Query         gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 731
No_of_seqs    179 out of 2993
Neff          6.4 
Searched_HMMs 23785
Date          Wed Jun  1 02:14:37 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781172.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2owo_A DNA ligase; protein/DNA 100.0       0       0 1548.7  49.8  664   14-719     1-670 (671)
  2 1dgs_A DNA ligase; AMP complex 100.0       0       0 1473.9  45.8  661   12-726     1-666 (667)
  3 1ta8_A DNA ligase, NAD-depende 100.0       0       0  684.5  30.6  325    9-342     3-328 (332)
  4 1b04_A Protein (DNA ligase); D 100.0       0       0  672.4  28.7  317   12-338     1-318 (318)
  5 1zau_A DNA ligase; AMP; HET: D 100.0       0       0  680.8  19.4  319    8-333     4-328 (328)
  6 3jsl_A DNA ligase; NAD+-depend 100.0       0       0  665.2  27.3  313   14-336     1-314 (318)
  7 3bac_A DNA ligase; adenylation 100.0       0       0  565.9  21.0  263   80-343     1-266 (270)
  8 1vq8_Y 50S ribosomal protein L  99.9 9.4E-30 3.9E-34  247.6 -24.8  220  469-720     8-241 (241)
  9 2k6g_A Replication factor C su  99.8 1.5E-19 6.3E-24  168.6  10.6   82  640-721    26-108 (109)
 10 2ebu_A Replication factor C su  99.8 3.1E-19 1.3E-23  166.2  10.2   88  639-726    15-103 (112)
 11 1l7b_A DNA ligase; BRCT, autos  99.7 3.7E-18 1.5E-22  157.9   7.3   79  642-721     3-81  (92)
 12 2cok_A Poly [ADP-ribose] polym  99.4 4.8E-13   2E-17  118.4   6.0   78  641-719     5-85  (113)
 13 2vug_A PAB1020; RNA, ligase, A  99.0 8.1E-09 3.4E-13   85.7  12.7  147  125-308    94-242 (389)
 14 2a1j_B DNA excision repair pro  98.9 6.8E-10 2.8E-14   94.0   4.9   74  536-619    12-87  (91)
 15 1z00_A DNA excision repair pro  98.9 3.1E-09 1.3E-13   89.0   6.5   67  543-619     7-74  (89)
 16 2xnk_A DNA topoisomerase 2-bin  98.7 1.3E-09 5.3E-14   91.9   0.5   79  643-722   198-277 (292)
 17 1x2i_A HEF helicase/nuclease;   98.7 6.9E-09 2.9E-13   86.2   4.1   70  543-622     2-72  (75)
 18 1x9n_A DNA ligase I; 5'-adenyl  98.7 1.4E-06 6.1E-11   68.3  15.8  247   93-382   310-577 (688)
 19 3ef1_A RNA polymerase II subun  98.7 4.1E-08 1.7E-12   80.3   7.7   78  644-721   350-431 (442)
 20 3c1y_A DNA integrity scanning   98.7 5.2E-08 2.2E-12   79.4   7.6  102  503-621   247-372 (377)
 21 2d8m_A DNA-repair protein XRCC  98.6 1.1E-07 4.5E-12   77.0   7.5   79  643-722    19-97  (129)
 22 2cfm_A Thermostable DNA ligase  98.6 1.3E-05 5.3E-10   61.0  17.8  221  126-382   242-479 (561)
 23 2hiv_A Thermostable DNA ligase  98.6 1.8E-05 7.4E-10   59.9  18.4  247   92-382   253-517 (621)
 24 3ef0_A RNA polymerase II subun  98.6 2.5E-07   1E-11   74.2   8.1   79  643-721   279-361 (372)
 25 3gde_A DNA ligase; DNA-binding  98.5 1.2E-05 5.1E-10   61.1  15.0  219  127-382   246-479 (558)
 26 3l3e_A DNA topoisomerase 2-bin  98.4   1E-06 4.4E-11   69.4   8.7   81  641-722    10-93  (107)
 27 3l46_A Protein ECT2; alternati  98.4 9.2E-08 3.9E-12   77.5   2.9   78  645-723    20-97  (112)
 28 2cou_A ECT2 protein; BRCT doma  98.3 1.6E-07 6.7E-12   75.7   2.5   79  644-723    10-88  (109)
 29 1wf6_A Similar to S.pombe -RAD  98.3 2.7E-06 1.2E-10   66.1   8.3   80  643-723    37-118 (132)
 30 1cdz_A Protein (DNA-repair pro  98.3 1.4E-06 5.9E-11   68.4   6.1   79  644-722     3-83  (96)
 31 3ii6_X DNA ligase 4; XRCC4, NH  98.3 3.1E-06 1.3E-10   65.7   7.8   79  644-722   162-254 (263)
 32 1kft_A UVRC, excinuclease ABC   98.2   1E-06 4.2E-11   69.5   4.8   51  558-618    28-78  (78)
 33 1vs0_A Putative DNA ligase-lik  98.2   2E-05 8.6E-10   59.4  11.1  209  125-382    24-242 (310)
 34 3l2p_A DNA ligase 3; DNA ligas  98.2 5.2E-05 2.2E-09   56.2  13.0  241   92-382   227-487 (579)
 35 2ebw_A DNA repair protein REV1  98.2 3.9E-06 1.6E-10   64.9   6.6   80  641-723     7-87  (97)
 36 2xnk_A DNA topoisomerase 2-bin  98.1 4.4E-06 1.8E-10   64.5   6.4   80  643-723   104-183 (292)
 37 2wt8_A Microcephalin; cell cyc  98.1 1.4E-05 5.8E-10   60.7   8.5   80  643-722     4-86  (97)
 38 1a0i_A DNA ligase; DNA replica  97.9  0.0001 4.3E-09   53.9  10.1  201  127-349    27-258 (348)
 39 2bgw_A XPF endonuclease; hydro  97.9 9.2E-06 3.9E-10   62.1   3.9   53  557-619   165-217 (219)
 40 2vxb_A DNA repair protein RHP9  97.8 8.2E-05 3.4E-09   54.7   7.7   77  644-721   149-236 (241)
 41 1fvi_A Chlorella virus DNA lig  97.7 0.00025   1E-08   51.0   8.6  177  126-351    19-208 (297)
 42 2a1j_A DNA repair endonuclease  97.6 2.5E-05 1.1E-09   58.7   3.4   52  557-619     7-58  (63)
 43 1z00_B DNA repair endonuclease  97.6 5.9E-05 2.5E-09   55.8   4.5   57  551-620    17-73  (84)
 44 2dun_A POL MU, DNA polymerase   97.5 9.7E-05 4.1E-09   54.1   5.1   82  642-723     6-98  (133)
 45 2nte_A BARD-1, BRCA1-associate  97.5 0.00049 2.1E-08   48.7   8.2   80  643-722   101-204 (210)
 46 1t15_A Breast cancer type 1 su  97.5 0.00045 1.9E-08   49.0   7.6   81  643-723   112-202 (214)
 47 2coe_A Deoxynucleotidyltransfe  97.4 0.00037 1.5E-08   49.7   6.9   81  643-723    17-105 (120)
 48 2etx_A Mediator of DNA damage   97.4 0.00043 1.8E-08   49.2   7.2   80  644-724   113-195 (209)
 49 1l0b_A BRCA1; TANDEM-BRCT, thr  97.4 0.00059 2.5E-08   48.1   7.9   79  644-722   115-203 (229)
 50 1kzy_C Tumor suppressor P53-bi  97.3  0.0028 1.2E-07   42.8  10.4   81  642-722   151-242 (259)
 51 2etx_A Mediator of DNA damage   97.3 0.00037 1.6E-08   49.6   5.8   65  651-720    14-79  (209)
 52 1s68_A RNA ligase 2; ribonucle  97.3   0.003 1.2E-07   42.7  10.0  138   96-274     6-155 (249)
 53 3c65_A Uvrabc system protein C  97.2 4.1E-05 1.7E-09   57.0   0.0   50  557-617   176-225 (226)
 54 2nrt_A Uvrabc system protein C  97.1 0.00043 1.8E-08   49.2   4.5   50  557-617   171-220 (220)
 55 1b22_A DNA repair protein RAD5  97.1 0.00018 7.6E-09   52.1   2.5   63  481-557    28-90  (114)
 56 2hvq_A ORF1, hypothetical 37.6  96.8   0.014 6.1E-07   37.3  10.1  140   96-281     7-162 (335)
 57 3l41_A BRCT-containing protein  96.8 0.00032 1.3E-08   50.2   1.5   84  643-726   110-209 (220)
 58 2jw5_A DNA polymerase lambda;   96.8  0.0009 3.8E-08   46.7   3.7   79  642-721     7-93  (106)
 59 1z56_C DNA ligase IV; DNA repa  96.7 2.9E-05 1.2E-09   58.2  -4.3   80  643-722   157-252 (264)
 60 1t15_A Breast cancer type 1 su  96.7  0.0045 1.9E-07   41.3   6.7   69  649-721     4-81  (214)
 61 1kzy_C Tumor suppressor P53-bi  96.6   0.011 4.6E-07   38.3   8.4   10  134-143    16-25  (259)
 62 2nte_A BARD-1, BRCA1-associate  96.6  0.0037 1.5E-07   42.0   5.7   73  649-722     2-77  (210)
 63 1xdn_A RNA editing ligase MP52  96.5   0.031 1.3E-06   34.8  10.1  172   92-283     8-209 (277)
 64 1ixr_A Holliday junction DNA h  96.5  0.0094   4E-07   38.8   7.1   76  522-618    54-129 (191)
 65 2w9m_A Polymerase X; SAXS, DNA  96.4   0.015 6.1E-07   37.3   8.0   26  698-723   530-561 (578)
 66 1cuk_A RUVA protein; DNA repai  96.4  0.0096   4E-07   38.7   6.9   72  522-614    55-126 (203)
 67 2ztd_A Holliday junction ATP-d  96.4   0.016 6.5E-07   37.1   7.9   76  522-618    70-145 (212)
 68 2zj8_A DNA helicase, putative   96.2  0.0053 2.2E-07   40.7   4.8   51  558-618   650-701 (720)
 69 2ihm_A POL MU, DNA polymerase   96.1  0.0059 2.5E-07   40.4   4.7   61  521-581    60-130 (360)
 70 1vq8_Y 50S ribosomal protein L  95.9   0.001 4.3E-08   46.3   0.0   19  523-541    16-34  (241)
 71 1jms_A Terminal deoxynucleotid  95.4  0.0049 2.1E-07   41.0   1.7   62  521-582    79-150 (381)
 72 2fmp_A DNA polymerase beta; nu  95.3   0.023 9.7E-07   35.8   5.1   61  522-582    57-127 (335)
 73 1jms_A Terminal deoxynucleotid  95.3   0.022 9.4E-07   35.9   4.9   95  528-631    55-151 (381)
 74 3kyh_C MRNA-capping enzyme sub  95.1     0.2 8.3E-06   28.6  10.9  167  126-337    65-257 (461)
 75 2ihm_A POL MU, DNA polymerase   94.9   0.007   3E-07   39.8   1.5   83  528-614    36-120 (360)
 76 2zj8_A DNA helicase, putative   94.9   0.015 6.5E-07   37.1   3.2   26  596-621   646-672 (720)
 77 2edu_A Kinesin-like protein KI  94.4   0.095   4E-06   31.0   6.3   66  531-614    23-88  (98)
 78 1imo_A DNA ligase III; paralle  94.3   0.054 2.3E-06   32.9   4.8   75  639-723     9-84  (88)
 79 1l0b_A BRCA1; TANDEM-BRCT, thr  94.3     0.1 4.3E-06   30.7   6.2   68  649-720     7-83  (229)
 80 1kft_A UVRC, excinuclease ABC   94.2   0.013 5.6E-07   37.6   1.5   51  481-543    27-77  (78)
 81 2bcq_A DNA polymerase lambda;   94.2  0.0042 1.8E-07   41.5  -1.1   60  523-582    58-125 (335)
 82 1kea_A Possible G-T mismatches  94.1    0.19   8E-06   28.7   7.3   24  592-615   111-134 (221)
 83 1dgs_A DNA ligase; AMP complex  94.0   0.024   1E-06   35.6   2.6   82  480-576   477-561 (667)
 84 2ziu_A MUS81 protein; helix-ha  93.9   0.099 4.1E-06   30.9   5.5   60  557-618   240-306 (311)
 85 2bcq_A DNA polymerase lambda;   93.9   0.029 1.2E-06   35.0   2.7   25  481-510    99-123 (335)
 86 2w9m_A Polymerase X; SAXS, DNA  93.8   0.025   1E-06   35.5   2.3   44    8-58      4-47  (578)
 87 3bz1_U Photosystem II 12 kDa e  93.5   0.087 3.7E-06   31.3   4.7   44  559-618    38-81  (104)
 88 1s5l_U Photosystem II 12 kDa e  93.3    0.11 4.6E-06   30.5   4.9   24  594-617    87-110 (134)
 89 2owo_A DNA ligase; protein/DNA  93.3   0.047   2E-06   33.4   3.0   86  480-580   482-570 (671)
 90 2abk_A Endonuclease III; DNA-r  93.0    0.37 1.5E-05   26.5   7.2   24  592-615   105-128 (211)
 91 3ii6_X DNA ligase 4; XRCC4, NH  92.8    0.49   2E-05   25.5   7.6   82  641-723     5-87  (263)
 92 1pu6_A 3-methyladenine DNA gly  92.0    0.59 2.5E-05   24.9   7.2   23  593-615   118-140 (218)
 93 2fmp_A DNA polymerase beta; nu  91.6    0.16 6.6E-06   29.3   3.9   82  529-614    33-116 (335)
 94 1orn_A Endonuclease III; DNA r  91.6    0.53 2.2E-05   25.2   6.6   23  593-615   110-132 (226)
 95 3huf_A DNA repair and telomere  91.3    0.73 3.1E-05   24.2   7.6   76  643-723   222-306 (325)
 96 1x2i_A HEF helicase/nuclease;   91.1   0.092 3.9E-06   31.1   2.3   52  482-545    18-69  (75)
 97 1z00_A DNA excision repair pro  91.1   0.067 2.8E-06   32.2   1.6   61  468-544    13-73  (89)
 98 1kg2_A A/G-specific adenine gl  90.9     0.8 3.4E-05   23.8   7.4   24  592-615   105-128 (225)
 99 2csb_A Topoisomerase V, TOP61;  90.7    0.49 2.1E-05   25.5   5.7   51  560-616   417-467 (519)
100 2a1j_B DNA excision repair pro  90.6   0.082 3.4E-06   31.5   1.7   53  480-544    33-86  (91)
101 1a76_A Flap endonuclease-1 pro  90.0     0.6 2.5E-05   24.9   5.6   97  479-584   145-255 (326)
102 1ul1_X Flap endonuclease-1; pr  89.6    0.54 2.3E-05   25.2   5.2   28  557-584   235-262 (379)
103 2ep8_A Pescadillo homolog 1; A  89.6    0.92 3.9E-05   23.4   6.4   74  642-722     8-92  (100)
104 2zix_A Crossover junction endo  89.1   0.071   3E-06   32.0   0.4   61  557-618   236-302 (307)
105 2duy_A Competence protein come  88.6    0.23 9.8E-06   28.0   2.7   23  594-616    51-73  (75)
106 1ckm_A MRNA capping enzyme; nu  88.5     1.2   5E-05   22.6  12.1  152  127-337    76-242 (330)
107 3c65_A Uvrabc system protein C  88.4   0.072   3E-06   32.0   0.0   50  481-543   176-225 (226)
108 1b22_A DNA repair protein RAD5  87.6    0.19 7.8E-06   28.8   1.7   47  559-615    30-77  (114)
109 3fhf_A Mjogg, N-glycosylase/DN  87.6    0.85 3.6E-05   23.7   5.1   23  594-616   123-145 (214)
110 3fhg_A Mjogg, N-glycosylase/DN  87.4    0.42 1.8E-05   26.0   3.4   25  593-617   114-138 (207)
111 1pzn_A RAD51, DNA repair and r  87.3    0.23 9.7E-06   28.0   2.0   55  479-544    36-90  (349)
112 1a4i_A Methylenetetrahydrofola  87.2    0.84 3.5E-05   23.7   4.9   14  484-497   273-286 (301)
113 1ngn_A Methyl-CPG binding prot  87.1    0.98 4.1E-05   23.2   5.2   25  594-618   102-126 (155)
114 1rxw_A Flap structure-specific  87.0     1.4 5.8E-05   22.0   5.9   28  557-584   238-265 (336)
115 3p2o_A Bifunctional protein fo  86.7    0.46 1.9E-05   25.7   3.3   13  485-497   263-275 (285)
116 2a1j_A DNA repair endonuclease  86.3    0.14   6E-06   29.6   0.6   52  481-545     7-58  (63)
117 1exn_A 5'-exonuclease, 5'-nucl  86.0    0.44 1.8E-05   25.9   2.9   17  481-497   206-222 (290)
118 1cuk_A RUVA protein; DNA repai  86.0    0.33 1.4E-05   26.8   2.3   19  523-541    74-92  (203)
119 2i1q_A DNA repair and recombin  85.9    0.27 1.2E-05   27.5   1.8   10   43-52     44-53  (322)
120 3gfk_B DNA-directed RNA polyme  85.8    0.38 1.6E-05   26.4   2.5   53  481-544    18-70  (79)
121 1z3e_B DNA-directed RNA polyme  85.4    0.36 1.5E-05   26.5   2.2   53  481-544    11-63  (73)
122 2ztd_A Holliday junction ATP-d  85.3     0.4 1.7E-05   26.2   2.4   55  480-543    90-144 (212)
123 2c2x_A Methylenetetrahydrofola  84.9    0.81 3.4E-05   23.8   3.8   14  484-497   260-273 (281)
124 1p16_A GTP--RNA, mRNA capping   84.3     1.9 7.9E-05   21.0  13.6  160  127-338    61-250 (395)
125 3k4g_A DNA-directed RNA polyme  83.9    0.52 2.2E-05   25.3   2.5   53  481-544    14-66  (86)
126 3l07_A Bifunctional protein fo  83.8     1.4 5.9E-05   22.0   4.7   13  485-497   263-275 (285)
127 1z00_B DNA repair endonuclease  83.4    0.28 1.2E-05   27.4   0.9   52  481-545    21-72  (84)
128 2nrt_A Uvrabc system protein C  82.9    0.27 1.1E-05   27.5   0.7   23  598-620   170-192 (220)
129 2izo_A FEN1, flap structure-sp  82.4    0.28 1.2E-05   27.4   0.6   28  558-585   238-265 (346)
130 1u9l_A Transcription elongatio  82.2     2.3 9.5E-05   20.4   6.2   53  549-614     4-57  (70)
131 1coo_A RNA polymerase alpha su  82.1    0.82 3.4E-05   23.8   2.9   52  481-543    26-77  (98)
132 3hn7_A UDP-N-acetylmuramate-L-  80.8     2.4  0.0001   20.2   4.9   18  298-315   251-269 (524)
133 3n5n_X A/G-specific adenine DN  80.3     2.6 0.00011   19.9   6.9   16  600-615   133-148 (287)
134 1b0a_A Protein (fold bifunctio  80.0    0.89 3.7E-05   23.5   2.5   13  485-497   262-274 (288)
135 2ziu_B Crossover junction endo  78.3     2.9 0.00012   19.5   4.9   61  557-618   258-330 (341)
136 1wcn_A Transcription elongatio  78.0    0.84 3.5E-05   23.7   1.9   48  481-539    10-57  (70)
137 2va8_A SSO2462, SKI2-type heli  77.8       3 0.00013   19.4   6.4   18  396-413   397-414 (715)
138 1nnq_A Rubrerythrin; structura  77.6    0.52 2.2E-05   25.3   0.7   11  466-476    20-30  (171)
139 2bgw_A XPF endonuclease; hydro  77.5    0.57 2.4E-05   25.0   0.9   21  598-618   164-184 (219)
140 3i0w_A 8-oxoguanine-DNA-glycos  76.4     3.3 0.00014   19.1   5.2   22  594-615   209-230 (290)
141 1vdd_A Recombination protein R  75.8     3.4 0.00014   19.0   6.4   23  552-574   136-158 (228)
142 2c5u_A RNA ligase, T4 RNA liga  75.4     1.3 5.4E-05   22.3   2.2   54   93-156    69-122 (375)
143 3eag_A UDP-N-acetylmuramate:L-  73.2     3.9 0.00016   18.5   5.5   13  256-268   124-137 (326)
144 1lko_A Rubrerythrin all-iron(I  72.5    0.93 3.9E-05   23.4   0.9   26  605-630   113-140 (191)
145 3lda_A DNA repair protein RAD5  72.4     1.8 7.6E-05   21.1   2.4   16  257-272    95-110 (400)
146 2p6r_A Afuhel308 helicase; pro  71.3     1.8 7.6E-05   21.1   2.2   18  597-614   633-650 (702)
147 1p91_A Ribosomal RNA large sub  69.8     1.4 5.9E-05   22.0   1.4   22  372-405   157-178 (269)
148 2h56_A DNA-3-methyladenine gly  69.2     3.6 0.00015   18.8   3.4   21  595-615   137-157 (233)
149 2qkd_A Zinc finger protein ZPR  68.5     1.4 5.9E-05   22.0   1.1   19  425-443   214-232 (404)
150 1yuz_A Nigerythrin; rubrythrin  68.0     1.2 5.1E-05   22.5   0.7   12  621-632   152-163 (202)
151 3cng_A Nudix hydrolase; struct  67.3     2.1 8.9E-05   20.6   1.9   27  432-460     4-30  (189)
152 1j6u_A UDP-N-acetylmuramate-al  67.2     5.1 0.00022   17.6   7.1   10  150-159   117-126 (469)
153 1m3q_A 8-oxoguanine DNA glycos  66.6     5.3 0.00022   17.5   4.5   22  594-615   228-249 (317)
154 2a6h_A DNA-directed RNA polyme  66.3    0.99 4.2E-05   23.1   0.0   52  482-544   257-308 (315)
155 3noy_A 4-hydroxy-3-methylbut-2  66.2     2.6 0.00011   19.9   2.1   60  395-475   234-298 (366)
156 2z43_A DNA repair and recombin  65.8       1 4.3E-05   23.0   0.0   12  258-269    25-36  (324)
157 2bln_A Protein YFBG; transfera  65.5     5.4 0.00023   17.5   3.6   23   89-112    50-72  (305)
158 2hc8_A PACS, cation-transporti  64.8     2.2 9.1E-05   20.5   1.5   24  393-418    28-51  (113)
159 2vl6_A SSO MCM N-TER, minichro  62.5     1.6 6.8E-05   21.5   0.5   40  401-440   125-177 (268)
160 2kp7_A Crossover junction endo  61.9     5.6 0.00023   17.3   3.2   23  594-616    56-78  (87)
161 1l8d_A DNA double-strand break  59.9       2 8.2E-05   20.9   0.5   11  432-442    48-58  (112)
162 1d8b_A SGS1 RECQ helicase; fiv  59.8     6.9 0.00029   16.6   4.2   35  591-631    43-77  (81)
163 2qq5_A DHRS1, dehydrogenase/re  59.6       4 0.00017   18.5   2.1   12  153-164    11-22  (260)
164 1b43_A Protein (FEN-1); nuclea  58.2     2.5 0.00011   20.0   0.9   15  483-497   242-256 (340)
165 1vk6_A NADH pyrophosphatase; 1  57.9     3.5 0.00015   18.9   1.6   12  432-443   108-119 (269)
166 1bgx_T TAQ DNA polymerase; DNA  57.1    0.18 7.7E-06   28.8  -5.1   16  253-268   265-280 (832)
167 2bw0_A 10-FTHFDH, 10-formyltet  56.6     7.7 0.00032   16.3   4.6   14  399-412   101-114 (329)
168 3ioy_A Short-chain dehydrogena  56.6     7.7 0.00032   16.3   3.4   16  151-166    12-27  (319)
169 2gdz_A NAD+-dependent 15-hydro  55.5     7.7 0.00032   16.3   3.0   11  647-657   240-250 (267)
170 3lu0_A DNA-directed RNA polyme  55.5       2 8.4E-05   20.8   0.0   49  485-544   261-309 (329)
171 3kvo_A Hydroxysteroid dehydrog  55.0     5.8 0.00024   17.2   2.3   15  152-166    50-64  (346)
172 2x5o_A UDP-N-acetylmuramoylala  54.1     8.4 0.00035   16.0   8.1   27  649-675   404-438 (439)
173 1yxm_A Pecra, peroxisomal tran  54.1     7.6 0.00032   16.3   2.8   16  151-166    22-37  (303)
174 2hl7_A Cytochrome C-type bioge  52.7     4.5 0.00019   18.0   1.4   47  432-499    27-73  (84)
175 3gqc_A DNA repair protein REV1  51.9     8.5 0.00036   15.9   2.7   48  481-541   318-365 (504)
176 3icc_A Putative 3-oxoacyl-(acy  51.5     7.1  0.0003   16.5   2.3   13  102-114    67-79  (255)
177 1yde_A Retinal dehydrogenase/r  51.3     9.1 0.00038   15.7   2.8   13  645-657   236-248 (270)
178 2gmg_A Hypothetical protein PF  51.2     3.7 0.00015   18.7   0.8   20  421-440    57-76  (105)
179 1bdb_A CIS-biphenyl-2,3-dihydr  50.4     8.3 0.00035   16.0   2.5   13  153-165    11-23  (277)
180 2f00_A UDP-N-acetylmuramate--L  50.2     9.5  0.0004   15.5   7.9   27  649-678   457-483 (491)
181 1uzm_A 3-oxoacyl-[acyl-carrier  50.0     8.5 0.00036   15.9   2.5   15  644-658   229-243 (247)
