHTTCTTE
T ss_pred             CCCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCC
T ss_conf             75423782899954888873499999999978988970356643112345788518998276323414899998756898


Q ss_pred             EEECHHHHHHHHHHHCCCCC
Q ss_conf             17379999999988286568
Q gi|254781172|r  707 KIMNEEQFLFLLQQYNTTLR  726 (731)
Q Consensus       707 ~Ii~e~ef~~ll~~~~~~~~  726 (731)
                      ++++.+.|++-|-.+.-+.+
T Consensus       190 ~vv~~eWl~dsIl~q~l~~~  209 (220)
T 3l41_A          190 FLQNYDWLIKTVLRQEIDVN  209 (220)
T ss_dssp             EEEEHHHHHHHHHHTCCCTT
T ss_pred             EEECHHHHHHHHHHCCCCCC
T ss_conf             59879999999986783851