182 1iy8_A Levodione reductase; ox  49.9     8.8 0.00037   15.8   2.6   14  644-657   249-262 (267)
183 1a87_A Colicin N; bacteriocin,  49.4     7.1  0.0003   16.5   2.0   23  133-156    61-84  (321)
184 1ja9_A 4HNR, 1,3,6,8-tetrahydr  48.8     8.5 0.00036   15.9   2.3   12  645-656   260-271 (274)
185 2a4k_A 3-oxoacyl-[acyl carrier  48.7     9.9 0.00042   15.4   2.7   15  645-659   226-240 (263)
186 3edm_A Short chain dehydrogena  48.0      10 0.00043   15.3   2.7   14  645-658   235-248 (259)
187 2d1y_A Hypothetical protein TT  47.1      11 0.00044   15.2   5.8   15  644-658   231-245 (256)
188 2r6f_A Excinuclease ABC subuni  47.1      11 0.00044   15.2   3.4   15  602-616   877-891 (972)
189 2fwm_X 2,3-dihydro-2,3-dihydro  46.1      11 0.00045   15.1   2.5   15  644-658   232-246 (250)
190 3d8t_A Uroporphyrinogen-III sy  45.5      11 0.00047   15.0   3.8   16  401-416   159-174 (286)
191 1hdc_A 3-alpha, 20 beta-hydrox  45.4      11 0.00047   15.0   2.5   14  645-658   229-242 (254)
192 3m7n_A Putative uncharacterize  45.2      11 0.00047   15.0   5.6   61  393-472   110-170 (179)
193 2ag5_A DHRS6, dehydrogenase/re  45.2      11 0.00045   15.1   2.4   15  644-658   229-243 (246)
194 1vmc_A Stromal cell-derived fa  45.1     3.9 0.00016   18.6   0.1   48  424-476     2-49  (71)
195 3h9i_A Cation efflux system pr  45.0     3.7 0.00016   18.7   0.0   12  393-404   305-316 (407)
196 3gvc_A Oxidoreductase, probabl  44.9      11 0.00048   15.0   2.8   13  645-657   259-271 (277)
197 2jhn_A ALKA, 3-methyladenine D  44.7      11 0.00048   14.9   3.0   21  595-615   209-229 (295)
198 1v5w_A DMC1, meiotic recombina  44.5     3.2 0.00013   19.3  -0.4   51  258-310   174-229 (343)
199 1k3x_A Endonuclease VIII; hydr  44.1       6 0.00025   17.1   1.0   10  434-443   237-246 (262)
200 1ltl_A DNA replication initiat  43.9     3.7 0.00016   18.7  -0.1   13  403-415   120-132 (279)
201 1mhs_A Proton pump, plasma mem  43.9     9.9 0.00042   15.4   2.1   12  183-194   248-259 (920)
202 3ndi_A Methyltransferase; S-ad  43.7       5 0.00021   17.7   0.5   17  663-679   389-408 (416)
203 3d3w_A L-xylulose reductase; u  43.6      12  0.0005   14.8   2.7   14  644-657   227-240 (244)
204 2k5c_A Uncharacterized protein  43.4       5 0.00021   17.7   0.5   14  431-444     8-21  (95)
205 3i1j_A Oxidoreductase, short c  43.3      12  0.0005   14.8   2.5   14  152-165    19-32  (247)
206 1zem_A Xylitol dehydrogenase;   43.3      12  0.0005   14.8   2.9   13  644-656   249-261 (262)
207 2apo_B Ribosome biogenesis pro  43.2       8 0.00034   16.1   1.5   22  423-444    10-31  (60)
208 1wr2_A Hypothetical protein PH  42.7      12 0.00051   14.7   3.5   44  253-307    21-64  (238)
209 3ctm_A Carbonyl reductase; alc  42.4      12 0.00052   14.7   2.9   13  645-657   263-275 (279)
210 2h7i_A Enoyl-[acyl-carrier-pro  42.1      12 0.00052   14.7   3.3   15  644-658   250-264 (269)
211 1k2w_A Sorbitol dehydrogenase;  42.1      10 0.00044   15.2   1.9   14  644-657   239-252 (256)
212 1zk4_A R-specific alcohol dehy  42.0      12 0.00052   14.6   2.4   15  644-658   234-248 (251)
213 1sby_A Alcohol dehydrogenase;   42.0      12 0.00052   14.6   2.4   12  153-164    11-22  (254)
214 1jx4_A DNA polymerase IV (fami  41.4     9.9 0.00042   15.4   1.8   46  482-540   182-227 (352)
215 3na7_A HP0958; flagellar bioge  41.4      10 0.00043   15.3   1.8   17  431-447   222-238 (256)
216 1wpg_A Sarcoplasmic/endoplasmi  41.3     9.7 0.00041   15.5   1.7   13  182-194   210-222 (994)
217 1tdz_A Formamidopyrimidine-DNA  41.3     7.1  0.0003   16.6   1.0   11  434-444   246-256 (272)
218 2zkr_y 60S ribosomal protein L  41.1     4.6 0.00019   18.0   0.0   57  452-513    31-88  (135)
219 3gpu_A DNA glycosylase; DNA gl  40.9     7.2  0.0003   16.5   1.0   22  434-459   231-252 (256)
220 2fiy_A Protein FDHE homolog; F  40.7     6.2 0.00026   17.0   0.6   11  431-441   182-192 (309)
221 2aus_D NOP10, ribosome biogene  40.6     8.6 0.00036   15.9   1.3   21  424-444    10-30  (60)
222 2pk7_A Uncharacterized protein  40.5     8.8 0.00037   15.8   1.4   15  433-447    10-24  (69)
223 3bqs_A Uncharacterized protein  40.3      13 0.00055   14.5   2.5   28  480-512     6-33  (93)
224 2q2v_A Beta-D-hydroxybutyrate   40.3      13 0.00055   14.5   2.3   15  644-658   238-252 (255)
225 2kij_A Copper-transporting ATP  39.8     8.5 0.00036   15.9   1.2   25  393-419    40-64  (124)
226 2kpi_A Uncharacterized protein  39.6     9.2 0.00039   15.7   1.3   15  433-447    12-26  (56)
227 2hf1_A Tetraacyldisaccharide-1  39.6     8.8 0.00037   15.8   1.2   16  432-447     9-24  (68)
228 2hu9_A MERP, mercuric transpor  39.4      12 0.00049   14.9   1.8   37  433-476     3-49  (130)
229 2jr6_A UPF0434 protein NMA0874  39.3     8.9 0.00038   15.8   1.2   16  432-447     9-24  (68)
230 1xkq_A Short-chain reductase f  39.2      14 0.00057   14.3   2.3   12  646-657   250-261 (280)
231 3grp_A 3-oxoacyl-(acyl carrier  39.1      14 0.00058   14.3   2.3   15  644-658   249-263 (266)
232 3imf_A Short chain dehydrogena  39.0      13 0.00054   14.5   2.0   14  645-658   237-250 (257)
233 1w6u_A 2,4-dienoyl-COA reducta  38.5      14 0.00059   14.3   4.1   16  151-166    30-45  (302)
234 2riq_A Poly [ADP-ribose] polym  38.4     6.8 0.00029   16.7   0.5   18   20-37     16-33  (160)
235 2bgk_A Rhizome secoisolaricire  38.2      14 0.00059   14.2   3.0   17  100-116    72-88  (278)
236 3bq0_A POL IV, DBH, DNA polyme  38.2      12  0.0005   14.8   1.7   46  482-540   183-228 (354)
237 1gee_A Glucose 1-dehydrogenase  38.1      14  0.0006   14.2   2.2   16  644-659   236-251 (261)
238 2zat_A Dehydrogenase/reductase  38.0      14  0.0006   14.2   2.3   15  644-658   242-256 (260)
239 3ek2_A Enoyl-(acyl-carrier-pro  38.0      14  0.0006   14.2   3.2   14  645-658   246-259 (271)
240 1lva_A Selenocysteine-specific  37.8      14  0.0006   14.2   5.1   62  488-560   107-170 (258)
241 2hq1_A Glucose/ribitol dehydro  37.8      14 0.00059   14.2   2.1   15  644-658   231-245 (247)
242 1cyd_A Carbonyl reductase; sho  37.7      14  0.0006   14.2   2.7   14  644-657   227-240 (244)
243 3ijr_A Oxidoreductase, short c  37.7      14  0.0006   14.2   3.8   15  152-166    52-66  (291)
244 3cxt_A Dehydrogenase with diff  37.6      14 0.00061   14.2   2.8   15  644-658   267-281 (291)
245 1nff_A Putative oxidoreductase  37.5      14 0.00061   14.1   3.0   17  100-116    61-77  (260)
246 1hxh_A 3BETA/17BETA-hydroxyste  37.4      14 0.00061   14.1   2.4   12  646-657   236-247 (253)
247 2z1n_A Dehydrogenase; reductas  37.3      15 0.00061   14.1   2.5   14  644-657   244-257 (260)
248 1gz6_A Estradiol 17 beta-dehyd  37.2      15 0.00061   14.1   2.1   16  151-166    13-28  (319)
249 2dtx_A Glucose 1-dehydrogenase  37.0      15 0.00062   14.1   2.6   15  644-658   232-246 (264)
250 1h5q_A NADP-dependent mannitol  36.9      15 0.00062   14.1   2.1   15  151-165    18-32  (265)
251 2jny_A Uncharacterized BCR; st  36.7      10 0.00044   15.2   1.2   15  433-447    12-26  (67)
252 3is3_A 17BETA-hydroxysteroid d  36.4      15 0.00063   14.0   2.5   14  644-657   255-268 (270)
253 1e7l_A GP49, recombination end  36.3      13 0.00055   14.5   1.7   10  432-441    21-30  (157)
254 3ksu_A 3-oxoacyl-acyl carrier   36.1      13 0.00055   14.5   1.7   14  102-115    73-86  (262)
255 1uls_A Putative 3-oxoacyl-acyl  36.1      15 0.00064   14.0   2.7   13  645-657   225-237 (245)
256 2zxe_A Na, K-ATPase alpha subu  35.7      13 0.00056   14.4   1.7   11  141-151   175-185 (1028)
257 1xg5_A ARPG836; short chain de  35.6      15 0.00065   13.9   2.6   20  473-494   186-205 (279)
258 2js4_A UPF0434 protein BB2007;  35.6      11 0.00046   15.1   1.2   16  432-447     9-24  (70)
259 3afn_B A1-R, 4-deoxy-L-erythro  35.5      15 0.00065   13.9   2.2   12  646-657   243-254 (258)
260 2f9i_B Acetyl-coenzyme A carbo  35.4     7.7 0.00032   16.3   0.4   16  429-444    24-43  (285)
261 3e03_A Short chain dehydrogena  35.4      15 0.00065   13.9   2.7   22  145-167     5-26  (274)
262 1o5i_A 3-oxoacyl-(acyl carrier  35.3      16 0.00065   13.9   2.8   19  644-662   230-248 (249)
263 2pnf_A 3-oxoacyl-[acyl-carrier  35.0      16 0.00066   13.9   2.1   13  645-657   234-246 (248)
264 3n74_A 3-ketoacyl-(acyl-carrie  34.9      16 0.00066   13.9   2.5   16  644-659   240-255 (261)
265 2b4q_A Rhamnolipids biosynthes  34.7      16 0.00067   13.8   2.7   14  644-657   260-273 (276)
266 1dm9_A Hypothetical 15.5 KD pr  34.6      13 0.00054   14.5   1.4   20  393-412    47-66  (133)
267 3h7a_A Short chain dehydrogena  34.1      16 0.00068   13.8   2.8   12  153-164    13-24  (252)
268 1fmc_A 7 alpha-hydroxysteroid   33.5      16 0.00066   13.9   1.8   14  644-657   236-249 (255)
269 2ae2_A Protein (tropinone redu  33.1      17  0.0007   13.7   2.8   15  644-658   240-254 (260)
270 1x1t_A D(-)-3-hydroxybutyrate   33.0      17 0.00071   13.6   1.9   15  644-658   243-257 (260)
271 2p1z_A Phosphoribosyltransfera  33.0      17 0.00071   13.6   5.2   54  646-710   111-170 (180)
272 3e1s_A Exodeoxyribonuclease V,  33.0      11 0.00045   15.2   0.8   13  256-268   223-235 (574)
273 2c07_A 3-oxoacyl-(acyl-carrier  32.8      15 0.00062   14.1   1.5   14  645-658   270-283 (285)
274 1xq1_A Putative tropinone redu  32.7      17 0.00071   13.6   1.9   13  645-657   242-254 (266)
275 3gr6_A Enoyl-[acyl-carrier-pro  32.5      17 0.00072   13.6   3.5   15  644-658   242-256 (260)
276 1g0o_A Trihydroxynaphthalene r  32.1      17 0.00073   13.5   2.1   13  645-657   268-280 (283)
277 2o2s_A Enoyl-acyl carrier redu  32.0      17 0.00073   13.5   2.7   16  644-659   278-293 (315)
278 2wsb_A Galactitol dehydrogenas  32.0      17 0.00073   13.5   2.7   15  644-658   237-251 (254)
279 3ftp_A 3-oxoacyl-[acyl-carrier  32.0      17 0.00073   13.5   2.2   14  644-657   253-266 (270)
280 3f1l_A Uncharacterized oxidore  31.9      17 0.00073   13.5   3.0   15  151-165    16-30  (252)
281 2raq_A Conserved protein MTH88  31.7      18 0.00074   13.5   6.5   41  646-693    47-87  (97)
282 1ekr_A Molybdenum cofactor bio  31.7      18 0.00074   13.5   1.9   47  344-408   104-150 (161)
283 2rhf_A DNA helicase RECQ; HRDC  31.5      18 0.00074   13.5   4.3   24  591-614    42-65  (77)
284 1dhr_A Dihydropteridine reduct  31.5      18 0.00074   13.5   2.0   16  151-166    11-26  (241)
285 2x3d_A SSO6206; unknown functi  31.4      18 0.00075   13.4   5.4   43  645-694    45-87  (96)
286 2yzk_A OPRT, oprtase, orotate   30.9      18 0.00076   13.4   5.0   67  645-722   102-174 (178)
287 1oaa_A Sepiapterin reductase;   30.8      17 0.00069   13.7   1.5   14  152-165    11-24  (259)
288 1mpg_A ALKA, 3-methyladenine D  30.6      18 0.00077   13.4   5.9   21  595-615   206-226 (282)
289 3osn_A DNA polymerase IOTA; ho  30.5      12 0.00049   14.8   0.7   47  482-541   238-284 (420)
290 3bpd_A Uncharacterized protein  30.3      18 0.00078   13.3   3.9   42  645-693    46-87  (100)
291 1wwu_A Hypothetical protein FL  30.0      16 0.00066   13.9   1.3   50  481-547    33-82  (99)
292 1yui_A GAGA-factor; complex (D  29.9      11 0.00047   15.0   0.5   12  430-441    23-34  (54)
293 2uvd_A 3-oxoacyl-(acyl-carrier  29.8      19 0.00079   13.3   2.1   13  645-657   231-243 (246)
294 3grk_A Enoyl-(acyl-carrier-pro  29.0      19 0.00081   13.2   3.4   15  644-658   261-275 (293)
295 2f9i_A Acetyl-coenzyme A carbo  28.8      20 0.00082   13.1   2.3   74    1-98      9-82  (327)
296 1d7o_A Enoyl-[acyl-carrier pro  28.8      20 0.00082   13.1   3.2   16  644-659   271-286 (297)
297 1dl6_A Transcription factor II  28.7      19 0.00081   13.2   1.5   34  432-473    12-45  (58)
298 2dok_A Telomerase-binding prot  28.6      20 0.00083   13.1   2.7   30  687-718   154-183 (186)
299 3oec_A Carveol dehydrogenase (  28.5      20 0.00083   13.1   2.7   14  644-657   299-312 (317)
300 3op4_A 3-oxoacyl-[acyl-carrier  28.5      20 0.00083   13.1   2.3   14  644-657   231-244 (248)
301 1z7e_A Protein aRNA; rossmann   28.4      20 0.00083   13.1   5.3   88  298-418   234-336 (660)
302 2f9y_B Acetyl-coenzyme A carbo  28.3      17  0.0007   13.7   1.1   31  530-560   134-166 (304)
303 1wii_A Hypothetical UPF0222 pr  28.2     7.2  0.0003   16.5  -0.7   29  429-459    19-51  (85)
304 2jrp_A Putative cytoplasmic pr  28.1      15 0.00063   14.0   0.9   17  427-443    27-43  (81)
305 1vl8_A Gluconate 5-dehydrogena  27.8      20 0.00085   13.0   2.7   14  644-657   250-263 (267)
306 3jyw_0 60S ribosomal protein L  27.8     9.4 0.00039   15.6  -0.2   56  454-514    17-73  (109)
307 1xu9_A Corticosteroid 11-beta-  27.6      20 0.00086   13.0   2.3   13  533-545   234-246 (286)
308 1e6c_A Shikimate kinase; phosp  27.3      21 0.00087   12.9   1.7   17  557-573     8-25  (173)
309 1qsg_A Enoyl-[acyl-carrier-pro  27.2      21 0.00087   12.9   4.7   14  644-657   240-253 (265)
310 3o9x_A Uncharacterized HTH-typ  27.2     9.8 0.00041   15.4  -0.2   25  508-532    74-98  (133)
311 1p3y_1 MRSD protein; flavoprot  27.0      21 0.00088   12.9   2.4   19  617-635   130-148 (194)
312 3o38_A Short chain dehydrogena  26.9      21 0.00088   12.9   4.9   13  644-656   251-263 (266)
313 2akl_A PHNA-like protein PA012  26.4      20 0.00085   13.0   1.3   12  433-444    29-40  (138)
314 3jyw_O 60S ribosomal protein L  26.4      14 0.00058   14.3   0.5   31  648-678    57-102 (121)
315 2o23_A HADH2 protein; HSD17B10  26.4      21  0.0009   12.8   2.6   14  645-658   246-259 (265)
316 3f9v_A Minichromosome maintena  26.3      21  0.0009   12.8   1.5   20  525-544   398-417 (595)
317 3f9i_A 3-oxoacyl-[acyl-carrier  26.3      21  0.0009   12.8   2.1   15  644-658   232-246 (249)
318 2pd6_A Estradiol 17-beta-dehyd  26.3      21  0.0009   12.8   3.0   15  644-658   241-255 (264)
319 1wud_A ATP-dependent DNA helic  26.2      22  0.0009   12.8   4.3   24  591-614    50-73  (89)
320 2fhd_A RAD9 homolog, DNA repai  26.1       5 0.00021   17.7  -1.9   23  392-418    61-83  (153)
321 1ae1_A Tropinone reductase-I;   26.1      22 0.00091   12.8   2.8   15  644-658   253-267 (273)
322 2wns_A Orotate phosphoribosylt  25.9      22 0.00091   12.8   5.7   63  647-720   109-180 (205)
323 3fac_A Putative uncharacterize  25.9      22 0.00092   12.8   1.8   16  431-446    67-82  (118)
324 3d55_A Antitoxin, uncharacteri  25.8      22 0.00092   12.8   2.4   26  191-221    36-61  (91)
325 3nrc_A Enoyl-[acyl-carrier-pro  25.6      22 0.00092   12.7   3.2   16  644-659   257-272 (280)
326 3n71_A Histone lysine methyltr  25.5      22 0.00093   12.7   1.5   44  393-442   240-284 (490)
327 3e9n_A Putative short-chain de  25.4      22 0.00093   12.7   1.4   13  152-164    10-22  (245)
328 2kdx_A HYPA, hydrogenase/ureas  25.4      16 0.00068   13.8   0.6   10  433-442    75-84  (119)
329 3bzc_A TEX; helix-turn-helix,   25.3      22 0.00093   12.7   3.7   15   97-111    94-108 (785)
330 1t3o_A Carbon storage regulato  25.3     1.4 5.9E-05   22.0  -4.8   52  143-194    16-71  (95)
331 1spx_A Short-chain reductase f  25.3      22 0.00094   12.7   2.2   10  647-656   251-260 (278)
332 3ixz_A Potassium-transporting   25.3      15 0.00062   14.1   0.4   11  183-193   256-266 (1034)
333 2x4h_A Hypothetical protein SS  25.1      22 0.00094   12.7   4.2   48  490-560    51-98  (139)
334 2con_A RUH-035 protein, NIN on  25.1      17 0.00071   13.6   0.7   12  432-443    31-42  (79)
335 3a46_A Formamidopyrimidine-DNA  25.0      22 0.00091   12.8   1.2   13  431-443   259-271 (289)
336 2iih_A Molybdenum cofactor bio  24.6      16 0.00068   13.8   0.5   40  185-227    26-65  (157)
337 3lqk_A Dipicolinate synthase s  24.6      23 0.00096   12.6   3.5   12  257-268    27-38  (201)
338 3ga8_A HTH-type transcriptiona  24.5      18 0.00075   13.4   0.7   10  432-441    37-46  (78)
339 3ojf_A Enoyl-[acyl-carrier-pro  24.1      23 0.00098   12.5   2.7   13  645-657   239-251 (257)
340 3maj_A DNA processing chain A;  23.9      24 0.00099   12.5   3.9   13  150-162    90-102 (382)
341 1s1i_9 L37A, YL35, 60S ribosom  23.8      23 0.00098   12.5   1.2   30  431-469    35-64  (91)
342 2e1f_A Werner syndrome ATP-dep  23.8      24   0.001   12.5   6.1   36  590-631    51-86  (103)
343 2ew8_A (S)-1-phenylethanol deh  23.8      24   0.001   12.5   2.9   15  644-658   232-246 (249)
344 3hcg_A Peptide methionine sulf  23.5      17  0.0007   13.7   0.4   47  433-488    94-140 (146)
345 2odx_A Cytochrome C oxidase po  23.0      18 0.00076   13.4   0.5   11  431-441    56-66  (80)
346 2jne_A Hypothetical protein YF  22.9      19  0.0008   13.2   0.6   18  429-446    30-47  (101)
347 1tev_A UMP-CMP kinase; ploop,   22.6      25   0.001   12.3   1.7   18  557-574     9-27  (196)
348 3k1f_M Transcription initiatio  22.4      13 0.00055   14.5  -0.3   39  428-475    18-59  (197)
349 1v54_F VI, cytochrome C oxidas  22.2      19 0.00079   13.3   0.5   10  431-440    79-88  (98)
350 3m3h_A OPRT, oprtase, orotate   22.2      25  0.0011   12.3   3.3   64  647-720   135-204 (234)
351 2et6_A (3R)-hydroxyacyl-COA de  22.2      25  0.0011   12.3   1.9   12  646-657   534-545 (604)
352 2nn6_I 3'-5' exoribonuclease C  22.0      25  0.0011   12.2   2.3   54  393-460   134-190 (209)
353 2zkr_z 60S ribosomal protein L  21.8      21 0.00088   12.9   0.7   23  431-459    36-58  (92)
354 2rrd_A BLM HRDC domain, HRDC d  21.7      26  0.0011   12.2   5.9   38  589-631    57-94  (101)
355 1a6s_A GAG polyprotein; core p  21.3      23 0.00095   12.6   0.7   26  490-519    29-54  (87)
356 1xmk_A Double-stranded RNA-spe  21.2      26  0.0011   12.1   3.0   22  474-498     3-24  (79)
357 1twf_I B12.6, DNA-directed RNA  21.2      26  0.0011   12.1   1.3   10  431-440    72-81  (122)
358 1wcw_A Uroporphyrinogen III sy  21.0      27  0.0011   12.1   3.7   14  255-268    20-33  (261)
359 3kkl_A Probable chaperone prot  20.9      27  0.0011   12.1   7.3   83  614-702   113-229 (244)
360 3lyl_A 3-oxoacyl-(acyl-carrier  20.8      27  0.0011   12.1   2.3   11  646-656   232-242 (247)
361 1xhl_A Short-chain dehydrogena  20.4      27  0.0011   12.0   2.1   14  645-658   267-280 (297)
362 3gdg_A Probable NADP-dependent  20.2      28  0.0012   12.0   2.6   15  644-658   250-264 (267)
363 2nm0_A Probable 3-oxacyl-(acyl  20.2      28  0.0012   12.0   1.5   15  644-658   235-249 (253)
364 1uf2_K Structural protein P7;   20.0      28  0.0012   11.9   7.7  114  595-719   375-504 (506)
365 2k2w_A Recombination and DNA r  20.0      28  0.0012   11.9   4.3   68  644-714    11-101 (118)

No 1  
>2owo_A DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12}
Probab=100.00  E-value=0  Score=1548.72  Aligned_cols=664  Identities=37%  Similarity=0.663  Sum_probs=628.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             99999999999999999998433177982087899999999999989772031158999962003643235775045166
Q gi|254781172|r   14 IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSI   93 (731)
Q Consensus        14 ~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~~~~~~kv~H~~   93 (731)
                      |+++++||.+|+++|++||++||++++|+|||+|||+|+++|+.||++||+++   +|+||||+||+++..+|.||+|++
T Consensus         1 m~~~~~~i~~L~~~i~~~~~~YY~~~~p~isD~eYD~L~~eL~~le~~~p~~~---~~~spt~~VG~~~~~~~~kv~H~~   77 (671)
T 2owo_A            1 MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDSPTQRVGAAPLAAFSQIRHEV   77 (671)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHTTCSSBCCTHHHHHHHHHHHHHHHCTTSC---CTTSGGGCCSCCCCBCCCEEECSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCCEECCC
T ss_conf             92799999999999999999874499997898999999999999998681556---999986544666267887306897


Q ss_pred             CCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             42570215999999999999998612467776119999415818999998599899888659865566699977531024
Q gi|254781172|r   94 PTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTI  173 (731)
Q Consensus        94 pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~i  173 (731)
                      |||||+|+|+.+||.+|++|+.+.+..  .+...|+||||+||+|++|+|++|+|++|+|||||.+|||||+|+++|++|
T Consensus        78 pMlSL~k~~~~~el~~~~~r~~~~l~~--~~~~~~~~e~KiDGls~~L~Y~~G~l~~a~TRGdG~~GeDvT~n~~~i~~i  155 (671)
T 2owo_A           78 PMLSLDNVFDEESFLAFNKRVQDRLKN--NEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAI  155 (671)
T ss_dssp             CCCCCEEECSHHHHHHHHHHHHHHSSS--CCCCCEEEEEEESSEEEEEEEETTEEEEEECCTTSSEEEBCHHHHHTCTTS
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCC--CCCCEEEEEEECCEEEEEEEEECCEEEEEECCCCCCCCCCHHHHHHHHCCC
T ss_conf             786733559999999999999987364--788228998613527999999899998976479996434847656553157


Q ss_pred             CCCCCC-CCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEECCCC-CCC
Q ss_conf             322335-44550489999998520212345564314854334234567777523455553-011105664102454-332
Q gi|254781172|r  174 PRVLSL-NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTS-EIF  250 (731)
Q Consensus       174 P~~l~~-~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~~~~-~~~  250 (731)
                      |+++.. ++|+.+|||||+||++++|+++|+++.+.|+++|+||||+|||+|||+||..+ .|+|.|++|++.... ...
T Consensus       156 p~~~~~~~~p~~levRGEv~~~~~~f~~~n~~~~~~~~~~faNpRN~aaG~lr~~d~~~~~~r~l~~~~~~~~~~~~~~~  235 (671)
T 2owo_A          156 PLKLHGENIPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL  235 (671)
T ss_dssp             CSBCCSSSCCSEEEEEEEEECCHHHHHHHHHHHHHSSCCCCSCHHHHHHHHHTCSCHHHHHTSCCEEEEEEEEEEESSCC
T ss_pred             CCCCCCCCCCCEEEEEEEEEEEHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             76423357985078876899757667877655430267655457889888750467266645776089981224335778


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECC
Q ss_conf             10000368999975996654148874032113455665531001123437637773110001115876568663123114
Q gi|254781172|r  251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKF  330 (731)
Q Consensus       251 ~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf  330 (731)
                      ..+|++.+.++..|||+++++...+.+.+++..++++|...|..+||+|||+|||+||+.+|+.||+|+|+|||||||||
T Consensus       236 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~R~~l~y~iDGiVikvn~~~~~~~lG~t~~~PrwaiA~Kf  315 (671)
T 2owo_A          236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKF  315 (671)
T ss_dssp             CSBHHHHHHHHHHHTCCCCTTCEEESSHHHHHHHHHHHHHHGGGSSSCEEEEEEEESBHHHHHHHCBCSSSBSSEEEEEC
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHCCCCCCCCCEEEEEEC
T ss_conf             21389999999970887552011011044422467789987630666677259983428889860997889872689840


Q ss_pred             CCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEECCCEEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCH
Q ss_conf             56215899878899403562258999974333026400010148989997502345432224684407689998358702
Q gi|254781172|r  331 AEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVI  410 (731)
Q Consensus       331 ~~e~~~T~v~~I~wqvgRtG~itPva~~ePV~l~G~~V~ratlhN~~~I~~l~~~~~~~~~~~~I~iGd~V~I~RaGdVI  410 (731)
                      |+++++|+|++|+|||||||+|||||+|+||.|+|+||+||||||+++|+++           ||+|||+|.|+||||||
T Consensus       316 ~~~~~~T~v~~I~~qVGRtG~itPva~lePV~l~G~tVsraTLhN~~~I~~~-----------~i~iGd~V~I~raGdVI  384 (671)
T 2owo_A          316 PAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERL-----------GLRIGDKVVIRRAGDVI  384 (671)
T ss_dssp             CCCEEEEEEEEEEEEECTTSBEEEEEEEEEEEETTEEEEEEECCSHHHHHHH-----------TCCBTCEEEEEEETTTE
T ss_pred             CHHHHEEEEEEEEEEECCCCEEEEEEEEEEEEECCEEEEECCCCCHHHHHHC-----------CCCCCCEEEEEECCCCC
T ss_conf             3031346534479984378446379998459824658887133788999976-----------96539878987438866


Q ss_pred             HHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             56654101235787304777043265775010337865445210100354344114466553321301231035410355
Q gi|254781172|r  411 PKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ  490 (731)
Q Consensus       411 P~I~~Vi~~~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GLG~k~  490 (731)
                      |+|++|+++.|+.++.+|.+|++||+||+++++..++      +++||+|+.+||+|++++|.|||||+||||+|||+++
T Consensus       385 PkI~~Vv~~~r~~~~~~~~~p~~CP~c~~~l~~~~~~------~~~~c~n~~~C~aq~~~~i~hF~sk~~mdI~GlG~~~  458 (671)
T 2owo_A          385 PQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI  458 (671)
T ss_dssp             EEEEEECGGGCCSSCBCCCCCSBCTTTCCBEEECTTC------SCEEECCGGGCHHHHHHHHHHHHSTTTTCCTTCCHHH
T ss_pred             CCCEEEEHHHCCCCCCCCCCCCCCCCCCCEEEEECCC------EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHH
T ss_conf             5402300300898887766888899889755774697------3489689876389999999999875313777724899


Q ss_pred             HHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             55653057654045410110106777531000100013421001456899998752234666776301011116899999
Q gi|254781172|r  491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSL  570 (731)
Q Consensus       491 Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~L  570 (731)
                      |++|+++    |+|++|+|||.|+..      +|..++|||+|||+||+++|++||+++|+|||+|||||++|+.+|++|
T Consensus       459 i~~L~~~----G~i~~~~Di~~L~~~------~l~~l~gfg~Ksa~nL~~sIe~sk~~~l~r~L~ALGI~~vG~~~ak~L  528 (671)
T 2owo_A          459 IDQLVEK----EYVHTPADLFKLTAG------KLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGL  528 (671)
T ss_dssp             HHHHHHT----TCCSSGGGGGTCCHH------HHHTSTTCCHHHHHHHHHHHHHHTBCCHHHHHHHTTCTTCCHHHHHHH
T ss_pred             HHHHHHC----CCCCCHHHHHHHHHH------HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCHHHHHHH
T ss_conf             9987365----786888999650177------776654114267899999998750698999998643777547789999


Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCC---CCCCCCCCC
Q ss_conf             98829989999978977612511778761388867899999999966979999999999733877654---322468821
Q gi|254781172|r  571 AKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEI  647 (731)
Q Consensus       571 a~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~~~~~~~~---~~~~~~~~l  647 (731)
                      +++|++++.+..          .+.++|.+|+|||+++|++|.+||+++.|++++++|+..+......   .....+++|
T Consensus       529 a~~f~~l~~l~~----------as~eeL~~I~gIG~~~A~si~~ff~~~~n~~~i~~L~~~G~~~~~~~~~~~~~~~~~l  598 (671)
T 2owo_A          529 AAYFGTLEALEA----------ASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPF  598 (671)
T ss_dssp             HHHHCSHHHHHT----------CCHHHHTTSTTCCHHHHHHHHHHHTCHHHHHHHHHHHHHTCBCCCC------------
T ss_pred             HHHCCCHHHHHC----------CCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             886299999873----------8999996449816999999999974989999999999848885664334543458976


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHH
Q ss_conf             686699972588998789999999829849981116321799778888637989974991737999999998
Q gi|254781172|r  648 ENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ  719 (731)
Q Consensus       648 ~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~  719 (731)
                      +||+|||||+|++|+|+|++++||++||+|+|||||||||||+|+++|||++||++|||+||+|+||++||+
T Consensus       599 ~gk~~ViTG~l~~~~R~e~~~~ie~~Ggkv~ssVSkkTd~Lv~g~~~gSKl~KA~~LgI~Ii~e~ef~~ll~  670 (671)
T 2owo_A          599 AGKTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLLG  670 (671)
T ss_dssp             ------------------------------------------------------------------------
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHCCCEECCCCCCCCCEEEECCCCCCHHHHHHHCCCCEECHHHHHHHHC
T ss_conf             898899940689999899999999779999465247760899899987399999983991843999999867


No 2  
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A*
Probab=100.00  E-value=0  Score=1473.85  Aligned_cols=661  Identities=36%  Similarity=0.624  Sum_probs=618.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCC-CCCCCEEE
Q ss_conf             89999999999999999999984331779820878999999999999897720311589999620036432-35775045
Q gi|254781172|r   12 LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM-NLSLFKVT   90 (731)
Q Consensus        12 ~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~-~~~~~kv~   90 (731)
                      |+.++++++|.+|+++|++||++||++++|+|||++||+|+++|+.||++||++.   +|+|||++||+.+ ...|.||+
T Consensus         1 m~~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~Le~~~p~~~---~~~spt~~vG~~~~~~~~~kv~   77 (667)
T 1dgs_A            1 MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFK---SPDSPTEQVGARPLEPTFRPVR   77 (667)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHTTCCCCSCSSSSHHHHHHHHHHTTSSGGGC---CTTSGGGGCSSSCCCCCCCEEE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCCCEE
T ss_conf             9879999999999999999999986489997898999999999999998680556---9999853247733667876310


Q ss_pred             CCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             16642570215999999999999998612467776119999415818999998599899888659865566699977531
Q gi|254781172|r   91 HSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAI  170 (731)
Q Consensus        91 H~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i  170 (731)
                      |+.|||||+|+|+.+|+.+|++|+.+..    .....|++|||+||+|+ |+|++|+|  +.|||||.+|||||+|+++|
T Consensus        78 H~~pMlSL~k~~~~~el~~w~~ri~k~~----~~~~~~~~e~KlDG~s~-L~Ye~G~l--~~TRGdG~~GeDvT~~~~~i  150 (667)
T 1dgs_A           78 HPTRMYSLDNAFTYEEVLAFEERLEREA----EAPSLYTVEHKVDGLSV-LYYEEGVW--STGSGDGEVGEEVTQNLLTI  150 (667)
T ss_dssp             CSSCCCCCCEECSHHHHHHHHHHTTSSS----CSCCEEEEEECCSCEEE-EEEETTEE--EEEECSSSEEEBCTGGGTSS
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHC----CCCCCEEEEECCCEEEE-EEEECCEE--EEECCCCCCCEEHHHHHHHH
T ss_conf             8987766113799999999999998632----79972798764577899-99949958--99224797570888878766


Q ss_pred             CCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEECCC---
Q ss_conf             02432233544550489999998520212345564314854334234567777523455553-01110566410245---
Q gi|254781172|r  171 PTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKT---  246 (731)
Q Consensus       171 ~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~~~---  246 (731)
                      ++||++|+. .|+.+|||||+||++++|+++|+++.+.|+++|+||||+|||+||++||..+ .|.|.|++|.++..   
T Consensus       151 ~~ip~~i~~-~~~~leiRGEi~~~~~~f~~~n~~~~~~~~~~f~NpRN~aaG~l~~k~~~~~~~r~l~~~~~~~~~~~~~  229 (667)
T 1dgs_A          151 PTIPRRLKG-VPDRLEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGLGLGL  229 (667)
T ss_dssp             TTSCSBCSS-CCSEEEEEEEEECCHHHHHHHHHHHHHHTCCCCSSHHHHHHHHHSCSSHHHHHHSCCEEECCCBCTTTTT
T ss_pred             CCCCHHCCC-CCCCEEECCCEEEEHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHCCCCCHHHHHCCEEEEEECCCCCCC
T ss_conf             057210268-8753264141797644301112889972576568878888877643566200110112576302223333


Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEE
Q ss_conf             43321000036899997599665414887403211345566553100112343763777311000111587656866312
Q gi|254781172|r  247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMI  326 (731)
Q Consensus       247 ~~~~~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~Prwai  326 (731)
                      ......+|++.+.+|+.|||+++++...+.+.+++.++++.|...|..+||+|||+|||+||+.+|+.||+|+|+|||||
T Consensus       230 ~~~~~~~~~~~~~~l~~~gf~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~y~iDGiVikvn~~~~~~~lG~ts~~PrwAi  309 (667)
T 1dgs_A          230 EESGLKSQYELLLWLKEKGFPVEHCYEKALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFAL  309 (667)
T ss_dssp             TSCCCCBHHHHHHHHHHTTCCCCSCEEEEEHHHHHHHHHHHHHHTTTTSSSCCCEEEEEESBTHHHHHSCBCSSCBSSEE
T ss_pred             CCCCCCCHHHHHHHHHHCCCCCCCHHEEECCHHHHHHHHHHHHHHCCCCCEECCCEEEEECCHHHHHHCCCCCCCCCEEE
T ss_conf             56764589999999875168887012110556889999999987432465131545997233555643488889977567


Q ss_pred             EECCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEECCCEEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             31145621589987889940356225899997433302640001014898999750234543222468440768999835
Q gi|254781172|r  327 SHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRA  406 (731)
Q Consensus       327 A~Kf~~e~~~T~v~~I~wqvgRtG~itPva~~ePV~l~G~~V~ratlhN~~~I~~l~~~~~~~~~~~~I~iGd~V~I~Ra  406 (731)
                      |||||+++++|+|++|+|||||||+|||||+|+||.|+|+||+||||||+++|++           +||+|||+|+|+||
T Consensus       310 A~Kf~~e~~~T~v~dI~~qvGRtG~itPvA~lePV~l~G~~VsraTlhN~~~i~~-----------~~i~iGd~V~I~ra  378 (667)
T 1dgs_A          310 AYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEE-----------LDIRIGDWVLVHKA  378 (667)
T ss_dssp             EEECCCCCEEEEEEEEEEEECTTSBEEEEEEEEEEEETTEEEEEEECCSHHHHHH-----------TTCBSSCEEEEEEE
T ss_pred             EECCHHHHCCEEEEEEEEEECCCCCCCEEEEEEEEEECCEEEEECCCCCHHHHHH-----------HCCCCCCEEEEEEC
T ss_conf             6125254212044269998337873133899753032767888515588889987-----------06765876665421


Q ss_pred             CCCHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             87025665410123578730477704326577501033786544521010035434411446655332130123103541
Q gi|254781172|r  407 GEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL  486 (731)
Q Consensus       407 GdVIP~I~~Vi~~~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GL  486 (731)
                      |||||+|++|+.+.|+....++.+|..||+|+++++++.        ..+||+|. .||+|++++|.||+||+||||+||
T Consensus       379 GdVIP~I~~vv~~~r~~~~~~~~~p~~cp~c~~~l~~~~--------~~~~C~n~-~C~~q~~~~l~~F~Sk~~l~I~Gl  449 (667)
T 1dgs_A          379 GGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVKEG--------KVHRCPNP-LCPAKRFEAIRHYASRKAMDIEGL  449 (667)
T ss_dssp             TTTEEEEEEECGGGCCSCCCBCCCCSBCTTTCCBCEEET--------TEEECCCT-TCGGGHHHHHHHHHSTTSSCCTTC
T ss_pred             CCCCCHHHCCCHHHCCCCCCCCCCCCCCCCCCCEEEECC--------HHEECCCC-CCCHHHHHHHHHHHCCCCCCCCCC
T ss_conf             466620311414327777778768988988683568602--------31024655-786678878787530244275760


Q ss_pred             HHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             03555565305765404541011010677753100010001342100145689999875223466677630101111689
Q gi|254781172|r  487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEI  566 (731)
Q Consensus       487 G~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~  566 (731)
                      |+++|++|+++|    +|++|+|||.|+.+      +|+++||||+||++||+++|++||+++|+|||+|||||++|+.+
T Consensus       450 G~~~i~~L~e~g----~I~~i~Diy~L~~~------~l~~l~gfg~ksa~nll~sIe~sk~~~l~r~L~aLGIp~vG~~~  519 (667)
T 1dgs_A          450 GEKLIERLLEKG----LVRDVADLYHLRKE------DLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVL  519 (667)
T ss_dssp             CHHHHHHHHHTT----SCSSGGGGGGGCCH------HHHTTSSCCSTTHHHHHHHHHHGGGCCHHHHHHHTTCSSCCHHH
T ss_pred             CHHHHHHHHHCC----CCCCHHHHHCCCHH------HHHCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCHHH
T ss_conf             899999998678----72767884137887------76357763402378999998764146267777750678744899


Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99999882998999997897761251177876138886789999999996697999999999973387765432246882
Q gi|254781172|r  567 ARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE  646 (731)
Q Consensus       567 Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~~~~~~~~~~~~~~~~  646 (731)
                      |++|+.+|++++.+..          .+.++|.+|+|||+++|++|++||+++.|.+++++|...+....  .....+++
T Consensus       520 ak~L~~~f~~l~~l~~----------as~e~L~~I~GIG~~~A~si~~~f~~~~~~~~i~~L~~~g~~~~--~~~~~~~~  587 (667)
T 1dgs_A          520 ARNLARRFGTMDRLLE----------ASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSME--SKEEVSDL  587 (667)
T ss_dssp             HHHHHHTTSBHHHHTT----------CCHHHHHTSTTCCHHHHHHHHHHHHCHHHHHHHHHHHHTTCCCB--CC------
T ss_pred             HHHHHHHCCCHHHHHC----------CCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCC--CCCCCCCC
T ss_conf             9999887599999860----------79999857799489999999999759999999999997599877--65555885


Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHCCCCC
Q ss_conf             16866999725889987899999998298499811163217997788886379899749917379999999988286568
Q gi|254781172|r  647 IENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTTLR  726 (731)
Q Consensus       647 l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~~~~~  726 (731)
                      |+||+|||||+|+ ++|++++++||++||+|+|||||||||||+|+++|||++||++|||+||+|+||++||++....+|
T Consensus       588 l~gk~~v~TG~l~-~~R~e~~~~ie~~Ggkv~ssVSkkt~~Lv~g~~~gSKl~KA~~LgI~ii~e~ef~~~l~~~~~~~~  666 (667)
T 1dgs_A          588 LSGLTFVLTGELS-RPREEVKALLGRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVAVLTEEEFWRFLKEKGAPVP  666 (667)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCEEEEECCCC-CCHHHHHHHHHHCCCEECCCCCCCCCEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHCCCCCC
T ss_conf             6898899985747-899999999997799997653166538998999884999999839908229999999985499999


No 3  
>1ta8_A DNA ligase, NAD-dependent; nucleotidyl transferase fold; HET: DNA NMN; 1.80A {Enterococcus faecalis V583} SCOP: d.142.2.2 PDB: 3ba8_A* 1tae_A* 3ba9_A* 3baa_A* 3bab_A*
Probab=100.00  E-value=0  Score=684.51  Aligned_cols=325  Identities=36%  Similarity=0.610  Sum_probs=308.1

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             46889999999999999999999984331779820878999999999999897720311589999620036432357750
Q gi|254781172|r    9 IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFK   88 (731)
Q Consensus         9 ~~~~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~~~~~~k   88 (731)
                      ++.+++.+++.|+++|+++|++||++||+.|+|+|||++||+|+++|+.||++||++.   +|+|||++||+++..++.|
T Consensus         3 ~~~~~~~~~~~r~~~L~~~i~~~~~~YY~~g~p~ISD~eYD~L~~~L~~le~~~p~l~---~~~spt~~VG~~~~~~~~k   79 (332)
T 1ta8_A            3 QQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLI---TPDSPTQRVGGKVLSGFEK   79 (332)
T ss_dssp             --CCCHHHHHHHHHHHHHHHHHHHHHHHTSSCCSSCHHHHHHHHHHHHHHHHHCGGGC---CTTCGGGGGCCCBCSSCCE
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCC
T ss_conf             7878888999999999999999999986399997988999999999999998681456---8999744457743667765


Q ss_pred             EECCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             45166425702159999999999999986124677761199994158189999985998998886598655666999775
Q gi|254781172|r   89 VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIR  168 (731)
Q Consensus        89 v~H~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~  168 (731)
                      ++|+.|||||+|+++.+++..|.+++.+.++    ....|+|||||||+|++|+|++|+|++|+|||||.+|||||+|++
T Consensus        80 ~~h~~pmlSl~~~~~~~~l~~~~~~~~~~~~----~~~~~~vepKiDG~si~l~Y~~G~L~~a~TRGdG~~GeDIT~~~~  155 (332)
T 1ta8_A           80 APHDIPMYSLNDGFSKEDIFAFDERVRKAIG----KPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLR  155 (332)
T ss_dssp             EECSSCCCCCCEECSHHHHHHHHHHHHHHHS----SCCCEEEEEEECSEEEEEEEETTEEEEEEECTTSSEEEBCHHHHT
T ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHCCC----CCCEEEEEECCCCCEEEEEECCCEEEEEEECCCCCEEEEEECCCC
T ss_conf             0315322010013533455668765233169----872179986367548999976996899684689873126421352


Q ss_pred             HHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEECCCC
Q ss_conf             3102432233544550489999998520212345564314854334234567777523455553-011105664102454
Q gi|254781172|r  169 AIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTS  247 (731)
Q Consensus       169 ~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~~~~  247 (731)
                      +|++||++++  .|+.++||||+||++++|+++|+++.+.+++.|+||||+|||+||+++|... .|.|.|++|.++...
T Consensus       156 ~i~~ip~~~~--~~~~leiRGEl~i~~~~F~~~n~~~~~~~~~~f~NpRN~vAG~l~~k~~~~~~~~~l~f~~~~~~~~~  233 (332)
T 1ta8_A          156 TVRSVPMRLT--EPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFG  233 (332)
T ss_dssp             TCTTSCSBCS--SCCCEEEEEEEECCHHHHHHHHHHHHHTTCCCCSSHHHHHHHHHTCSBHHHHHTSCCEEEEEEESCCT
T ss_pred             EECCCCCCCC--CCCCEEEEEEEEEEHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHHCCEEEEEECCCCC
T ss_conf             3224653247--88734776679876788999999999844555655024533124423612444200348998604567


Q ss_pred             CCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEE
Q ss_conf             33210000368999975996654148874032113455665531001123437637773110001115876568663123
Q gi|254781172|r  248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMIS  327 (731)
Q Consensus       248 ~~~~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA  327 (731)
                      .....++.+.+.+|+.+||.+++....+.+++++..++++|.+.|..++|+|||||||+||+.+|+.||+|+++||||||
T Consensus       234 ~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~v~~~~~~~~~~R~~~~Y~iDGiVikvn~~~~~~~lG~ts~~PrwaiA  313 (332)
T 1ta8_A          234 PMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIA  313 (332)
T ss_dssp             TCCCSBHHHHHHHHHHTTCCCCTTCEEESSHHHHHHHHHHHHHTGGGSSSCEEEEEEEESBHHHHHHHCBCSSSBSSEEE
T ss_pred             CCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHCCCCCCCCCCEEE
T ss_conf             64320067775443105876687422169999999999999975343998886289998188999975985799985699


Q ss_pred             ECCCCCEEEEEEEEE
Q ss_conf             114562158998788
Q gi|254781172|r  328 HKFAEKQASTRLLDI  342 (731)
Q Consensus       328 ~Kf~~e~~~T~v~~I  342 (731)
                      ||||+++++|+|..-
T Consensus       314 ~Kf~~e~a~T~v~~~  328 (332)
T 1ta8_A          314 YKFPPEEAETVVZHH  328 (332)
T ss_dssp             EECC-----------
T ss_pred             ECCCCCEEEEEEEEC
T ss_conf             748877478999501


No 4  
>1b04_A Protein (DNA ligase); DNA replication; 2.80A {Geobacillus stearothermophilus} SCOP: d.142.2.2
Probab=100.00  E-value=0  Score=672.43  Aligned_cols=317  Identities=36%  Similarity=0.632  Sum_probs=301.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             89999999999999999999984331779820878999999999999897720311589999620036432357750451
Q gi|254781172|r   12 LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTH   91 (731)
Q Consensus        12 ~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~~~~~~kv~H   91 (731)
                      |+.++++++|++|+++|++||++||+.|+|+|||++||+|+++|+.||++||++.   .++|||++||+.+...+.|++|
T Consensus         1 m~~~~~~~~i~~L~~~i~~~~~~YY~~~~p~IsD~eYD~L~~~L~~le~~~p~l~---~~~sp~~~v~~~~~~~~~k~~h   77 (318)
T 1b04_A            1 MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEEQYPELK---TSDSPTQRIGGPPLEAFRKVAH   77 (318)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHHHHTTCSCCSSCHHHHHHHHHHHHHHHHCGGGC---CTTCGGGGTCCCCCSCCCEECC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9879999999999999999999986389997988999999999999998681336---8999865558754333433434


Q ss_pred             CCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             66425702159999999999999986124677761199994158189999985998998886598655666999775310
Q gi|254781172|r   92 SIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIP  171 (731)
Q Consensus        92 ~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~  171 (731)
                      +.|||||+|+++.+|+..|.+++....     ....|+|||||||+|++|+|++|+|++|+|||||.+|||||+|+++|+
T Consensus        78 ~~pmlSl~~~~~~~e~~~~~~~~~~~~-----~~~~~vve~KlDG~s~~l~Y~~G~l~~a~TRGdG~~GeDiT~~~~~i~  152 (318)
T 1b04_A           78 RVPMMSLANAFGEGDLRDFDRRVRQEV-----GEAAYVCELAIDGLAVSVRYEDGYFVQGATRGDGTTGEDITENLKTIR  152 (318)
T ss_dssp             SSCCCCCCEECSTTHHHHHHHHHHHHH-----SSCCEEEEEEESSEEEEEEEETTEEEEEEECTTSSCEEBCHHHHHTCT
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHCCC-----CCCEEEEEEEEEEEEEEEEECCCEEEEEEECCCCCCCEEEECCCCCCC
T ss_conf             544442223354755313555432026-----784389977763047888851986899895588751103100332036


Q ss_pred             CCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEECCCCCCC
Q ss_conf             2432233544550489999998520212345564314854334234567777523455553-011105664102454332
Q gi|254781172|r  172 TIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF  250 (731)
Q Consensus       172 ~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~~~~~~~  250 (731)
                      +||+.+.  .|..++||||+||++++|+++|+.+.+.++++|+||||+|||+||+|+|... .|.+.|++|+++......
T Consensus       153 ~ip~~~~--~~~~~~irGEv~~~~~~f~~~~~~~~~~~~~~f~NpRN~aaG~l~~k~~~~~~~~~l~~~~~~~~~~~~~~  230 (318)
T 1b04_A          153 SLPLRLK--EPVSLEARGEAFMPKASFLRLNEERKARGEELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALG  230 (318)
T ss_dssp             TSCSBCS--SCCCEEEEEEEECCHHHHHHHHHHHHHC--CCCSCHHHHHHHHHHSSCHHHHHHTCCEEEEEEETTTTTTT
T ss_pred             CCCCCCC--CCCCCCCCCCEEEEHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHCEEEEEEEECCCCC
T ss_conf             8875578--98431234655641135778778999723776566478875555502303666532014799986112468


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECC
Q ss_conf             10000368999975996654148874032113455665531001123437637773110001115876568663123114
Q gi|254781172|r  251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKF  330 (731)
Q Consensus       251 ~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf  330 (731)
                      ..+|++.|++|+.|||+++++...+.+.+++.+++++|.+.|..++|+|||||||+||+.+|+.||+|+|+|||||||||
T Consensus       231 ~~~~~e~l~~L~~~gf~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~y~iDGiVvkvn~~~~~~~lG~t~~~PrwaiA~Kf  310 (318)
T 1b04_A          231 IASHSEALDYLQALGFKVNPERRRCANIDEVIAFVSEWHDKRPQLPYEIDGIVIKVDSFAQQRALGATAKSPRWAIAYKF  310 (318)
T ss_dssp             CCBHHHHHHHHHHTTCCCCTTCEEESSHHHHHHHHHHHHHHSTTCSSCEEEEEEEECBHHHHHHHCCCSSSCTTEEEEEC
T ss_pred             CCCHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHCCCCCCCCCCEEEECC
T ss_conf             89999999999964997787558868999999999999976543998887079998388999971986799885689748


Q ss_pred             CCCEEEEE
Q ss_conf             56215899
Q gi|254781172|r  331 AEKQASTR  338 (731)
Q Consensus       331 ~~e~~~T~  338 (731)
                      |+++++||
T Consensus       311 ~~e~a~TT  318 (318)
T 1b04_A          311 PAEEVVTT  318 (318)
T ss_dssp             CCC-----
T ss_pred             CCCCCCCC
T ss_conf             85602689


No 5  
>1zau_A DNA ligase; AMP; HET: DNA AMP; 3.15A {Mycobacterium tuberculosis}
Probab=100.00  E-value=0  Score=680.77  Aligned_cols=319  Identities=33%  Similarity=0.590  Sum_probs=298.9

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             946889999999999999999999984331779820878999999999999897720311589999620036432-3577
Q gi|254781172|r    8 PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM-NLSL   86 (731)
Q Consensus         8 ~~~~~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~-~~~~   86 (731)
                      +..+.+..+++++|++|+++|++||++||+.++|+|||++||+|+++|+.||++||++.   +|+|||++||+.+ ...+
T Consensus         4 ~~~~~~~~~~~~~~~~L~~~i~~~~~~YY~~~~p~IsD~eYD~L~~~L~~le~~~p~l~---~~~spt~~v~~~~~~~~~   80 (328)
T 1zau_A            4 PDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELR---TPDSPTQLVGGAGFATDF   80 (328)
T ss_dssp             ----CCHHHHHTTHHHHHHHHHHHHHHHTTTCCCSSCTHHHHHHHHHHHHHHHTSSTTC---CTTCTTTTCSSCCCCCCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCC
T ss_conf             86563609999999999999999999986599998988999999999999998690335---899974244776544677


Q ss_pred             CEEECCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHH
Q ss_conf             50451664257021599999999999999861246777611999941581899999859989988865986556669997
Q gi|254781172|r   87 FKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSAC  166 (731)
Q Consensus        87 ~kv~H~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n  166 (731)
                      .||+|+.|||||+|+|+.+|+.+|.+++.+.+.    ....|+|||||||+|++|+|++|+|++|+|||||..|||||+|
T Consensus        81 ~kv~h~~pMlSL~k~~~~~el~~w~~~~~~~l~----~~~~~~vepKlDG~s~~l~Y~~G~lv~a~TRGdG~~GeDiT~~  156 (328)
T 1zau_A           81 EPVDHLERMLSLDNAFTADELAAWAGRIHAEVG----DAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLN  156 (328)
T ss_dssp             CCEECSSCCCCCCCBSSHHHHHHHHHGGGTTTC----SCSCEEEEEEECSEEEEEECGGGBCCBCBBCTTSSEECBCHHH
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC----CCCCEEEEEEECCEEEEEEEECCCEEEEEECCCCCCCHHHHHH
T ss_conf             651046545144444433788999998887641----3550578773568778999908957999965787204229999


Q ss_pred             HHHHCCCCCCCCC----CCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEE
Q ss_conf             7531024322335----44550489999998520212345564314854334234567777523455553-011105664
Q gi|254781172|r  167 IRAIPTIPRVLSL----NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVH  241 (731)
Q Consensus       167 ~~~i~~iP~~l~~----~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay  241 (731)
                      +++|++||++|..    +.|+.+|||||+||++++|+++|+++.+.|+++|+||||+|||+||+++|... .|.|.||+|
T Consensus       157 ~~~i~~ip~~i~~~~~~~~~~~leiRGEl~~~~~~f~~~n~~~~~~~~~~f~NpRN~aaG~l~~k~~~~~~~~~l~~~~~  236 (328)
T 1zau_A          157 ARTIADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICH  236 (328)
T ss_dssp             HHHSSSCCSBCCCBTTBCCCSCCEEEEEEBCCHHHHHHHHHSCSSTTSCCCSSHHHHHHHHHTCSSHHHHHHSCCBCCCC
T ss_pred             HHHHCCCCCCCCCCCCCCCCCEEEECCEEEECHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEE
T ss_conf             98743563111466677887515753436512655999999998717764310577777777514543110134169999


Q ss_pred             EECCCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCC
Q ss_conf             10245433210000368999975996654148874032113455665531001123437637773110001115876568
Q gi|254781172|r  242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS  321 (731)
Q Consensus       242 ~~~~~~~~~~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~  321 (731)
                      .++........+|++.+.+|+.|||+++++...+.+++++.+++++|.+.|.+++|+|||||||+||+.+|+.||+|||+
T Consensus       237 ~~~~~~~~~~~~~~~~l~~L~~~gf~~~~~~~~~~~~~~v~~~~~~~~~~R~~l~y~iDGiVvkvn~~~~~~~lG~ts~~  316 (328)
T 1zau_A          237 GLGHVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRA  316 (328)
T ss_dssp             BCCCCSSCCCSBHHHHHHHHHTTTCCCCCCCCCBCHHHHHHHHHHHTTTTCSSCSSCEEEEEEEECBHHHHTTSCBCSSS
T ss_pred             EECCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHCCCCCC
T ss_conf             81355765410179999999971884577838848999999999999976421998877379998098999971976789


Q ss_pred             CCCEEEECCCCC
Q ss_conf             663123114562
Q gi|254781172|r  322 PRWMISHKFAEK  333 (731)
Q Consensus       322 PrwaiA~Kf~~e  333 (731)
                      ||||||||||||
T Consensus       317 PrwAiA~Kfp~E  328 (328)
T 1zau_A          317 PRWAIAYKYPPE  328 (328)
T ss_dssp             BSSCCCEECCCC
T ss_pred             CCCEEEECCCCC
T ss_conf             972479688999


No 6  
>3jsl_A DNA ligase; NAD+-dependent, DNA damage, DNA repair, DNA replication, magnesium, manganese, metal-binding, NAD, zinc; HET: DNA; 1.80A {Staphylococcus aureus} PDB: 3jsn_A*
Probab=100.00  E-value=0  Score=665.22  Aligned_cols=313  Identities=35%  Similarity=0.598  Sum_probs=296.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             99999999999999999998433177982087899999999999989772031158999962003643235775045166
Q gi|254781172|r   14 IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSI   93 (731)
Q Consensus        14 ~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~~~~~~~~kv~H~~   93 (731)
                      |++++.||.+|+++|++||++||+.|+|+|||++||+|+++|+.||++||++.   +++|||++||+.+...+.||+|+.
T Consensus         1 ~~~~~~~i~~L~~~i~~~~~~YY~~~~p~IsD~eYD~L~~~L~~le~~~p~l~---~~~spt~~vg~~~~~~~~kv~h~~   77 (318)
T 3jsl_A            1 MADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYK---TVDSPTVRVGGEAQASFNKVNHDT   77 (318)
T ss_dssp             -CCCHHHHHHHHHHHHHHHHHHHTSCCCSSCHHHHHHHHHHHHHHHHHCGGGC---CTTCGGGGGCCSCCCCCCEEECSS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             93199999999999999999987289997988999999999999998680114---789987554754456676545676


Q ss_pred             CCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             42570215999999999999998612467776119999415818999998599899888659865566699977531024
Q gi|254781172|r   94 PTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTI  173 (731)
Q Consensus        94 pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~i  173 (731)
                      |||||+|+++.+++.+|..|+.+..     +...|+|||||||+|++|+|++|+|++|+|||||.+|||||+|+++|++|
T Consensus        78 pmlSl~k~~~~~~~~~~~~~~~k~~-----~~~~~~ve~KlDG~s~~l~Y~~G~l~~a~TRGdG~~GeDIT~~~~~i~~i  152 (318)
T 3jsl_A           78 PMLSLGNAFNEDDLRKFDQRIREQI-----GNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAI  152 (318)
T ss_dssp             CCCCCEEECSHHHHHHHHHHHHHHT-----CSCCEEEEEEECSEEEEEEEETTEEEEEEECTTSSEEEBCHHHHTTCTTS
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCC-----CCEEEEEEECCCCCEEEEEECCCCEEEEEECCCCCCCEEEHHHCCCCCCC
T ss_conf             6221123333567888988766316-----98148999735541689998189679978678987022754003336788


Q ss_pred             CCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCEEEEEEECCCCCCCCC
Q ss_conf             32233544550489999998520212345564314854334234567777523455553-01110566410245433210
Q gi|254781172|r  174 PRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIFAK  252 (731)
Q Consensus       174 P~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~f~ay~~~~~~~~~~~  252 (731)
                      |+++.  .|+.++||||+||++++|+++|+.+.+.+++.|+||||+|||+||+++|... .|.|.|++|+++........
T Consensus       153 P~~~~--~~~~i~iRGEl~i~k~~f~~~n~~~~~~~~~~f~NpRN~vaG~l~~k~~~~~~~~~l~f~~~~~~~~~~~~~~  230 (318)
T 3jsl_A          153 PLKMK--EPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNAR  230 (318)
T ss_dssp             CSBCS--SCCCEEEEEEEECCHHHHHHHHHHHBTTBCCCCSSHHHHHHHHHSCSCHHHHHHSCCEEEEEEESCCTTCCCS
T ss_pred             CCCCC--CCCCCCCCCCEEECHHHHHHHHHHHHHHCCCCCCCHHHHHHCCHHCCCCHHHHHHHCEEEEEECCCCCCCCCC
T ss_conf             86678--9865130433452166699999999982688776528987501220452345543202788641565566520


Q ss_pred             CCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             00036899997599665414887403211345566553100112343763777311000111587656866312311456
Q gi|254781172|r  253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAE  332 (731)
Q Consensus       253 ~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~  332 (731)
                      ++.+.+..++.+||+++++...+.+++++..++++|.+.|..++|+|||||||+||+.+|+.||+|+|+||||||||||+
T Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~r~~~~y~iDGiVvkvn~~~~~~~lG~ts~~PrwaiA~Kf~a  310 (318)
T 3jsl_A          231 SQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFPA  310 (318)
T ss_dssp             BHHHHHHHHHHHTCCCCTTCEEESSHHHHHHHHHHHHHHGGGSSSCEEEEEEEESBHHHHHHHCBCSSSBTTEEEEECC-
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCEEEECCCH
T ss_conf             08999999986277613451796999999999999997545199888717999818899998098578988758988782


Q ss_pred             CEEE
Q ss_conf             2158
Q gi|254781172|r  333 KQAS  336 (731)
Q Consensus       333 e~~~  336 (731)
                      ||-.
T Consensus       311 eE~~  314 (318)
T 3jsl_A          311 EEHH  314 (318)
T ss_dssp             ----
T ss_pred             HHCC
T ss_conf             4415


No 7  
>3bac_A DNA ligase; adenylation domain, DNA damage, DNA repair, DNA replication, NAD; HET: DNA 3B9; 3.00A {Haemophilus influenzae}
Probab=100.00  E-value=0  Score=565.85  Aligned_cols=263  Identities=36%  Similarity=0.602  Sum_probs=244.0

Q ss_pred             CCCCCCCCEEECCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHH
Q ss_conf             43235775045166425702159999999999999986124677761199994158189999985998998886598655
Q gi|254781172|r   80 GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHS  159 (731)
Q Consensus        80 ~~~~~~~~kv~H~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~  159 (731)
                      |.|+++|.||+|++|||||+|+|+++||.+|++|+.+.+.... .+..|+|||||||+|++|+|++|+|++|+|||||.+
T Consensus         1 a~p~~~f~kv~H~~pMlSL~k~~~~~el~~w~~r~~~~l~~~~-~~~~~v~epKlDG~si~l~Y~~G~l~~a~TRGdG~~   79 (270)
T 3bac_A            1 AKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLP-KPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTT   79 (270)
T ss_dssp             -----CCCEEECSSCCCCCCCCCSHHHHHHHHHHHHHHSSSCC-SSCEEEEEEEESSEEEEEEEETTEEEEEEECTTSSE
T ss_pred             CCCCCCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCC-CCCEEEEEEEECCEEEEEEEECCEEEEEEEECCCHH
T ss_conf             9965368876279887551200999999999999998735688-773388887660439999960990766787159613


Q ss_pred             HHHHHHHHHHHCCCCCCCCC-CCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH-HCCCE
Q ss_conf             66699977531024322335-44550489999998520212345564314854334234567777523455553-01110
Q gi|254781172|r  160 GEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLN  237 (731)
Q Consensus       160 GeDVT~n~~~i~~iP~~l~~-~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~-~r~L~  237 (731)
                      |||||+|+++|.+||..+.. +.|+.++||||+||++++|+.+|+.+.+.++++|+||||+|||+||++||... .|.|.
T Consensus        80 GeDIT~~~~~i~~ip~~~~~~~~~~~~evrGE~~i~~~~f~~~n~~~~~~~~~~f~NpRN~aaG~l~~kd~~~~~~r~l~  159 (270)
T 3bac_A           80 GEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLV  159 (270)
T ss_dssp             EEBCHHHHHTCTTSCSBCCSSSCCSEEEEEEEEECCHHHHHHHHHHHHHTTCCCCSSHHHHHHHHHSCSSHHHHHHSCCE
T ss_pred             HHHHHHHHHHHCCCCHHHHCCCCCCCCEEEEEEEEEECCEEEECHHHHHCCCCCCCCHHHHHHHHHHCCCCCHHHHCCCE
T ss_conf             67799999985466412202577543224358887533385501545412555430078898877642484013314640


Q ss_pred             EEEEEECCCCC-CCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCC
Q ss_conf             56641024543-32100003689999759966541488740321134556655310011234376377731100011158
Q gi|254781172|r  238 FFVHGLGKTSE-IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG  316 (731)
Q Consensus       238 f~ay~~~~~~~-~~~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG  316 (731)
                      |++|++..... ....+|++.|++|+.|||+++++...+.+.+++.+++++|.+.|.+++|+|||||||+||+.+|+.||
T Consensus       160 ~~~~~~~~~~~~~~~~~~~e~l~~L~~~GF~~~~~~~~~~~~~~~~~~~~~~~~~R~~l~Y~iDGiVikvn~~~~~~~LG  239 (270)
T 3bac_A          160 LNAYGIGIAEGVGLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLDFYQDIQNKRSSLGYDIDGTVLKINDIALQNELG  239 (270)
T ss_dssp             EEEEEEEEECSCCCCSBHHHHHHHHHHTTCCBCTTCEEEEHHHHHHHHHHHHHTTTTTTSSCEEEEEEEESBHHHHHHHC
T ss_pred             EEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHCC
T ss_conf             79999865147667630999999999719988867289888999999999999750059998760899995889999739


Q ss_pred             CCCCCCCCEEEECCCCCEEEEEEEEEE
Q ss_conf             765686631231145621589987889
Q gi|254781172|r  317 ERARSPRWMISHKFAEKQASTRLLDID  343 (731)
Q Consensus       317 ~ts~~PrwaiA~Kf~~e~~~T~v~~I~  343 (731)
                      +|||+|||||||||++++++|+|+|-.
T Consensus       240 ~Ts~~PrwAiAfKf~~e~a~T~l~D~~  266 (270)
T 3bac_A          240 FISKAPRWAIAYKFPAQEELTLLNDHH  266 (270)
T ss_dssp             CCCCSCSSCCCCCCCCCCCCC------
T ss_pred             CCCCCCCCEEEECCCCCCEEEEEEECC
T ss_conf             837898844898688663049997256


No 8  
>1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ...
Probab=99.89  E-value=9.4e-30  Score=247.55  Aligned_cols=220  Identities=9%  Similarity=0.042  Sum_probs=168.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH-H
Q ss_conf             655332130123103541035555653057654045410110106777531000100013421001456899998752-2
Q gi|254781172|r  469 LERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR-N  547 (731)
Q Consensus       469 ~~~i~hF~SK~aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK-~  547 (731)
                      ++.-.-|.  .-+||+|+|++++++|+++|     +.+++|||.++..      +|.+++|||+|+|+||+++|+.++ .
T Consensus         8 ~~~~~~~~--~l~~i~gvG~~~~~~l~~~g-----~~~~~~i~~~~~~------~L~~~~g~g~k~a~~i~~~i~~~~~~   74 (241)
T 1vq8_Y            8 VEAEEEYT--ELTDISGVGPSKAESLREAG-----FESVEDVRGADQS------ALADVSGIGNALAARIKADVGGLEVE   74 (241)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHH--HHCCCCCCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHHCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             88688674--32588998999999999768-----9999999869999------99746895799999999998650032


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             34666776301011116899999988299899999789776125117787613888678999999999669799999999
Q gi|254781172|r  548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEA  627 (731)
Q Consensus       548 ~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~  627 (731)
                      .++.++++++|++++|..+++.|+++|++++.+.          ..+.+++..++|+|+++|.+|++|+.+..+ ....+
T Consensus        75 ~~~~~~~~~~~~~~~g~~~~~~l~~~~~~~~~l~----------~~~~e~l~~i~~ig~~~a~~~~~~~~~~~~-~~~~~  143 (241)
T 1vq8_Y           75 SETEAEVEEEGGEEAPDEDVETELQARGLTEKTP----------DLSDEDARLLTQRHRVGKPQFNRQDHHKKK-RVSTS  143 (241)
T ss_dssp             ---------------------CCEEECSCTTCCC----------CCCHHHHHHHHHHHHHCCCCCCCTTGGGCT-TSCSS
T ss_pred             CHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHH----------HCCHHHHHCCCCCCHHHHHHHHHHHHHHHH-HHHHH
T ss_conf             0688998762001300788999999727889887----------389999835565168999999999899887-76888


Q ss_pred             HHH----------HCCCCCCCCCCCCCCCCCCCEEEEECCCC--CCCHHHHHHH-HHHCCCEEEEEEECCEEEEEECCCC
Q ss_conf             997----------33877654322468821686699972588--9987899999-9982984998111632179977888
Q gi|254781172|r  628 LLK----------EVSPSIGRHEKNVSSEIENKKLVFTGTLQ--KIQRHKAQEY-VTQLGAVVSAILSRKTDIIIVGDNP  694 (731)
Q Consensus       628 L~~----------~~~~~~~~~~~~~~~~l~gk~vV~TGtl~--~~~R~e~~~~-ie~~Ggkv~sSVSkkT~~LI~ge~~  694 (731)
                      |.+          ..............+++.++.+++||+..  .+++.+++.. ++..||+|++|||+||||||     
T Consensus       144 ~r~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~tG~~~~~~~~~~dl~~~~~e~~G~kv~ssVSsKtd~lI-----  218 (241)
T 1vq8_Y          144 WRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERI-----  218 (241)
T ss_dssp             CCCCCCTTCTTTTTCTTSCCCCCGGGCCCTTTTTCCTTSCEEEEESSGGGGTTCCTTTEEEEECTTSCHHHHHHH-----
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHCCEEECCCCCCCCCHHH-----
T ss_conf             985531178999884377665553557754555511105589861589999988898538788276446677999-----


Q ss_pred             CCHHHHHHHCCCEEECHHHHHHHHHH
Q ss_conf             86379899749917379999999988
Q gi|254781172|r  695 GSKLEKAQQLGVKIMNEEQFLFLLQQ  720 (731)
Q Consensus       695 gSKl~KA~~LgI~Ii~e~ef~~ll~~  720 (731)
                         ++||++|||+||++++|..+++|
T Consensus       219 ---l~KA~eLGIkIlN~~~~~~~~~~  241 (241)
T 1vq8_Y          219 ---EEEAEDAGIRVLNPTYVEVEVSE  241 (241)
T ss_dssp             ---HHHHHHTTCCBSSCCEEEC----
T ss_pred             ---HHHHHHCCCCCCCHHHHHHHHCC
T ss_conf             ---99999859944687999987239


No 9  
>2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A
Probab=99.81  E-value=1.5e-19  Score=168.65  Aligned_cols=82  Identities=33%  Similarity=0.576  Sum_probs=77.6

Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC-CHHHHHHHCCCEEECHHHHHHHH
Q ss_conf             22468821686699972588998789999999829849981116321799778888-63798997499173799999999
Q gi|254781172|r  640 EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQLGVKIMNEEQFLFLL  718 (731)
Q Consensus       640 ~~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g-SKl~KA~~LgI~Ii~e~ef~~ll  718 (731)
                      +...+++|.||+|||||+|+.|+|++++++|+.+||+|.+|||++|||||+|+++| ||++||++|||+||+|++|++||
T Consensus        26 p~~~~~~l~gk~~vfTG~l~~~~R~e~~~~i~~~Gg~v~~sVt~~t~~LV~G~~~g~sK~~kA~~lgI~Ii~E~~f~~ll  105 (109)
T 2k6g_A           26 PKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLI  105 (109)
T ss_dssp             CCCCTTTTTTCEEEEESBCSSCCHHHHHHHHHHTTCEEESSCCTTCCEEEECBCCCHHHHHHHHHHTCEEECHHHHHHHH
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEECCCCCCCCEEEEECCCCHHHHHHHHHCCCCEECHHHHHHHH
T ss_conf             77899875898999924689988999999999879999176146656899818999799999998399682599999999


Q ss_pred             HHH
Q ss_conf             882
Q gi|254781172|r  719 QQY  721 (731)
Q Consensus       719 ~~~  721 (731)
                      ++.
T Consensus       106 ~~~  108 (109)
T 2k6g_A          106 RNL  108 (109)
T ss_dssp             HHT
T ss_pred             HHC
T ss_conf             856


No 10 
>2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=99.80  E-value=3.1e-19  Score=166.17  Aligned_cols=88  Identities=31%  Similarity=0.510  Sum_probs=80.6

Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC-CHHHHHHHCCCEEECHHHHHHH
Q ss_conf             322468821686699972588998789999999829849981116321799778888-6379899749917379999999
Q gi|254781172|r  639 HEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQLGVKIMNEEQFLFL  717 (731)
Q Consensus       639 ~~~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g-SKl~KA~~LgI~Ii~e~ef~~l  717 (731)
                      .+...+++|.||+|||||+|+.|+|++++++|+.+||+|.+|||++|||||+|+++| ||++||++|||+||+|++|++|
T Consensus        15 ~p~~~~~~L~Gk~~v~TG~l~~~~R~e~~~~i~~~Gg~v~~sVs~kT~~LV~G~~~g~sK~~kA~~lgI~Ii~E~~f~~l   94 (112)
T 2ebu_A           15 IPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNL   94 (112)
T ss_dssp             CCCCCSSSSTTCEEEECSCCSSSCHHHHHHHHHHTTCEECSSCCSSCCEEEECSSCCSHHHHHHHHHTCEEEEHHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEECCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEECHHHHHHH
T ss_conf             67799986489989990258998899999999984997668756685689981899978999999809968369999999


Q ss_pred             HHHHCCCCC
Q ss_conf             988286568
Q gi|254781172|r  718 LQQYNTTLR  726 (731)
Q Consensus       718 l~~~~~~~~  726 (731)
                      |+.......
T Consensus        95 L~~~~~~~~  103 (112)
T 2ebu_A           95 IRTMPGKKS  103 (112)
T ss_dssp             HHHSCCCCC
T ss_pred             HHHCCCCCC
T ss_conf             985879875


No 11 
>1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2
Probab=99.73  E-value=3.7e-18  Score=157.92  Aligned_cols=79  Identities=39%  Similarity=0.611  Sum_probs=75.2

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHH
Q ss_conf             46882168669997258899878999999982984998111632179977888863798997499173799999999882
Q gi|254781172|r  642 NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY  721 (731)
Q Consensus       642 ~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~  721 (731)
                      ..+++|+|++|||||+|+ ++|++++++|+++||+|+++||++|+|||+|+++|||++||+++||+||+|++|++||+.-
T Consensus         3 ~~~~~l~G~~~v~TG~~~-~~R~e~~~~i~~~Gg~v~~~Vs~~t~~LV~g~~~gsK~~kA~~~gI~Ii~e~~f~~~l~~~   81 (92)
T 1l7b_A            3 KGGEALKGLTFVITGELS-RPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVPTLTEEELYRLLEAR   81 (92)
T ss_dssp             CCCCSSTTCEEECSTTTT-SCHHHHHHHHHHTTCEEESCCSSSCCCBEECSSSSTTHHHHHCSSSCCEEHHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEECCCC-CCHHHHHHHHHHCCCEEECEEECCEEEEEECCCCCHHHHHHHHHCCCEECHHHHHHHHHHC
T ss_conf             889877898999989857-7999999999986999907032776089988998809999999099496399999999746


No 12 
>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=99.38  E-value=4.8e-13  Score=118.35  Aligned_cols=78  Identities=13%  Similarity=0.289  Sum_probs=70.2

Q ss_pred             CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECC---CCCCHHHHHHHCCCEEECHHHHHHH
Q ss_conf             2468821686699972588998789999999829849981116321799778---8886379899749917379999999
Q gi|254781172|r  641 KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGD---NPGSKLEKAQQLGVKIMNEEQFLFL  717 (731)
Q Consensus       641 ~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge---~~gSKl~KA~~LgI~Ii~e~ef~~l  717 (731)
                      ...+.+|.|++|||||+|+. +|++++++|+++||+++++||++|+|||+++   +.|+|+++|+++||||++|+.|.++
T Consensus         5 ~~~~kpL~g~~i~itG~~~~-~r~el~~~Ie~~Gg~~~~~vsk~t~~lv~~~e~~~~~~K~~kA~~~gI~iV~e~~L~d~   83 (113)
T 2cok_A            5 SSGDKPLSNMKILTLGKLSR-NKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDV   83 (113)
T ss_dssp             CCCCCSSSSCEEEECSCCSS-CHHHHHHHHHHTTCEEESCSTTCSEEECCHHHHHHCCHHHHHHHHTTCCEECTHHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCC-CHHHHHHHHHHCCCEEECCCCCCEEEEEECCCCCCCCHHHHHHHHCCCEEEEHHHHHHH
T ss_conf             88888879938999826888-99999999998499891333576689984441136667999999879929619999999


Q ss_pred             HH
Q ss_conf             98
Q gi|254781172|r  718 LQ  719 (731)
Q Consensus       718 l~  719 (731)
                      +.
T Consensus        84 ~~   85 (113)
T 2cok_A           84 SA   85 (113)
T ss_dssp             HS
T ss_pred             HH
T ss_conf             97


No 13 
>2vug_A PAB1020; RNA, ligase, AMPPNP, nucleotidyl- transferase; HET: ANP; 2.9A {Pyrococcus abyssi GE5}
Probab=99.01  E-value=8.1e-09  Score=85.69  Aligned_cols=147  Identities=17%  Similarity=0.229  Sum_probs=101.6

Q ss_pred             CCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHH
Q ss_conf             61199994158189999985998998886598655666999775310243223354455048999999852021234556
Q gi|254781172|r  125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDE  204 (731)
Q Consensus       125 ~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~  204 (731)
                      ..+|+||.|+||..+.++|.+|.. ++.||| |....+.|.++..+  ++..+....| .+.+.||+++....|...   
T Consensus        94 ~~~~~vEeK~DG~Rvqih~~~g~v-~~~SR~-g~~~~~~t~~~~~~--i~~~~~~~~~-~~iLdGE~vg~~~~~~~~---  165 (389)
T 2vug_A           94 RGEFYVEEKVDGYNVRVVMYKGKM-LGITRG-GFICPFTTERIPDF--VPQEFFKDNP-NLILVGEMAGPESPYLVE---  165 (389)
T ss_dssp             SCEEEEEEECCSEEEEEEEETTEE-EEEETT-SCBCHHHHHHGGGT--SCTHHHHHCT-TEEEEEEEESSSCSSCSC---
T ss_pred             CCCEEEEEEECCEEEEEEEECCEE-EEECCC-CCCCCCCHHHHHHH--HHHHHHCCCC-CEEEEEEEEECCCCCCCC---
T ss_conf             984899980777089999989999-998689-84688613557999--9998636799-889998999658985300---


Q ss_pred             HHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCEEEE--ECCCCHH
Q ss_conf             43148543342345677775234555530111056641024543321000036899997599665414887--4032113
Q gi|254781172|r  205 MIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQA--NTFHGIV  282 (731)
Q Consensus       205 ~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~~~~~~e~l~~L~~~GF~v~~~~~~~--~~~~~~~  282 (731)
                                             ......+++.|++|++.+.++....++.+..+.|+..+++.++.....  .+.+++.
T Consensus       166 -----------------------~~~~~~~~~~f~vFDil~~~g~~~lp~~eRr~lLe~~~~~~v~~~~~~~~~~~~ei~  222 (389)
T 2vug_A          166 -----------------------GPPYVKEDIQFFLFDVQEIKTGRSLPVEERLKIAEEYGINHVEVFGKYTKDDVDELY  222 (389)
T ss_dssp             -----------------------CCTTCCSSCEEEEEEEEETTTCCBCCHHHHHHHHHHHTCCBCCEEEEEEGGGHHHHH
T ss_pred             -----------------------CCCCCCCCCEEEEEEEEECCCCEECCHHHHHHHHHHHCCCCCEEECCCCCCHHHHHH
T ss_conf             -----------------------543345782499977787599735379999999997089851001322332178999


Q ss_pred             HHHHHHHHHHCCCCCCCCCEEEEECC
Q ss_conf             45566553100112343763777311
Q gi|254781172|r  283 SYYNEMKSIRSTLPYDIDGLVYKVDE  308 (731)
Q Consensus       283 ~~~~~~~~~r~~l~y~iDGiVikvn~  308 (731)
                      +++++..+.      ...|||+|--|
T Consensus       223 ~~~~~~~~~------g~EGvVlK~~d  242 (389)
T 2vug_A          223 QLIERLSKE------GREGIIMKSPD  242 (389)
T ss_dssp             HHHHHHHHT------TCCEEEEECTT
T ss_pred             HHHHHHHCC------CCCEEEEECCC
T ss_conf             999998527------98769994579


No 14 
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5
Probab=98.94  E-value=6.8e-10  Score=94.01  Aligned_cols=74  Identities=16%  Similarity=0.201  Sum_probs=63.4

Q ss_pred             HHHHHHH-HHHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHH
Q ss_conf             5689999-8752234666776301-0111168999999882998999997897761251177876138886789999999
Q gi|254781172|r  536 TNLYDSI-NKRRNISLERFIFSLG-IRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV  613 (731)
Q Consensus       536 ~nL~~sI-e~sK~~~L~r~L~ALG-I~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~  613 (731)
                      +|--++| +++++..+++++++|| ||+||+..|+.|+++|++++++..          ++.++|.+|+|||+++|++|.
T Consensus        12 q~~~d~ike~~~~~~~~~~~~~L~~I~gIGk~~A~~L~~~F~Si~~l~~----------As~eeL~~i~GIG~~~A~~I~   81 (91)
T 2a1j_B           12 QDPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIA----------ASREDLALCPGLGPQKARRLF   81 (91)
T ss_dssp             -CCSHHHHHHHHHHHHHHHHHHHTTSTTCCHHHHHHHHHHHSSHHHHHS----------CCHHHHHTSSSCCSHHHHHHH
T ss_pred             CCCHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHH----------HHHHHHCCCCCCCHHHHHHHH
T ss_conf             4978999998737909999998646888599999999999588298999----------899975577996999999999


Q ss_pred             HHHCCH
Q ss_conf             996697
Q gi|254781172|r  614 EFYQNP  619 (731)
Q Consensus       614 ~ff~~~  619 (731)
                      +||++|
T Consensus        82 ~~f~~p   87 (91)
T 2a1j_B           82 DVLHEP   87 (91)
T ss_dssp             HHHHSC
T ss_pred             HHHHCC
T ss_conf             998481


No 15 
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5
Probab=98.88  E-value=3.1e-09  Score=88.95  Aligned_cols=67  Identities=16%  Similarity=0.208  Sum_probs=62.0

Q ss_pred             HHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCH
Q ss_conf             875223466677630-10111168999999882998999997897761251177876138886789999999996697
Q gi|254781172|r  543 NKRRNISLERFIFSL-GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNP  619 (731)
Q Consensus       543 e~sK~~~L~r~L~AL-GI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~  619 (731)
                      +++++..+++++.+| |||+||+.+|+.|+++|+|++++..+          +.++|.+|+|||++.|++|.+||++|
T Consensus         7 ek~~~~~~~~~~~~L~~I~gIG~~~a~~L~~~Fgsl~~i~~A----------s~eeL~~i~GiG~~~A~~I~~~f~~p   74 (89)
T 1z00_A            7 EKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAA----------SREDLALCPGLGPQKARRLFDVLHEP   74 (89)
T ss_dssp             HHHHHHHHHHHHHHHTTSSSCCHHHHHHHHHHTCBHHHHHHC----------CHHHHHTSTTCCHHHHHHHHHHHHSC
T ss_pred             HHHHCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHH----------HHHHHHCCCCCCHHHHHHHHHHHCCH
T ss_conf             887367499999987589975999999999994888999998----------78777268996999999999998084


No 16 
>2xnk_A DNA topoisomerase 2-binding protein 1; phosphorylation, protein-protein interaction; HET: DNA; 2.60A {Homo sapiens} PDB: 2xnh_A*
Probab=98.73  E-value=1.3e-09  Score=91.94  Aligned_cols=79  Identities=19%  Similarity=0.218  Sum_probs=67.6

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEE-ECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHH
Q ss_conf             688216866999725889987899999998298499811-1632179977888863798997499173799999999882
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL-SRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY  721 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSV-SkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~  721 (731)
                      .-..|.|.+||||| |..-.|.+++++|+.+||++..++ +.++++||+.+..|.|+..|++.||+|++.+.|.+=|...
T Consensus       198 ~~~~f~g~~i~~sg-~~~~~r~~l~~li~~~GG~~~~~l~~~~~THlI~~~~~~~k~~~A~~~~i~iV~~eWl~dsi~~g  276 (292)
T 2xnk_A          198 KCPIFLGCIICVTG-LCGLDRKEVQQLTVKHGGQYMGQLKMNECTHLIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKG  276 (292)
T ss_dssp             BCCTTTTCEEEECS-CCHHHHHHHHHHHHHTTCEECSSCCTTTCCEEECSSSCSHHHHHHHHTTCEEECHHHHHHHHHHT
T ss_pred             CCCCCCCEEEEECC-CCCHHHHHHHHHHHHCCCEEECCCCCCCCEEEEECCCCCHHHHHHHHCCCCEECHHHHHHHHHCC
T ss_conf             44455874999818-88553799999999859987343478998599976999779999998699480599999999859


Q ss_pred             C
Q ss_conf             8
Q gi|254781172|r  722 N  722 (731)
Q Consensus       722 ~  722 (731)
                      .
T Consensus       277 ~  277 (292)
T 2xnk_A          277 F  277 (292)
T ss_dssp             S
T ss_pred             C
T ss_conf             8


No 17 
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5
Probab=98.72  E-value=6.9e-09  Score=86.20  Aligned_cols=70  Identities=27%  Similarity=0.310  Sum_probs=57.8

Q ss_pred             HHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHH
Q ss_conf             875223466677630-1011116899999988299899999789776125117787613888678999999999669799
Q gi|254781172|r  543 NKRRNISLERFIFSL-GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN  621 (731)
Q Consensus       543 e~sK~~~L~r~L~AL-GI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n  621 (731)
                      |+++.....+.++.| ||||||..+|+.|+++|++++.+..+          +.++|..|+|||+++|++|.+||+.++|
T Consensus         2 ekk~~~~~~~~~~~L~~IpgIG~~~a~~L~~~F~s~~~i~~A----------s~eeL~~v~GIG~~~a~~i~~~~~~~~~   71 (75)
T 1x2i_A            2 EKKALTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFTA----------SVAELMKVEGIGEKIAKEIRRVITAPYI   71 (75)
T ss_dssp             ---CCCHHHHHHHHHTTSTTCCHHHHHHHHHHHCSHHHHHHC----------CHHHHTTSTTCCHHHHHHHHHHHHSCCC
T ss_pred             CCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHH----------HHHHHHHCCCCCHHHHHHHHHHHCCHHH
T ss_conf             967488999999998489994299999999996888989997----------8999985589799999999999857632


Q ss_pred             H
Q ss_conf             9
Q gi|254781172|r  622 I  622 (731)
Q Consensus       622 ~  622 (731)
                      .
T Consensus        72 ~   72 (75)
T 1x2i_A           72 E   72 (75)
T ss_dssp             C
T ss_pred             C
T ss_conf             0


No 18 
>1x9n_A DNA ligase I; 5'-adenylated nicked DNA, protein-DNA complex, ligase/DNA complex; HET: DNA DOC AMP; 3.00A {Homo sapiens} SCOP: a.235.1.1 b.40.4.6 d.142.2.1
Probab=98.71  E-value=1.4e-06  Score=68.27  Aligned_cols=247  Identities=17%  Similarity=0.139  Sum_probs=133.8

Q ss_pred             CCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEE-ECCEEEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             642570215999999999999998612467776119999415818999998-5998998886598655666999775310
Q gi|254781172|r   93 IPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY-EKGKFVYAALRGDGHSGEDVSACIRAIP  171 (731)
Q Consensus        93 ~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y-~~G~L~~a~TRGdG~~GeDVT~n~~~i~  171 (731)
                      .|||. ..+.+.+|...-            .....|++|+|+||.=+-+++ ++|. ++..||    -|+|+|+..--|.
T Consensus       310 ~PMLA-~~~~~~~e~~~~------------~~~~~~~~E~K~DG~R~qih~~~~g~-v~lfSR----ng~d~T~~~Pel~  371 (688)
T 1x9n_A          310 KPMLA-HPTRGISEVLKR------------FEEAAFTCEYKYDGQRAQIHALEGGE-VKIFSR----NQEDNTGKYPDII  371 (688)
T ss_dssp             CCCEE-EEESSHHHHHHH------------TTTSCEEEEEEESSEEEEEEECTTSC-EEEECT----TSCBCTTTCHHHH
T ss_pred             CCCCC-CCCCCHHHHHHH------------CCCCCEEEEEEECCEEEEEEEECCCE-EEEECC----CCCCCCCHHHHHH
T ss_conf             87049-989986899862------------47885699996545789999942998-999848----9880300428999


Q ss_pred             -CCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCC-HHHHHCCCEEEEEEECCCCCC
Q ss_conf             -243223354455048999999852021234556431485433423456777752345-555301110566410245433
Q gi|254781172|r  172 -TIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI  249 (731)
Q Consensus       172 -~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d-~~~~~r~L~f~ay~~~~~~~~  249 (731)
                       .++. +.......+.+=||++.-...-..         -.    |-+....-.|... ......++.|++|++.+.++.
T Consensus       372 ~~~~~-~~~~~~~~~ILDGElva~d~~~~~---------~~----~Fq~l~~r~~~~~~~~~~~~~v~~~vFDlL~l~g~  437 (688)
T 1x9n_A          372 SRIPK-IKLPSVTSFILDTEAVAWDREKKQ---------IQ----PFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGE  437 (688)
T ss_dssp             HTSGG-GBCTTCCCEEEEEEEEEECTTTCS---------BC----CHHHHTTSCSSCCCGGGCCSEEEEEEEEEEEETTE
T ss_pred             HHHHH-HHCCCCCCEEECCEEEEEECCCCC---------CC----CHHHHHHHHHCCCCHHHHCCCEEEEEEEEECCCCC
T ss_conf             99987-536774010443437986079997---------45----18888777504577566417605899986234897


Q ss_pred             --CCCCCHHHHHHHHHCCCCCCCCE-----EEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEEC--CHHCCCCCCCCCC
Q ss_conf             --21000036899997599665414-----88740321134556655310011234376377731--1000111587656
Q gi|254781172|r  250 --FAKGQYEMLQKMRCLGFPVNNGV-----RQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD--EFSLQKQLGERAR  320 (731)
Q Consensus       250 --~~~~~~e~l~~L~~~GF~v~~~~-----~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn--~~~~q~~lG~ts~  320 (731)
                        .-....+..+.|..+--++....     ..+.+.+++..++++..+      -...|+|+|--  +..++-    ..|
T Consensus       438 ~l~~~pl~eRr~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~g~EGlm~K~l~~ds~Y~~----gkR  507 (688)
T 1x9n_A          438 SLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVK------DSCEGLMVKTLDVDATYEI----AKR  507 (688)
T ss_dssp             ECTTSCHHHHHHHHHHHBCCBTTTEEECCEECCCCHHHHHHHHHHHHH------TSEEEEEEEESSSSCSSCT----TTC
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHHHHHHH------CCCCEEEEEECCCCCCEEC----CCC
T ss_conf             412387999999999973547872899976227889999999999987------6986599852268876501----888


Q ss_pred             CCCCEEEECC-----CCCEEEEEEEEEEEEECC-CCEEEE--EEEEEEEEECCCEEEEE-CCCCHHHHHHH
Q ss_conf             8663123114-----562158998788994035-622589--99974333026400010-14898999750
Q gi|254781172|r  321 SPRWMISHKF-----AEKQASTRLLDIDIQIGR-TGILTP--VARLEPVNIGGALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       321 ~PrwaiA~Kf-----~~e~~~T~v~~I~wqvgR-tG~itP--va~~ePV~l~G~~V~ra-tlhN~~~I~~l  382 (731)
                      +..| +=+|-     ..++..-+|.+-.|-.|| .|.+..  +|..+|-.-.=.+|.++ |+++-...+.|
T Consensus       508 s~~W-lK~K~dy~~~~~dt~DlVviG~~~G~Gkr~g~~g~~llg~~d~~~~~l~~v~kvgsGfsd~~l~~l  577 (688)
T 1x9n_A          508 SHNW-LKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEH  577 (688)
T ss_dssp             SEEE-EEEEHHHHHSSCEEEEEEEEEEEEBCTTSBTSEEEEEEEEEETTTTEEEEEEEECCSCCHHHHHHH
T ss_pred             CHHH-HHEEHHHHHCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEECCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             8155-311465420434410158998884787668861269999994899879999897889999999999


No 19 
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe}
Probab=98.71  E-value=4.1e-08  Score=80.26  Aligned_cols=78  Identities=19%  Similarity=0.308  Sum_probs=67.5

Q ss_pred             CCCCCCCEEEEECCCCC---CCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCC-CEEECHHHHHHHHH
Q ss_conf             88216866999725889---987899999998298499811163217997788886379899749-91737999999998
Q gi|254781172|r  644 SSEIENKKLVFTGTLQK---IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG-VKIMNEEQFLFLLQ  719 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~---~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~Lg-I~Ii~e~ef~~ll~  719 (731)
                      ...|.|.+|||||.+..   ..|.++..+++.+||+|.++|+++|++||++...+.|+.+|+++| |+|++.+.+..=+.
T Consensus       350 ~~vL~g~~i~fsG~~~~~~~~~~~~~~~~~~~~Ga~v~~~~~~~~ThvV~~~~~t~K~~~A~~~~~i~iV~~~Wl~~c~~  429 (442)
T 3ef1_A          350 QKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLS  429 (442)
T ss_dssp             HTTSTTCEEEEESSSCTTSCSTTSHHHHHHHTTTCEECSSSSSCCSEEEECSCCCHHHHHHHHHSSSEEEEHHHHHHHHH
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEECCCCCCCCEEEECCCCCHHHHHHHHCCCCEEECHHHHHHHHH
T ss_conf             76418978999224479998456599999997699994867999628996899988999998779978987999999999


Q ss_pred             HH
Q ss_conf             82
Q gi|254781172|r  720 QY  721 (731)
Q Consensus       720 ~~  721 (731)
                      ..
T Consensus       430 ~~  431 (442)
T 3ef1_A          430 QW  431 (442)
T ss_dssp             HT
T ss_pred             HC
T ss_conf             64


No 20 
>3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A*
Probab=98.68  E-value=5.2e-08  Score=79.41  Aligned_cols=102  Identities=17%  Similarity=0.161  Sum_probs=84.7

Q ss_pred             EEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH------------------
Q ss_conf             45410110106777531000100013421001456899998752234666776301011116------------------
Q gi|254781172|r  503 SIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGA------------------  564 (731)
Q Consensus       503 ~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~------------------  564 (731)
                      ++.++.|.|.|--.|      ... +++.++++.|++.++..++..++.++..+||++.+|.                  
T Consensus       247 Lv~~Vee~~~LlIrD------Y~~-e~~~~~~a~~~L~~L~~~elldl~~ia~~LGy~~~g~~~llD~~v~pRGyRiLsk  319 (377)
T 3c1y_A          247 LTEDVDDLLVLLIMD------YSS-EEVEEETAQNILQDFITRREPSPISISRVLGYDVQQAAQLDDVLVSARGYRLLKT  319 (377)
T ss_dssp             HHTTHHHHHHHHHHH------HSS-SCCCHHHHHHHHHHHHTTSCCCHHHHHHHTTCCCSCGGGGGGCBCCCCSHHHHHH
T ss_pred             HHCCCHHHHHHHHHH------HCC-CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             981748788999987------186-7788678999998622224467689999829998786664445657417888723


Q ss_pred             ------HHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHH
Q ss_conf             ------899999988299899999789776125117787613888678999999999669799
Q gi|254781172|r  565 ------EIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN  621 (731)
Q Consensus       565 ------~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n  621 (731)
                            ..+..|.++|+++++++.          ++.++|.+|+|||+..|++|.++++--++
T Consensus       320 iprlp~~vienLV~~FgsLq~Ll~----------AS~EeL~eVeGIGe~RAr~IreGL~Rl~e  372 (377)
T 3c1y_A          320 VARIPLSIGYNVVRMFKTLDQISK----------ASVEDLKKVEGIGEKRARAISESISSLKH  372 (377)
T ss_dssp             TSCCCHHHHHHHHHHHCSHHHHTT----------CCHHHHTTSTTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHCCHHHHHH----------CCHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             899978899999998468999985----------89988964588589999999999999874


No 21 
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=98.61  E-value=1.1e-07  Score=77.02  Aligned_cols=79  Identities=19%  Similarity=0.222  Sum_probs=71.4

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             68821686699972588998789999999829849981116321799778888637989974991737999999998828
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      ....|.|.+||+|| |.+-.|+++..+++.+||+++.+++.+|++||+.+..+.|..+|+++||+|++.+.+.+-+....
T Consensus        19 ~~~~~~g~~i~~sG-~~~~~r~~l~~~i~~~Gg~~~~~~~~~~ThlI~~~~~~~k~~~a~~~~i~IV~~~Wl~dc~~~~~   97 (129)
T 2d8m_A           19 LGKILQGVVVVLSG-FQNPFRSELRDKALELGAKYRPDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRR   97 (129)
T ss_dssp             HTTTSTTEEEEEES-CCTTHHHHHHHHHHHTTEEEESSCCTTCCEEEESSSSCHHHHHHHHHTCEEEETHHHHHHHHTTS
T ss_pred             CCCCCCCEEEEEEC-CCCHHHHHHHHHHHHCCCEEECCCCCCCEEEEECCCCHHHHHHHHCCCCCCCCHHHHHHHHHCCC
T ss_conf             01046985899928-98173999999999879999173268840898446516789987546870556999999998687


No 22 
>2cfm_A Thermostable DNA ligase; protein-nucleotide complex, cell cycle, cell division, DNA damage, DNA recombination, DNA repair, DNA replication; HET: AMP; 1.8A {Pyrococcus furiosus}
Probab=98.60  E-value=1.3e-05  Score=60.97  Aligned_cols=221  Identities=15%  Similarity=0.168  Sum_probs=125.9

Q ss_pred             CEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCC-CCCCCCCCCCCEEEEEEEEEEECHHHHHHHHH
Q ss_conf             11999941581899999859989988865986556669997753102-43223354455048999999852021234556
Q gi|254781172|r  126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPT-IPRVLSLNIPEIIEVRGEVYISKNDFLALNDE  204 (731)
Q Consensus       126 ~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~-iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~  204 (731)
                      ..|.+|+|+||.=+-+++++|. ++..||    -|+|+|+....|.. ++..   -.|..+.+-||++.-..+.      
T Consensus       242 ~~~~~E~K~DG~R~qih~~~~~-v~~~SR----~g~~~t~~~p~i~~~l~~~---~~~~~~iLDGEl~~~~~~g------  307 (561)
T 2cfm_A          242 GEAEFEIKYDGARVQVHKDGSK-IIVYSR----RLENVTRAIPEIVEALKEA---IIPEKAIVEGELVAIGENG------  307 (561)
T ss_dssp             SCEEEEEECCSEEEEEEEETTE-EEEECT----TCCBCGGGCHHHHHHHHHH---BCSSEEEEEEEEEEBCTTS------
T ss_pred             CCCEEEEECCCEEEEEEEECCE-EEEEEC----CCCCCHHHHHHHHHHHHHH---CCCCCCCCCCEEEEECCCC------
T ss_conf             8714665337376788885998-999947----9854223307899876641---4884343645699988999------


Q ss_pred             HHHCCCCCCCCHHHHHHHHHHCCCHH-H--HHCCCEEEEEEECCCCCCC--CCCCHHHHHHHHHCCCCCCCCE-----EE
Q ss_conf             43148543342345677775234555-5--3011105664102454332--1000036899997599665414-----88
Q gi|254781172|r  205 MIAVGRKPYANPRNAASGILRRLNPT-D--ITRYLNFFVHGLGKTSEIF--AKGQYEMLQKMRCLGFPVNNGV-----RQ  274 (731)
Q Consensus       205 ~~~~g~~~f~NpRN~aaG~lr~~d~~-~--~~r~L~f~ay~~~~~~~~~--~~~~~e~l~~L~~~GF~v~~~~-----~~  274 (731)
                           ..   -|-+...+.++++.+. .  ..-++.|++|++...++..  -....+..+.|..+--+. +..     ..
T Consensus       308 -----~~---~~f~~l~~r~~~~~~~~~~~~~~~~~~~vFDil~~~g~~~~~~p~~eR~~~L~~~~~~~-~~~~~~~~~~  378 (561)
T 2cfm_A          308 -----RP---LPFQYVLRRFRRKHNIEEMMEKIPLELNLFDVLYVDGQSLIDTKFIDRRRTLEEIIKQN-EKIKVAENLI  378 (561)
T ss_dssp             -----SB---CCTHHHHHHHHCCSCHHHHHHHSCEEEEEEEEEEETTEECTTSCHHHHHHHHHHHBCCC-SSEEECCEEE
T ss_pred             -----CC---CCHHHHHHHHHHCCCHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CCEEEEEEEC
T ss_conf             -----83---76899999976505745565207849998112010785421203566678999986036-6526776411


Q ss_pred             EECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEEECC-CCEEE
Q ss_conf             74032113455665531001123437637773110001115876568663123114562158998788994035-62258
Q gi|254781172|r  275 ANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGR-TGILT  353 (731)
Q Consensus       275 ~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T~v~~I~wqvgR-tG~it  353 (731)
                      +.+.+++..+++...+      -.-.|+|+|--+..++.  |  .|+..| +=+|-..+...-+|.+..|-.|| .|.++
T Consensus       379 ~~~~~~~~~~~~~~~~------~g~EGimlK~~~s~Y~~--g--kRs~~w-~K~K~~~~~~d~vivg~~~G~Gk~~g~~g  447 (561)
T 2cfm_A          379 TKKVEEAEAFYKRALE------MGHEGLMAKRLDAVYEP--G--NRGKKW-LKIKPTMENLDLVIIGAEWGEGRRAHLFG  447 (561)
T ss_dssp             ESCHHHHHHHHHHHHH------TTCCEEEEECTTCCCCT--T--CEEEEE-EEECSSCCCEEEEEEEEEECSGGGTTSEE
T ss_pred             CCCHHHHHHHHHHHHH------CCCCCCCCCCCCCCEEC--C--CCCCCE-EEEECCCCCCCEEEEEEEECCCCCCCCEE
T ss_conf             4777899999998876------79735100168886107--7--778860-89821511241699987747888788524


Q ss_pred             EE--EEEEEEEECC--CEEEEE-CCCCHHHHHHH
Q ss_conf             99--9974333026--400010-14898999750
Q gi|254781172|r  354 PV--ARLEPVNIGG--ALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       354 Pv--a~~ePV~l~G--~~V~ra-tlhN~~~I~~l  382 (731)
                      ..  +..+|-  +|  .+|.++ |+++....+.+
T Consensus       448 ~~l~g~~d~~--~~~~~~v~kvgsG~sd~~~~~l  479 (561)
T 2cfm_A          448 SFILGAYDPE--TGEFLEVGKVGSGFTDDDLVEF  479 (561)
T ss_dssp             EEEEEEECTT--TCCEEEEEEECSSCCHHHHHHH
T ss_pred             EEEEEEEECC--CCEEEEEEEECCCCCHHHHHHH
T ss_conf             7999998488--9979999898589999999999


No 23 
>2hiv_A Thermostable DNA ligase; ATP-dependent, open conformation; 2.05A {Sulfolobus solfataricus} PDB: 2hix_A*
Probab=98.59  E-value=1.8e-05  Score=59.88  Aligned_cols=247  Identities=16%  Similarity=0.153  Sum_probs=130.3

Q ss_pred             CCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             66425702159999999999999986124677761199994158189999985998998886598655666999775310
Q gi|254781172|r   92 SIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIP  171 (731)
Q Consensus        92 ~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~  171 (731)
                      -.|||. ..+.+.+++.+-+             ...|++|+|+||.=+-+++.+|. ++..||    -|+|+|+....+.
T Consensus       253 v~PMLA-~~~~~~~~~~~~~-------------~~~~~~E~K~DG~R~qih~~~~~-v~lfSR----~g~~~t~~~pel~  313 (621)
T 2hiv_A          253 IRPMLA-ERLSNPEEILKKM-------------GGNAIVDYKYDGERAQIHKKEDK-IFIFSR----RLENITSQYPDVV  313 (621)
T ss_dssp             CCCCEE-EECSCHHHHHHHT-------------TTCEEEEEECSSEEEEEEEETTE-EEEECT----TCCBCGGGCHHHH
T ss_pred             CCCCCC-CCCCCHHHHHHHC-------------CCCCEEEEEECCEEEEEEEECCE-EEEECC----CCCCCCCCCHHHH
T ss_conf             776568-6679979998750-------------88834777325577899983999-999768----9975655677899


Q ss_pred             -CCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH--HCCCEEEEEEECCCCC
Q ss_conf             -2432233544550489999998520212345564314854334234567777523455553--0111056641024543
Q gi|254781172|r  172 -TIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI--TRYLNFFVHGLGKTSE  248 (731)
Q Consensus       172 -~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~--~r~L~f~ay~~~~~~~  248 (731)
                       .+...+.   ...+.+=||+++-..+...+             .|-....-..+..+....  ..++.|++|++...++
T Consensus       314 ~~l~~~~~---~~~~ILDGElv~~d~~~~~~-------------~~f~~l~~r~~~~~~~~~~~~~~v~~~vFDiL~l~g  377 (621)
T 2hiv_A          314 DYVSKYIE---GKEFIIEGEIVAIDPESGEM-------------RPFQELMHRKRKSDIYEAIKEYPVNVFLFDLMYYED  377 (621)
T ss_dssp             HHHHHHBC---CSSEEEEEEEEEBCTTTCCB-------------CCTHHHHHHHHCSCHHHHHHHSCEEEEEEEEEEETT
T ss_pred             HHHHHCCC---CCCCCCCCEEEEECCCCCCC-------------CHHHHHHHHHHCCCHHHHHHHCCCCEEEEEEECCCC
T ss_conf             99985436---66531477688765899872-------------139999875403323667751776137850204278


Q ss_pred             C--CCCCCHHHHHHHHHCCCCC----CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCC
Q ss_conf             3--2100003689999759966----541488740321134556655310011234376377731100011158765686
Q gi|254781172|r  249 I--FAKGQYEMLQKMRCLGFPV----NNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSP  322 (731)
Q Consensus       249 ~--~~~~~~e~l~~L~~~GF~v----~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~P  322 (731)
                      .  .-....+..+.|+.+--+.    ......+++.+++.+++++..+.      .-.|||+|--+-...-.-  ..|..
T Consensus       378 ~~l~~~pl~eRr~~L~~~~~~~~~v~~~~~~~~~~~~~i~~~~~~~i~~------g~EGimiK~l~~~s~Y~~--gkRs~  449 (621)
T 2hiv_A          378 VDYTTKPLEARRKLLESIVKPNDYVKIAHHIQANNVEDLKSFFYRAISE------GGEGVMVKAIGKDAIYQA--GARGW  449 (621)
T ss_dssp             EECTTSCHHHHHHHHHHHBCCCSSEEECCEEEESSHHHHHHHHHHHHHT------TCCEEEEECCSTTCCCCT--TCEEE
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCEECCEEECCCHHHHHHHHHHHHHC------CCCEEEEEECCCCCCCCC--CCCCC
T ss_conf             7501266999999999973655765013165216889999999999977------996389984157888758--88888


Q ss_pred             CCEEEECC--C---CCEEEEEEEEEEEEECC-CCEEEE--EEEEEEEEECCCEEEEE-CCCCHHHHHHH
Q ss_conf             63123114--5---62158998788994035-622589--99974333026400010-14898999750
Q gi|254781172|r  323 RWMISHKF--A---EKQASTRLLDIDIQIGR-TGILTP--VARLEPVNIGGALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       323 rwaiA~Kf--~---~e~~~T~v~~I~wqvgR-tG~itP--va~~ePV~l~G~~V~ra-tlhN~~~I~~l  382 (731)
                      .| +=+|-  .   .++...+|.+..|-.|| .|.+..  +|..+|-.=.=.+|.++ |+++....++|
T Consensus       450 ~w-~K~K~~y~~~~~~t~DlvivG~~~G~gkr~g~~~~fllg~~d~~~~~~~~v~kvgsG~sd~~~~~l  517 (621)
T 2hiv_A          450 LW-IKLKRDYQSEMADTVDLVVVGGFYGKGKRGGKISSLLMAAYNPKTDSFESVCKVASGFSDEQLDEL  517 (621)
T ss_dssp             EE-EEEETTCTTSSCEEEEEEEEEEEECSGGGTTSEEEEEEEEEETTTTEEEEEEEECBSCCHHHHHHH
T ss_pred             CE-EEEEECCCCCCCCCCEEEEEEEEECCCCCCCCCCEEEEEEEECCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             76-988533002567631068998886788877861159999996899949999798579999999999


No 24 
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}
Probab=98.55  E-value=2.5e-07  Score=74.20  Aligned_cols=79  Identities=19%  Similarity=0.308  Sum_probs=68.2

Q ss_pred             CCCCCCCCEEEEECCCC---CCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCC-CEEECHHHHHHHH
Q ss_conf             68821686699972588---9987899999998298499811163217997788886379899749-9173799999999
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQ---KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG-VKIMNEEQFLFLL  718 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~---~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~Lg-I~Ii~e~ef~~ll  718 (731)
                      ....|.|.+|||||.++   +..|.++..+++.+||+++++|+.+|++||+++..+.|..+|++.| |+|++.+.+..=+
T Consensus       279 r~~~L~g~~i~~Sg~~p~~~~~~~~~~~~~~~~~Ga~~~~~~~~~~THlV~~~~~t~K~~~A~~~~~i~iV~~~WL~~c~  358 (372)
T 3ef0_A          279 KQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESL  358 (372)
T ss_dssp             HTTTSTTCEEEEESSSCTTSCTTTSHHHHHHHHTTCEEESSSSSCCSEEEECSCCCHHHHHHHHSSSCCEEEHHHHHHHH
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCEEECCCCCCCCEEEECCCCCHHHHHHHHCCCCEEECHHHHHHHH
T ss_conf             00114896899477305899840649999999779999485699950899689997899999875998898899999999


Q ss_pred             HHH
Q ss_conf             882
Q gi|254781172|r  719 QQY  721 (731)
Q Consensus       719 ~~~  721 (731)
                      ...
T Consensus       359 ~~~  361 (372)
T 3ef0_A          359 SQW  361 (372)
T ss_dssp             HTT
T ss_pred             HHC
T ss_conf             968


No 25 
>3gde_A DNA ligase; DNA-binding domain, adenylation domain, OB-fold domain, ATP-binding, cell cycle, cell division, DNA damage, DNA recombination; HET: DNA; 2.30A {Archaeoglobus fulgidus}
Probab=98.47  E-value=1.2e-05  Score=61.13  Aligned_cols=219  Identities=17%  Similarity=0.198  Sum_probs=123.4

Q ss_pred             EEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHH
Q ss_conf             19999415818999998599899888659865566699977531024322335445504899999985202123455643
Q gi|254781172|r  127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMI  206 (731)
Q Consensus       127 ~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~  206 (731)
                      .|.+|+|+||.=+-+++.+|. ++..||    -|+|+|+....|.   ..+....+..+.+=||++.-...         
T Consensus       246 ~~~~E~K~DG~R~qih~~~~~-v~l~SR----~g~d~t~~~p~i~---~~l~~~~~~~~ILDGElv~~~~~---------  308 (558)
T 3gde_A          246 TAAVEWKFDGSRVQVHWDGSR-VTIYSR----RLENVTNALPDIV---EEIKKSVKPGVILDGEVIAVKEG---------  308 (558)
T ss_dssp             SEEEEEECSSEEEEEEECSSC-CEEEET----TCCBCGGGCHHHH---HHHHHHBCSSEEEEEEEEEEETT---------
T ss_pred             CCEEEEEECCEEEEEEECCCE-EEEECC----CCCCCHHHCCHHH---HHHHHCCCCCCEECCEEEEEECC---------
T ss_conf             827888416478999970998-999737----9746243231479---99985178565145689998489---------


Q ss_pred             HCCCCCCCCHHHHHHHHHHCCCH-HH--HHCCCEEEEEEECCCCCCC-CCCCHHHHHHHHHCCCCCCCCE-----EEEEC
Q ss_conf             14854334234567777523455-55--3011105664102454332-1000036899997599665414-----88740
Q gi|254781172|r  207 AVGRKPYANPRNAASGILRRLNP-TD--ITRYLNFFVHGLGKTSEIF-AKGQYEMLQKMRCLGFPVNNGV-----RQANT  277 (731)
Q Consensus       207 ~~g~~~f~NpRN~aaG~lr~~d~-~~--~~r~L~f~ay~~~~~~~~~-~~~~~e~l~~L~~~GF~v~~~~-----~~~~~  277 (731)
                         .   ..|........+++.+ ..  ...++.|++|++...++.. -....+..+.|..+=-+ .++.     ..+++
T Consensus       309 ---~---~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~fDll~~dg~~l~~pl~eRr~~L~~~~~~-~~~~~~~~~~~~~~  381 (558)
T 3gde_A          309 ---K---PMPFQHVLRRFRRKHDVAKMVEKIPLEAHFFDILYHDGECIDLPLRERRKLLESAVNE-SEKIKLAKQIVTDS  381 (558)
T ss_dssp             ---E---EECHHHHHHHHHC--CTHHHHHHSCEEEEEEEEEEESSBCTTSBHHHHHHHHHHHBCC-CSSEEECCEEEESC
T ss_pred             ---C---CCCHHHHHHHHCCCCCHHHHHHHCCEEEEEEEHHHCCCCCCCCCHHHHHHHHHHHHCC-CCCEEEEEEEECCC
T ss_conf             ---8---7749998766312331678876405489973034338840146699999999997455-66434432220111


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEEECC-CCEEEEE-
Q ss_conf             32113455665531001123437637773110001115876568663123114562158998788994035-6225899-
Q gi|254781172|r  278 FHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGR-TGILTPV-  355 (731)
Q Consensus       278 ~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T~v~~I~wqvgR-tG~itPv-  355 (731)
                      .+++..++++..+.      .-.|+|+|--+-.++.  |.  |+..| +-+|...+...-.|.+..+-.|| .|.++.. 
T Consensus       382 ~~~~~~~~~~~~~~------g~EGlm~K~~~s~Y~~--gk--Rs~~w-lK~K~~~~~~D~vivG~~~g~Gkr~g~~~~fl  450 (558)
T 3gde_A          382 VDEVRKMYDEAISA------GHEGVMIKLPSSPYIP--GK--RGKNW-LKVKAIMETLDLVVVGGEWGEGKRSHWLSSFE  450 (558)
T ss_dssp             HHHHHHHHHHHHHT------TCCEEEEECTTCBCCT--TC--EEEEE-EEEESSCCCEEEEEEEEEECCTTGGGSEEEEE
T ss_pred             HHHHHHHHHHHHHC------CCCEEEEECCCCCCCC--CC--CCCCE-EEEECCCCCEEEEEEEEEECCCCCCCCEEEEE
T ss_conf             89999999998867------9970156647876137--88--89870-88844776325899986636888777422699


Q ss_pred             -EEEEEEEECC--CEEEEE-CCCCHHHHHHH
Q ss_conf             -9974333026--400010-14898999750
Q gi|254781172|r  356 -ARLEPVNIGG--ALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       356 -a~~ePV~l~G--~~V~ra-tlhN~~~I~~l  382 (731)
                       +..++.  +|  .+|.++ |+++....+.+
T Consensus       451 lg~~~~~--~~~~~~v~kvgsG~s~~~~~~l  479 (558)
T 3gde_A          451 LACLDPV--TGKLLKVGRVATGFTEEDLEEL  479 (558)
T ss_dssp             EEEECTT--TCCEEEEEEECSSCCHHHHHHH
T ss_pred             EEEEECC--CCEEEEEEEECCCCCHHHHHHH
T ss_conf             9999679--9979999798889999999999


No 26 
>3l3e_A DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, cell cycle checkpoints, acetylation, cytoplasm, cytoskeleton, DNA damage; HET: DNA; 1.26A {Homo sapiens} PDB: 3jve_A*
Probab=98.43  E-value=1e-06  Score=69.35  Aligned_cols=81  Identities=15%  Similarity=0.224  Sum_probs=68.6

Q ss_pred             CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC---CHHHHHHHCCCEEECHHHHHHH
Q ss_conf             2468821686699972588998789999999829849981116321799778888---6379899749917379999999
Q gi|254781172|r  641 KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG---SKLEKAQQLGVKIMNEEQFLFL  717 (731)
Q Consensus       641 ~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g---SKl~KA~~LgI~Ii~e~ef~~l  717 (731)
                      .....+|.|..||+||... -.|.++.++++.+||+++.++++++++||+++..+   .|+..|+..||+|++.+.+.+-
T Consensus        10 ~~~~~~l~g~~i~~sg~~~-~~~~~l~~~i~~~Gg~~~~~~~~~~THlI~~~~~~~~~~k~~~a~~~~i~iV~~~Wl~~c   88 (107)
T 3l3e_A           10 EEAPKPLHKVVVCVSKKLS-KKQSELNGIAASLGADYRRSFDETVTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDC   88 (107)
T ss_dssp             ----CTTTTCEEEECGGGG-GGHHHHHHHHHHTTCEEESSCCTTCCEEECCCCTTCCCHHHHHHHHTTCEEECHHHHHHH
T ss_pred             CCCCCCCCCEEEEEECCCH-HHHHHHHHHHHHCCCEECCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCEEECHHHHHHH
T ss_conf             6678777874999815898-999999999999499863533677438997067888599999988379879789999999


Q ss_pred             HHHHC
Q ss_conf             98828
Q gi|254781172|r  718 LQQYN  722 (731)
Q Consensus       718 l~~~~  722 (731)
                      +....
T Consensus        89 ~~~~~   93 (107)
T 3l3e_A           89 AQECK   93 (107)
T ss_dssp             HHHTS
T ss_pred             HHHCC
T ss_conf             99298


No 27 
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens}
Probab=98.41  E-value=9.2e-08  Score=77.51  Aligned_cols=78  Identities=14%  Similarity=0.166  Sum_probs=68.9

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHCC
Q ss_conf             8216866999725889987899999998298499811163217997788886379899749917379999999988286
Q gi|254781172|r  645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT  723 (731)
Q Consensus       645 ~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~~  723 (731)
                      .+|.|.+||||| |+.-.|.+++.+|+.+||+++.++++++++||+.+..|.|++.|+..||+|++++.+.+-+....-
T Consensus        20 p~F~G~~i~~sG-~~~~~r~~i~~~i~~~GG~~~~~~~~~~THLI~~~~~~~k~~~a~~~~i~IVs~~Wl~ds~~~~~~   97 (112)
T 3l46_A           20 PPFQDCILSFLG-FSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDAR   97 (112)
T ss_dssp             CTTTTCEECEES-CCHHHHHHHHHHHHHTTCEECCTTCTTCSEEEECTTTBSSCSSCCCSSCEEEEHHHHHHHHHHTSC
T ss_pred             CCCCCCEEEEEC-CCHHHHHHHHHHHHHCCCEECCCCCCCCEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHCCCC
T ss_conf             986992899848-987999999999998599990534898459997256513577865367755889999999982987


No 28 
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=98.33  E-value=1.6e-07  Score=75.69  Aligned_cols=79  Identities=16%  Similarity=0.197  Sum_probs=69.9

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHCC
Q ss_conf             88216866999725889987899999998298499811163217997788886379899749917379999999988286
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT  723 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~~  723 (731)
                      -.+|.|.+||||| |....|.+++++|+.+||++...++.++++||+++..+.|+.+|.+.||+|++++.+.+=++...-
T Consensus        10 ~~~F~G~~i~~sG-~~~~~~~~l~~~i~~~GG~~~~~~~~~~THlI~~~~~~~k~~~a~~~~i~VV~~~Wl~ds~~~~~~   88 (109)
T 2cou_A           10 VPPFQDCILSFLG-FSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDAR   88 (109)
T ss_dssp             CCTTTTCBEEEES-SCHHHHHHHHHHHHHHTCBCCCTTCTTCSEEEECTTTCSSCSSCCCTTSEEECHHHHHHHHHTTSC
T ss_pred             CCCCCCCEEEECC-CCHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHCCCC
T ss_conf             8878982899858-986889999999998399997642898518997369847889888637866679999999983984


No 29 
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5
Probab=98.30  E-value=2.7e-06  Score=66.11  Aligned_cols=80  Identities=13%  Similarity=0.145  Sum_probs=67.7

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCH--HHHHHHCCCEEECHHHHHHHHHH
Q ss_conf             6882168669997258899878999999982984998111632179977888863--79899749917379999999988
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSK--LEKAQQLGVKIMNEEQFLFLLQQ  720 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSK--l~KA~~LgI~Ii~e~ef~~ll~~  720 (731)
                      ....|.|.+|+||| |..-.|..++.+|+.+||++...+++++++||+++..+.|  ..+|...+|+|++++.+.+=+++
T Consensus        37 ~~~if~G~~i~~sG-~~~~~~~~l~~li~~~GG~~~~~l~~~~THvI~~~~~~~~~~~~~a~~~~i~IV~~~Wi~dc~~~  115 (132)
T 1wf6_A           37 PEDLLDGCRIYLCG-FSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLECFSK  115 (132)
T ss_dssp             CTTTTTTCEEEEES-CCSHHHHHHHHHHHHTTCEEESSCCSSCCEEEESSCCSHHHHHHHHSCCCCCEEEHHHHHHHHHH
T ss_pred             HHHHCCCEEEEEEC-CCCHHHHHHHHHHHHCCCEEEEECCCCCCEEEEECCCCCHHHHHHHHCCCCCCCCHHHHHHHHHC
T ss_conf             67751980899979-98077999999999889999500278742798617998529999985599782899999999984


Q ss_pred             HCC
Q ss_conf             286
Q gi|254781172|r  721 YNT  723 (731)
Q Consensus       721 ~~~  723 (731)
                      ...
T Consensus       116 ~~~  118 (132)
T 1wf6_A          116 GYM  118 (132)
T ss_dssp             SSC
T ss_pred             CCC
T ss_conf             985


No 30 
>1cdz_A Protein (DNA-repair protein XRCC1); BRCT, BRCA1, protein-protein interaction, DNA binding protein; 3.20A {Homo sapiens} SCOP: c.15.1.1
Probab=98.26  E-value=1.4e-06  Score=68.37  Aligned_cols=79  Identities=14%  Similarity=0.209  Sum_probs=68.7

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHH--CCCEEECHHHHHHHHHHH
Q ss_conf             882168669997258899878999999982984998111632179977888863798997--499173799999999882
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ--LGVKIMNEEQFLFLLQQY  721 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~--LgI~Ii~e~ef~~ll~~~  721 (731)
                      ...|.|..|+++|.+++..|+.++++|.++||+++++.+++|+++|+.+..+.|.++|..  .+++|++.+.+.+-+++.
T Consensus         3 p~~F~g~~f~i~g~~~~~~~~~L~~~i~~~GG~~~~~~~~~~ThlI~~~~~~~k~~~~~~~~~~i~iV~~~Wi~~c~~~~   82 (96)
T 1cdz_A            3 PDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQ   82 (96)
T ss_dssp             CCTTTTCEEEECSCCCTHHHHHHHHHHHHTTCEECSSCSTTCSEEECSSCCCHHHHHHHTTCTTCEEECTHHHHHHHTTT
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEECCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEEHHHHHHHHHCC
T ss_conf             32019928999478785899999999986898995546887029998168605789999777998697279999999839


Q ss_pred             C
Q ss_conf             8
Q gi|254781172|r  722 N  722 (731)
Q Consensus       722 ~  722 (731)
                      .
T Consensus        83 ~   83 (96)
T 1cdz_A           83 K   83 (96)
T ss_dssp             S
T ss_pred             C
T ss_conf             8


No 31 
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A*
Probab=98.26  E-value=3.1e-06  Score=65.68  Aligned_cols=79  Identities=13%  Similarity=0.120  Sum_probs=57.0

Q ss_pred             CCCCCCCEEEEECC---------CCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHH-----HHHHCCCEEE
Q ss_conf             88216866999725---------889987899999998298499811163217997788886379-----8997499173
Q gi|254781172|r  644 SSEIENKKLVFTGT---------LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLE-----KAQQLGVKIM  709 (731)
Q Consensus       644 ~~~l~gk~vV~TGt---------l~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~-----KA~~LgI~Ii  709 (731)
                      ...|.|..+.+.|.         +....+..+...+..+||++..+.+.+++++|+.+..+.+..     .+...++.|+
T Consensus       162 ~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~Gg~~~~~~~~~~thvv~~~~~~~~~~~~~~~~~~~~~~~iV  241 (263)
T 3ii6_X          162 LSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKIL  241 (263)
T ss_dssp             GGTTTTCEEEECCBSSTTCGGGBCCSSHHHHHHHHHHHTTCEEESSCCTTCCEEEECSCCTTHHHHHHHHHTCSSCCEEE
T ss_pred             HHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCEEE
T ss_conf             12137738997076555654321204689999999985397663134677337998067651166899997428999893


Q ss_pred             CHHHHHHHHHHHC
Q ss_conf             7999999998828
Q gi|254781172|r  710 NEEQFLFLLQQYN  722 (731)
Q Consensus       710 ~e~ef~~ll~~~~  722 (731)
                      ++..+.+=+.+..
T Consensus       242 t~~Wl~~c~~~~~  254 (263)
T 3ii6_X          242 KESWVTDSIDKCE  254 (263)
T ss_dssp             ETHHHHHHHHTTS
T ss_pred             CHHHHHHHHHCCC
T ss_conf             5899999998598


No 32 
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3
Probab=98.23  E-value=1e-06  Score=69.52  Aligned_cols=51  Identities=22%  Similarity=0.250  Sum_probs=47.2

Q ss_pred             CHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             1011116899999988299899999789776125117787613888678999999999669
Q gi|254781172|r  558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       558 GI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~  618 (731)
                      +|||||+.+++.|.++|++++.+..+          +.++|.+|+|||+++|++|.+||++
T Consensus        28 ~IpGIG~k~ak~Ll~~F~si~~i~~A----------s~eeL~~v~GIg~~~A~~I~~~l~n   78 (78)
T 1kft_A           28 TIEGVGPKRRQMLLKYMGGLQGLRNA----------SVEEIAKVPGISQGLAEKIFWSLKH   78 (78)
T ss_dssp             GCTTCSSSHHHHHHHHHSCHHHHHHC----------CHHHHTTSSSTTSHHHHHHHHHHTC
T ss_pred             CCCCCCHHHHHHHHHHHCCHHHHHHH----------CHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             69993299999999992994999883----------7999980799899999999999668


No 33 
>1vs0_A Putative DNA ligase-like protein RV0938/MT0965; OB fold, nucleotidyl transferase, structural genomics, PSI; HET: APK MSE; 2.40A {Mycobacterium tuberculosis H37RV}
Probab=98.21  E-value=2e-05  Score=59.36  Aligned_cols=209  Identities=15%  Similarity=0.174  Sum_probs=112.4

Q ss_pred             CCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHH
Q ss_conf             61199994158189999985998998886598655666999775310243223354455048999999852021234556
Q gi|254781172|r  125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDE  204 (731)
Q Consensus       125 ~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~  204 (731)
                      ...|++|+|+||+=+-+++.+|. ++..||    .|.|+|++...|..+-..+.   +..+.+=||+++-...       
T Consensus        24 ~~~~~~E~K~DG~R~~~~~~~~~-v~l~SR----~g~~~t~~fp~i~~~~~~~~---~~~~iLDGElv~~~~~-------   88 (310)
T 1vs0_A           24 ASQWAFEGXWDGYRLLVEADHGA-VRLRSR----SGRDVTAEYPQLRALAEDLA---DHHVVLDGEAVVLDSS-------   88 (310)
T ss_dssp             TTTEEEEEECCSEEEEEEEETTE-EEEEET----TCCBCGGGCGGGHHHHHHTT---TCEEEEEEEEECBCTT-------
T ss_pred             CCCEEEECCCCCEEEEEEEECCE-EEEECC----CCCCCCHHHHHHHHHHHHCC---CCCEEEEEEEEEECCC-------
T ss_conf             78689988747099999998999-999989----99897003467999998568---8478982179987899-------


Q ss_pred             HHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCC--CCCCHHHHHHHHHC----CCCCCCCEEEEECC
Q ss_conf             4314854334234567777523455553011105664102454332--10000368999975----99665414887403
Q gi|254781172|r  205 MIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIF--AKGQYEMLQKMRCL----GFPVNNGVRQANTF  278 (731)
Q Consensus       205 ~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~--~~~~~e~l~~L~~~----GF~v~~~~~~~~~~  278 (731)
                          +..+|        +.+++..   ...++.|++|++...++..  .....+..+.|+.+    .+.+.++.     .
T Consensus        89 ----~~~~f--------~~l~~~~---~~~~~~~~vFDil~~~g~~l~~~p~~eR~~~L~~~~~~~~~~~~~~~-----~  148 (310)
T 1vs0_A           89 ----GVPSF--------SQMQNRG---RDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELL-----P  148 (310)
T ss_dssp             ----SCBCH--------HHHHTCC---TTSCCEEEEEEEEEETTEECTTSCHHHHHHHHHHHHHHSCCCCCCCC-----C
T ss_pred             ----CCCCH--------HHHHHHC---CCCEEEEEEEEEECCCCHHHHCCCHHHHHHHHHHHHCCCCCCCCCCC-----C
T ss_conf             ----76758--------9875532---45248999985535498012105799999999987543556654202-----5


Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEEECC-CCEEEEEEE
Q ss_conf             2113455665531001123437637773110001115876568663123114562158998788994035-622589999
Q gi|254781172|r  279 HGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGR-TGILTPVAR  357 (731)
Q Consensus       279 ~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T~v~~I~wqvgR-tG~itPva~  357 (731)
                      .++.+.++...+      -.-.|+|+|--+-.+..  |  .++..| +=+| +...++.+|.++.+-.|+ .|.++-...
T Consensus       149 ~~~~~~~~~~~~------~G~EGim~K~~~s~Y~~--G--krs~~w-lK~K-~~~~~d~vvvg~~~g~Gk~~g~~~~~~~  216 (310)
T 1vs0_A          149 GDGAQAFACSRK------HGWEGVIAKRRDSRYQP--G--RRCASW-VKDK-HWNTQEVVIGGWRAGEGGRSSGVGSLLM  216 (310)
T ss_dssp             SSHHHHHHHHHH------TTCCEEEEEETTCCCCT--T--CEEEEE-EEEE-SSEEEEEEEEEEEC--------CCEEEE
T ss_pred             CHHHHHHHHHHH------CCCEEEEEECCCCCCCC--C--CCCCCC-EEEC-CCCCCEEEEEEEECCCCCCCCCCCEEEE
T ss_conf             409999997764------28737887769986579--9--817871-7643-6665079999898088854787514899


Q ss_pred             EEEEEECCC--EEEE-ECCCCHHHHHHH
Q ss_conf             743330264--0001-014898999750
Q gi|254781172|r  358 LEPVNIGGA--LITN-ATLHNEDYIKGL  382 (731)
Q Consensus       358 ~ePV~l~G~--~V~r-atlhN~~~I~~l  382 (731)
                        -+.-+|.  .|.+ .|+++....+.|
T Consensus       217 --g~~~~~~~~~v~kvgsG~s~~~~~~l  242 (310)
T 1vs0_A          217 --GIPGPGGLQFAGRVGTGLSERELANL  242 (310)
T ss_dssp             --EEEETTEEEEEEEECSSCCHHHHHHH
T ss_pred             --EEECCCEEEEEEEECCCCCHHHHHHH
T ss_conf             --98619979996343477999999999


No 34 
>3l2p_A DNA ligase 3; DNA ligase, DNA repair, ATP-binding, cell cycle, cell divisi damage; HET: DNA AMP; 3.00A {Homo sapiens}
Probab=98.20  E-value=5.2e-05  Score=56.21  Aligned_cols=241  Identities=15%  Similarity=0.139  Sum_probs=128.3

Q ss_pred             CCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             66425702159999999999999986124677761199994158189999985998998886598655666999775310
Q gi|254781172|r   92 SIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIP  171 (731)
Q Consensus        92 ~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~  171 (731)
                      -.|||. ..+.+.+++....             ...|.+|+|+||+=+-+++.+|. ++..||    -|+|+|...  ..
T Consensus       227 ~~PMLA-~~~~~~~~~~~~~-------------~~~~~~E~K~DG~R~~ih~~~~~-v~~~SR----~g~~~t~~~--~~  285 (579)
T 3l2p_A          227 VQPMLA-EACKSVEYAMKKC-------------PNGMFSEIKYDGERVQVHKNGDH-FSYFSR----SLKPVLPHK--VA  285 (579)
T ss_dssp             CCCCEE-EECCCHHHHHHHC-------------TTCEEEEECCCSEEEEEEEETTE-EEEECT----TSCBCCGGG--TT
T ss_pred             CCCCCC-CCCCCHHHHHHHC-------------CCCEEEEECCCCEEEEEEEECCE-EEEEEC----CCCCCCCCC--CH
T ss_conf             864649-9789979999755-------------88748885247679999980999-999938----997467541--00


Q ss_pred             CCCCCCCC--CCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCC
Q ss_conf             24322335--4455048999999852021234556431485433423456777752345555301110566410245433
Q gi|254781172|r  172 TIPRVLSL--NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEI  249 (731)
Q Consensus       172 ~iP~~l~~--~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~  249 (731)
                      .+|..+..  .....+.+-||+++-...          .|.     |+...+...|.+. .....++.|++|++...++.
T Consensus       286 ~~~~~i~~~~~~~~~~ILDGElv~~d~~----------~~~-----~~~f~~l~~~~~~-~~~~~~~~~~vFDil~~~g~  349 (579)
T 3l2p_A          286 HFKDYIPQAFPGGHSMILDSEVLLIDNK----------TGK-----PLPFGTLGVHKKA-AFQDANVCLFVFDCIYFNDV  349 (579)
T ss_dssp             TGGGTHHHHSTTCSEEEEEEEEEEBCTT----------TCC-----BCCGGGGSHHHHH-HCSSCCEEEEEEEEEEETTE
T ss_pred             HHHHHHHHHCCCCCCEEEEEEEEEEECC----------CCC-----CCCHHHHHHHHHH-HCCCCCEEEEEEEEECCCCC
T ss_conf             0178999854677557996248986378----------886-----3748998666552-13568749999864301894


Q ss_pred             C--CCCCHHHHHHHHHCCCCCCCC-----EEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCC
Q ss_conf             2--100003689999759966541-----488740321134556655310011234376377731100011158765686
Q gi|254781172|r  250 F--AKGQYEMLQKMRCLGFPVNNG-----VRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSP  322 (731)
Q Consensus       250 ~--~~~~~e~l~~L~~~GF~v~~~-----~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~P  322 (731)
                      .  -....+..+.|..+--++...     ...+.+.+++..++++..+.      .-.|+|+|--+-.+.  .|..+   
T Consensus       350 ~l~~~pl~eRr~~L~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~------g~EGlm~K~~~s~Y~--~g~R~---  418 (579)
T 3l2p_A          350 SLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQE------GLEGLVLKDVKGTYE--PGKRH---  418 (579)
T ss_dssp             ECTTSCHHHHHHHHHHHCCCBTTTEEECCEEEECSHHHHHHHHHHHHHT------TCCCEEEEESSCCCC--TTCEE---
T ss_pred             CHHHCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHC------CCCCEECCCCCCCCC--CCCCC---
T ss_conf             0432609999999998761388549997323268889999999999970------654111346789898--99866---


Q ss_pred             CCEEEEC--CC-----CCEEEEEEEEEEEEECC-CCEEEE--EEEEEEEEECCCEEEEE-CCCCHHHHHHH
Q ss_conf             6312311--45-----62158998788994035-622589--99974333026400010-14898999750
Q gi|254781172|r  323 RWMISHK--FA-----EKQASTRLLDIDIQIGR-TGILTP--VARLEPVNIGGALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       323 rwaiA~K--f~-----~e~~~T~v~~I~wqvgR-tG~itP--va~~ePV~l~G~~V~ra-tlhN~~~I~~l  382 (731)
                       |- =.|  +-     .++..-+|.+..|--|| .|.++-  ++..++-.-.=.+|.++ |++.....+.|
T Consensus       419 -w~-K~K~~~~~~~~~~dt~D~vivg~~~g~gkr~~~~~~~l~g~~d~~~~~~~~v~kvgsG~sd~~~~~l  487 (579)
T 3l2p_A          419 -WL-KVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARL  487 (579)
T ss_dssp             -EE-EECTTTCC---CCEEEEEEEEEEECCCTTSCSSCCEEEEEEECTTTSSEEEEEEECTTCCHHHHHHT
T ss_pred             -CE-EEECHHHHCCCCCCCEEEEEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             -76-8812576545666631478987781788778861279999996899879999897489999999999


No 35 
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens}
Probab=98.16  E-value=3.9e-06  Score=64.92  Aligned_cols=80  Identities=18%  Similarity=0.227  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC-CEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHH
Q ss_conf             2468821686699972588998789999999829849981116-321799778888637989974991737999999998
Q gi|254781172|r  641 KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR-KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ  719 (731)
Q Consensus       641 ~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk-kT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~  719 (731)
                      ...+..|.|.+|+++| +...+|++++++|+.+||++...+++ ++++||+....++|..+|+  |++|++++.+.+=+.
T Consensus         7 ~~~~~iF~g~~~~vsg-~~~~~~~~l~~lI~~~GG~~~~~~~~~~~ThlI~~~~~~~k~~~~~--~~~iV~~~Wi~dci~   83 (97)
T 2ebw_A            7 GTSSTIFSGVAIYVNG-YTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELK--GEKVIRPEWIVESIK   83 (97)
T ss_dssp             SCCCCTTTTCEEEECS-SCSSCHHHHHHHHHHTTCEECSSCCSSSCCEEECSCCCTTHHHHTS--SSCCBCTHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEEC-CCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEECCCCCHHHHHHC--CCCEECHHHHHHHHH
T ss_conf             9834268996999968-9973899999999987999950446888669997789968999847--998846999999998


Q ss_pred             HHCC
Q ss_conf             8286
Q gi|254781172|r  720 QYNT  723 (731)
Q Consensus       720 ~~~~  723 (731)
                      +...
T Consensus        84 ~~~~   87 (97)
T 2ebw_A           84 AGRL   87 (97)
T ss_dssp             HTSC
T ss_pred             CCCC
T ss_conf             5985


No 36 
>2xnk_A DNA topoisomerase 2-binding protein 1; phosphorylation, protein-protein interaction; HET: DNA; 2.60A {Homo sapiens} PDB: 2xnh_A*
Probab=98.13  E-value=4.4e-06  Score=64.53  Aligned_cols=80  Identities=20%  Similarity=0.227  Sum_probs=70.0

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             68821686699972588998789999999829849981116321799778888637989974991737999999998828
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      -+..|.|++||+|| |..-.|+++.++|+.+||++..+++.+|++||++...|.|+..|.++|++|++.+.+.+.+....
T Consensus       104 ~~~~l~g~~i~~sg-~~~~e~~~i~~~i~~~GG~v~~~~~~~~ThlI~~~~~~~Ky~~A~~~~~~iv~~~Wl~~~~~~~~  182 (292)
T 2xnk_A          104 YNMVMSDVTISCTS-LEKEKREEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQ  182 (292)
T ss_dssp             CCCTTTTCEEEEES-CCHHHHHHHHHHHHHTTCEECSSCCTTCCEEEESSSCSHHHHHHHHTTCCEECTHHHHHHHHHHH
T ss_pred             CCCCCCCCEEEECC-CCHHHHHHHHHHHHHCCCEEECCCCCCEEEEEEECCCCCHHHHHHHHCCCCCCCHHHHHHHHHCC
T ss_conf             63036996899848-99899999999999879999477688703999956898276766650787547299999998086


Q ss_pred             C
Q ss_conf             6
Q gi|254781172|r  723 T  723 (731)
Q Consensus       723 ~  723 (731)
                      .
T Consensus       183 ~  183 (292)
T 2xnk_A          183 E  183 (292)
T ss_dssp             T
T ss_pred             C
T ss_conf             4


No 37 
>2wt8_A Microcephalin; cell cycle, chromosome condensation, dwarfism, polymorphism, microcephaly, phosphoprotein, mental retardation, primary microcephaly; HET: MSE; 1.60A {Homo sapiens} PDB: 3ktf_A*
Probab=98.11  E-value=1.4e-05  Score=60.67  Aligned_cols=80  Identities=16%  Similarity=0.085  Sum_probs=68.4

Q ss_pred             CCCCCCCCEEEEECCCCCC---CHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHH
Q ss_conf             6882168669997258899---8789999999829849981116321799778888637989974991737999999998
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKI---QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ  719 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~---~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~  719 (731)
                      ....|.|-+++|+|.....   .++.+.++++.+||+++..++.+|++||+.+..++|+.+|.+.||+|++.+.+.+=+.
T Consensus         4 ~~pil~g~~i~v~~~~~~~~~~~~~~l~~~i~~~Gg~~~~~~~~~~THlI~~~~~~~k~~~a~~~~i~iV~~~Wl~~c~~   83 (97)
T 2wt8_A            4 AAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRT   83 (97)
T ss_dssp             CCCTTTTCEEEEEEBCTTSCCBCHHHHHHHHHHTTCEECSSCCTTCCEEEEESCCHHHHHHHHHHTCEEECHHHHHHHHH
T ss_pred             CCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCEEEEECCCCHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             77678982899998759976789999999999879999625558823999807982999999874997587899999999


Q ss_pred             HHC
Q ss_conf             828
Q gi|254781172|r  720 QYN  722 (731)
Q Consensus       720 ~~~  722 (731)
                      +..
T Consensus        84 ~~~   86 (97)
T 2wt8_A           84 AGA   86 (97)
T ss_dssp             HTS
T ss_pred             HCC
T ss_conf             397


No 38 
>1a0i_A DNA ligase; DNA replication; HET: DNA ATP; 2.60A {Enterobacteria phage T7} SCOP: b.40.4.6 d.142.2.1
Probab=97.92  E-value=0.0001  Score=53.93  Aligned_cols=201  Identities=12%  Similarity=0.155  Sum_probs=106.3

Q ss_pred             EEEEEEECCEEEEEEEEEC-CEEEEEEECCCCHHHHHHHHHHHHHCC----CCCCCC---CCCCCEEEEEEEEEEECHHH
Q ss_conf             1999941581899999859-989988865986556669997753102----432233---54455048999999852021
Q gi|254781172|r  127 FFTLEPKIDGTMITIRYEK-GKFVYAALRGDGHSGEDVSACIRAIPT----IPRVLS---LNIPEIIEVRGEVYISKNDF  198 (731)
Q Consensus       127 ~~~vepKiDG~sisl~Y~~-G~L~~a~TRGdG~~GeDVT~n~~~i~~----iP~~l~---~~~~~~ieiRGEv~m~~~~F  198 (731)
                      .+++|+|+||.=+-+++.+ |. +...||    .|.++|+ +..+..    +|..+.   ...|..+.+-||+++...+|
T Consensus        27 ~~~~E~K~DG~R~~i~~~~~g~-v~~~SR----~g~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~~iLDGElv~~~~~f  100 (348)
T 1a0i_A           27 YLIAEIKYDGVRGNICVDNTAN-SYWLSR----VSKTIPA-LEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDF  100 (348)
T ss_dssp             SEEEEECCCSEEEEEEEETTSE-EEEECT----TSCBCGG-GGGGCEECHHHHHHHHSTTCCCTTEEEEEEEEEESSSCT
T ss_pred             CEEEEEEECCEEEEEEEECCCE-EEEECC----CCCCCCC-CHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCC
T ss_conf             6899971060269999979954-999837----9987675-110013456788876666531588879997998515785


Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHH----HCCCH--HHH-HCCCEEEEEEECCCCCC-----------CCCCCHHHHHH
Q ss_conf             23455643148543342345677775----23455--553-01110566410245433-----------21000036899
Q gi|254781172|r  199 LALNDEMIAVGRKPYANPRNAASGIL----RRLNP--TDI-TRYLNFFVHGLGKTSEI-----------FAKGQYEMLQK  260 (731)
Q Consensus       199 ~~lN~~~~~~g~~~f~NpRN~aaG~l----r~~d~--~~~-~r~L~f~ay~~~~~~~~-----------~~~~~~e~l~~  260 (731)
                      +.+..........  .++.......+    ++...  ... ..++.|++|++...+..           ......+.+..
T Consensus       101 ~~~~~~l~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vFDil~l~~~~~~~~~~~~~~~~~~r~~~l~~  178 (348)
T 1a0i_A          101 NTGSGLLRTKWTD--TKNQEFHEELFVEPIRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLP  178 (348)
T ss_dssp             TTHHHHHHCCSCC--SSBSSCC--------CCCSCCCCCBCTTTEEEEEEEEEEHHHHHHCCCEEEEHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHCCC--CCCCCCCHHHHHHHHHCCCCHHHHHCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             2035666441134--45664616777666511454266650286499998888046655554420111002899999998


Q ss_pred             -HHHCCCCC---CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCC-CEE
Q ss_conf             -99759966---5414887403211345566553100112343763777311000111587656866312311456-215
Q gi|254781172|r  261 -MRCLGFPV---NNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAE-KQA  335 (731)
Q Consensus       261 -L~~~GF~v---~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~-e~~  335 (731)
                       +....-.+   ......+.+.+++.+++++..+      -...|||+|--+-.++  -|..+   .|   +|+.. .+.
T Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~------~g~EGimiK~~~s~Y~--~Grr~---~w---~K~K~~~~~  244 (348)
T 1a0i_A          179 LLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRA------EGHEGLIVKDPMCIYK--RGKKS---GW---WKMKPENEA  244 (348)
T ss_dssp             HHHHHCTTSEEEECCEEEESSHHHHHHHHHHHHT------TTCCCEEEECTTCEEC--SEEEE---EE---EEESCCEEE
T ss_pred             HHHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHH------CCCCEEEECCCCCCCC--CCCCC---CC---EEECCCCCE
T ss_conf             7665078763698346843999999999999986------4972056017998788--99966---83---830688847


Q ss_pred             EEEEEEEEEEECCC
Q ss_conf             89987889940356
Q gi|254781172|r  336 STRLLDIDIQIGRT  349 (731)
Q Consensus       336 ~T~v~~I~wqvgRt  349 (731)
                      .-+|.+..|-.|+.
T Consensus       245 d~vIiG~~~G~g~~  258 (348)
T 1a0i_A          245 DGIIQGLVWGTKGL  258 (348)
T ss_dssp             EEEEEEEECCCTTT
T ss_pred             EEEEEEEEECCCCC
T ss_conf             89999998378874


No 39 
>2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A
Probab=97.86  E-value=9.2e-06  Score=62.07  Aligned_cols=53  Identities=17%  Similarity=0.260  Sum_probs=48.2

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCH
Q ss_conf             010111168999999882998999997897761251177876138886789999999996697
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNP  619 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~  619 (731)
                      ++|||||..+|+.|+++|+|+.++..          ++.++|+.|+|||++.|+.|.++|+.|
T Consensus       165 ~~Ipgi~~~~A~~Ll~~f~Sl~~l~~----------as~~eL~~v~giG~~~A~~I~~~l~~p  217 (219)
T 2bgw_A          165 QSFPGIGRRTAERILERFGSLERFFT----------ASKAEISKVEGIGEKRAEEIKKILMTP  217 (219)
T ss_dssp             HTSTTCCHHHHHHHHHHHSSHHHHTT----------CCHHHHHHSTTCCHHHHHHHHHHHHSC
T ss_pred             HCCCCCCHHHHHHHHHHCCCHHHHHH----------CCHHHHHCCCCCCHHHHHHHHHHHCCC
T ss_conf             40799899999999998699999986----------889999608997999999999996385


No 40 
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A*
Probab=97.78  E-value=8.2e-05  Score=54.72  Aligned_cols=77  Identities=13%  Similarity=0.040  Sum_probs=44.1

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEE-EEC----CEEEEEE--C--CC--CCCHHHHHHHCCCEEECHH
Q ss_conf             8821686699972588998789999999829849981-116----3217997--7--88--8863798997499173799
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI-LSR----KTDIIIV--G--DN--PGSKLEKAQQLGVKIMNEE  712 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sS-VSk----kT~~LI~--g--e~--~gSKl~KA~~LgI~Ii~e~  712 (731)
                      .+.|.|..|+++|.... .+.+....+...|+.+... .+.    .+..++.  .  +.  .+.+...|.+.||||++.+
T Consensus       149 ~~lf~g~~v~i~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~i~vV~~e  227 (241)
T 2vxb_A          149 KGPLFGKKILFIIPEAK-SWQKKIENTEQGQKALAHVYHALALGADVEIRPNVAHLECDLILTMDGNIVDETNCPVVDPE  227 (241)
T ss_dssp             CCTTTTCEEEECCCC-------------CHHHHHHHHHHHHHTTCEEECCSCCSSCCCSEEECSSSCCCSSCSSCEECHH
T ss_pred             CCCCCCCEEEEECCCCC-CHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEEECCCHHHHHCHHHHHHHHCCCCCEECHH
T ss_conf             88768838999648886-78999999994697276420232357763355310362031211078889865899798799


Q ss_pred             HHHHHHHHH
Q ss_conf             999999882
Q gi|254781172|r  713 QFLFLLQQY  721 (731)
Q Consensus       713 ef~~ll~~~  721 (731)
                      .+.+-|-..
T Consensus       228 Wl~~ci~~g  236 (241)
T 2vxb_A          228 WIVECLISQ  236 (241)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHCC
T ss_conf             999999848


No 41 
>1fvi_A Chlorella virus DNA ligase-adenylate; adenylated DNA ligase; HET: AMP; 2.00A {Chlorella virus} SCOP: b.40.4.6 d.142.2.1 PDB: 2q2t_A* 2q2u_A* 1p8l_A*
Probab=97.66  E-value=0.00025  Score=51.00  Aligned_cols=177  Identities=13%  Similarity=0.173  Sum_probs=92.2

Q ss_pred             CEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHH
Q ss_conf             11999941581899999859989988865986556669997753102432233544550489999998520212345564
Q gi|254781172|r  126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEM  205 (731)
Q Consensus       126 ~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~  205 (731)
                      .++.+|||+||+=+-   .+.   +..||    .|+|+|+....     ..+....|..  +=||++....+|+.+    
T Consensus        19 ~p~~~e~K~DG~R~~---~~v---~l~SR----~g~~~~~~~~~-----~~~~~~~~~~--lDGEl~~~~~~f~~~----   77 (297)
T 1fvi_A           19 FPCLATPKIAGIRSV---KQT---QMLSR----TFKPIRNSVMN-----RLLTELLPEG--SDGEISIEGATFQDT----   77 (297)
T ss_dssp             SSEEEEECCCSEEEE---ESS---SEECT----TSCBCSCHHHH-----HHHHHHSCTT--EEEEEECTTSCHHHH----
T ss_pred             CCEEEEECCCCEEEE---EEE---EEECC----CCCCCCCCCHH-----HHHHHCCCCC--EEEEEEECCCCHHHH----
T ss_conf             718999564518898---535---79999----99805641249-----9997578855--355799738998999----


Q ss_pred             HHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCC------CCCCC--C----EE
Q ss_conf             314854334234567777523455553011105664102454332100003689999759------96654--1----48
Q gi|254781172|r  206 IAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLG------FPVNN--G----VR  273 (731)
Q Consensus       206 ~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~~~~~~e~l~~L~~~G------F~v~~--~----~~  273 (731)
                                     .+.+++..+.. ..++.|++|++.......  ...+.++.|+++=      +....  .    ..
T Consensus        78 ---------------~~~~~~~~~~~-~~~~~~~vFDil~~~~~~--~~~eR~~~L~~~~~~~~~~~~~~~~~~~~~~~~  139 (297)
T 1fvi_A           78 ---------------TSAVMTGHKMY-NAKFSYYWFDYVTDDPLK--KYIDRVEDMKNYITVHPHILEHAQVKIIPLIPV  139 (297)
T ss_dssp             ---------------HHHHHSCC-----CCEEEEEEEECSSCTTS--CHHHHHHHHHHHHHHCGGGGGCSSEEEEECCCE
T ss_pred             ---------------HHHHHHCCCCC-CCCEEEEEEEEECCCCCC--HHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEE
T ss_conf             ---------------99875314551-213588899974577633--288999999999874510003576148985457


Q ss_pred             EEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCC-CCCCCEEEECCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             8740321134556655310011234376377731100011158765-68663123114562158998788994035622
Q gi|254781172|r  274 QANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERA-RSPRWMISHKFAEKQASTRLLDIDIQIGRTGI  351 (731)
Q Consensus       274 ~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts-~~PrwaiA~Kf~~e~~~T~v~~I~wqvgRtG~  351 (731)
                      .+.+.+++.++++...+      -.-.|||+|-.+-.+  ..|.++ +...| +-+| +...++-+|.++.+..|+.+.
T Consensus       140 ~~~~~~e~~~~~~~~~~------~g~EGiv~K~~~s~Y--~~G~~~~R~~~w-~K~K-~~~~~d~~Ivg~~~~~g~~~~  208 (297)
T 1fvi_A          140 EINNITELLQYERDVLS------KGFEGVMIRKPDGKY--KFGRSTLKEGIL-LKMK-QFKDAEATIISMTALFKNTNT  208 (297)
T ss_dssp             EECSHHHHHHHHHHHHH------TTCCSEEEECTTCCC--CSSBCCTTTTSS-EEEC-CCEEEEEEEEEEEESCC----
T ss_pred             ECCCHHHHHHHHHHHHH------CCCCCEEEECCCCCC--CCCCCCCCCCCE-EECC-CCCCCEEEEEEEEECCCCCCC
T ss_conf             44999999999987876------698731775388877--678753445660-0335-545515899999826776675


No 42 
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A*
Probab=97.65  E-value=2.5e-05  Score=58.66  Aligned_cols=52  Identities=19%  Similarity=0.139  Sum_probs=47.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCH
Q ss_conf             010111168999999882998999997897761251177876138886789999999996697
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNP  619 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~  619 (731)
                      ..|||||.++++.|.++|+|+.++.+          ++.++|.+|.| |++.|+.|.+||+.+
T Consensus         7 ~~IPGIg~~~~~~Ll~~fgSi~~l~~----------as~eeL~~v~G-~~~~A~~i~~~l~~~   58 (63)
T 2a1j_A            7 LKMPGVNAKNCRSLMHHVKNIAELAA----------LSQDELTSILG-NAANAKQLYDFIHTS   58 (63)
T ss_dssp             HTSTTCCHHHHHHHHHHCSSHHHHHT----------CCHHHHHHHHS-CHHHHHHHHHHHHCC
T ss_pred             HCCCCCCHHHHHHHHHHCCCHHHHHH----------CCHHHHHHCCC-CHHHHHHHHHHHCCC
T ss_conf             52999889999999998679999987----------99999987869-899999999998021


No 43 
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A*
Probab=97.58  E-value=5.9e-05  Score=55.83  Aligned_cols=57  Identities=19%  Similarity=0.180  Sum_probs=49.6

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHH
Q ss_conf             6677630101111689999998829989999978977612511778761388867899999999966979
Q gi|254781172|r  551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPR  620 (731)
Q Consensus       551 ~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~  620 (731)
                      ..+|  ..|||||.++++.|.++|+++..+..+          +.++|.+|.| |+..|+.|.+||+.+.
T Consensus        17 ~~~L--~~iPGIg~k~~~~Ll~~f~sl~~i~~A----------S~eeL~~v~G-~~~~Ak~i~~~lh~~~   73 (84)
T 1z00_B           17 QDFL--LKMPGVNAKNCRSLMHHVKNIAELAAL----------SQDELTSILG-NAANAKQLYDFIHTSF   73 (84)
T ss_dssp             HHHH--HTCSSCCHHHHHHHHHHSSCHHHHHHS----------CHHHHHHHHS-CHHHHHHHHHHHTSBH
T ss_pred             HHHH--HCCCCCCHHHHHHHHHHCCCHHHHHHC----------CHHHHHHCCC-CHHHHHHHHHHHCCCC
T ss_conf             9999--838999999999999996699999859----------9999988759-7999999999985535


No 44 
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A*
Probab=97.53  E-value=9.7e-05  Score=54.13  Aligned_cols=82  Identities=9%  Similarity=0.038  Sum_probs=68.2

Q ss_pred             CCCCCCCCCEEEEEC-CCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHH----------CCCEEEC
Q ss_conf             468821686699972-58899878999999982984998111632179977888863798997----------4991737
Q gi|254781172|r  642 NVSSEIENKKLVFTG-TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ----------LGVKIMN  710 (731)
Q Consensus       642 ~~~~~l~gk~vV~TG-tl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~----------LgI~Ii~  710 (731)
                      .....|.|.+|.|-| .+.+.+|+.++++++.+||++...+|..+++||+.+..++|...+.+          .+++|++
T Consensus         6 ~~~~~F~g~~i~i~~~~~~~~rr~~L~~li~~~Gg~v~~~~s~~vTHvI~~~~~~~k~~~~~~~~~~~~~~~~~~~~VV~   85 (133)
T 2dun_A            6 SGSTRFPGVAIYLVEPRMGRSRRAFLTGLARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLD   85 (133)
T ss_dssp             CSSCSEEEEEEEECHHHHCSHHHHHHHHHHHHHTEEECSSCCTTCCEEEESSCCHHHHHHHHHHHHHHSCTTCCCCEEEE
T ss_pred             CCCCEECCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             99866289799997898888999999999998598997312788778996278728999999987653014578864974


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999988286
Q gi|254781172|r  711 EEQFLFLLQQYNT  723 (731)
Q Consensus       711 e~ef~~ll~~~~~  723 (731)
                      .+.|.+=+++..-
T Consensus        86 ~~Wl~dCi~~gk~   98 (133)
T 2dun_A           86 ISWLTESLGAGQP   98 (133)
T ss_dssp             HHHHHHHHHHTSC
T ss_pred             HHHHHHHHHCCCC
T ss_conf             7999999985981


No 45 
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin ligase, antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A
Probab=97.49  E-value=0.00049  Score=48.67  Aligned_cols=80  Identities=16%  Similarity=0.126  Sum_probs=61.3

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC------------------------CEEEEEECCCCCCHH
Q ss_conf             68821686699972588998789999999829849981116------------------------321799778888637
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR------------------------KTDIIIVGDNPGSKL  698 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk------------------------kT~~LI~ge~~gSKl  698 (731)
                      ....|+|.+|+++|.+....|++++++|+..||++.++..+                        .+++++.........
T Consensus       101 ~~~lf~g~~~~~~~~~~~~~~~~l~~li~~~Gg~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~  180 (210)
T 2nte_A          101 LPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHP  180 (210)
T ss_dssp             CCCTTTTCEEEECSCCSSSCHHHHHHHHHHTTCEEESSCCCGGGCGGGSSCCCCTTSCTTCGGGTCCEEEEECSCSSCCC
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCEEEEEECCCCHHHH
T ss_conf             76433785899945888848999999999789999825666432234665325522457855344204776232224799


Q ss_pred             HHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             989974991737999999998828
Q gi|254781172|r  699 EKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       699 ~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      ..|...++++++.+.+.+=|..+.
T Consensus       181 ~~~~~~~~~~V~~~Wl~dcI~~~~  204 (210)
T 2nte_A          181 ERVRQGKVWKAPSSWFIDCVMSFE  204 (210)
T ss_dssp             SCSEETTEEEEEHHHHHHHHHHTS
T ss_pred             HHHHCCCCEEECHHHHHHHHHHCC
T ss_conf             999809997977999999999198


No 46 
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 1t2u_A 1n5o_X 3k15_A* 3k16_A* 2ing_X 1oqa_A
Probab=97.45  E-value=0.00045  Score=48.96  Aligned_cols=81  Identities=17%  Similarity=0.147  Sum_probs=62.4

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECC------EEEEEEC-CC---CCCHHHHHHHCCCEEECHH
Q ss_conf             688216866999725889987899999998298499811163------2179977-88---8863798997499173799
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRK------TDIIIVG-DN---PGSKLEKAQQLGVKIMNEE  712 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkk------T~~LI~g-e~---~gSKl~KA~~LgI~Ii~e~  712 (731)
                      ....|.|..|+++|.+....|+++.++|+..||++.++.+..      +.++++- +.   ...+...|.+.++++++.+
T Consensus       112 ~~~lF~g~~~~i~~~~~~~~~~~l~~lI~~~GG~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~iV~~~  191 (214)
T 1t15_A          112 DRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTRE  191 (214)
T ss_dssp             TSCTTTTCEEEECSCCSSSCHHHHHHHHHHTTCEECCSGGGCCCSTTCCEEEEECGGGCSSCGGGGSSTTTCSSCEEEHH
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHCCCEEEEHH
T ss_conf             77768997447655888858999999999869999533575444555442034225543114799999996699396499


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999988286
Q gi|254781172|r  713 QFLFLLQQYNT  723 (731)
Q Consensus       713 ef~~ll~~~~~  723 (731)
                      .+.+=|..+..
T Consensus       192 Wl~dsi~~~~~  202 (214)
T 1t15_A          192 WVLDSVALYQC  202 (214)
T ss_dssp             HHHHHHHHTSC
T ss_pred             HHHHHHHHCCC
T ss_conf             99999996995


No 47 
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=97.42  E-value=0.00037  Score=49.67  Aligned_cols=81  Identities=14%  Similarity=0.125  Sum_probs=66.1

Q ss_pred             CCCCCCCCEEEEECC-CCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHH-------CCCEEECHHHH
Q ss_conf             688216866999725-8899878999999982984998111632179977888863798997-------49917379999
Q gi|254781172|r  643 VSSEIENKKLVFTGT-LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ-------LGVKIMNEEQF  714 (731)
Q Consensus       643 ~~~~l~gk~vV~TGt-l~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~-------LgI~Ii~e~ef  714 (731)
                      ....|.|..|.|.+. +..-+|..++++++.+||++..++++++++||+.+..+.|...+.+       .+++|++.+.+
T Consensus        17 ~~~~F~~~~iyiv~~~~~~~rr~~l~~li~~~Gg~v~~~~~~~vTHvI~~~~~~~~~~~~~k~~~~~~~~~~~IVs~~Wl   96 (120)
T 2coe_A           17 QDIKFQDLVVFILEKKMGTTRRALLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWL   96 (120)
T ss_dssp             SCCSCTTCEEEEECTTTCHHHHHHHHHHHHHHTCEECSSCCTTCCEEEESSCCHHHHHHHHHHCCCCCSSCCEEEEHHHH
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEECCHHH
T ss_conf             76104865999957889979999999999985999973236883089982587289999998765410688769740689


Q ss_pred             HHHHHHHCC
Q ss_conf             999988286
Q gi|254781172|r  715 LFLLQQYNT  723 (731)
Q Consensus       715 ~~ll~~~~~  723 (731)
                      .+=+++..-
T Consensus        97 ~dC~~~gk~  105 (120)
T 2coe_A           97 IECIGAGKP  105 (120)
T ss_dssp             HHHHHTTSC
T ss_pred             HHHHHCCCC
T ss_conf             999986798


No 48 
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A
Probab=97.42  E-value=0.00043  Score=49.18  Aligned_cols=80  Identities=13%  Similarity=0.146  Sum_probs=65.5

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC---CEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHH
Q ss_conf             8821686699972588998789999999829849981116---3217997788886379899749917379999999988
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR---KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ  720 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk---kT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~  720 (731)
                      ...|.|.+|+++|... -.|+++.++|+..||++..+...   .++++|..+..+.+...|.+.||++++.+.+.+-|..
T Consensus       113 ~~lF~g~~~~i~~~~~-~~~~~l~~li~~~GG~v~~~~~~~~~~~~~vi~~~~~~~~~~~~~~~~i~vv~~~Wl~d~i~~  191 (209)
T 2etx_A          113 RRLLEGYEIYVTPGVQ-PPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLK  191 (209)
T ss_dssp             SCTTTTCEEEECTTCS-SCHHHHHHHHHHTTCEECSSCCCSCCTTEEEECCGGGGGGCHHHHHHTCCEECTHHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCC-CCHHHHHHHHHHCCCEEEECCCCCCCCCEEEEECCCCHHHHHHHHHCCCEEECHHHHHHHHHH
T ss_conf             4655882899936888-769999999998699896015777777579994588779999999789919979999999996


Q ss_pred             HCCC
Q ss_conf             2865
Q gi|254781172|r  721 YNTT  724 (731)
Q Consensus       721 ~~~~  724 (731)
                      ..-.
T Consensus       192 ~~l~  195 (209)
T 2etx_A          192 QEAK  195 (209)
T ss_dssp             TCCC
T ss_pred             CCCC
T ss_conf             8978


No 49 
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3
Probab=97.42  E-value=0.00059  Score=48.07  Aligned_cols=79  Identities=13%  Similarity=0.120  Sum_probs=57.4

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECC----EE--EEEECCC----CCCHHHHHHHCCCEEECHHH
Q ss_conf             88216866999725889987899999998298499811163----21--7997788----88637989974991737999
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRK----TD--IIIVGDN----PGSKLEKAQQLGVKIMNEEQ  713 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkk----T~--~LI~ge~----~gSKl~KA~~LgI~Ii~e~e  713 (731)
                      ...+.|..+++.|.+..-.+++++.+|+..||++.......    +.  .+++.+.    ...+..-|.+.+++|++.+.
T Consensus       115 ~~~~~~~~~~~~~~~~~~~~~~l~~li~~~Gg~v~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~iV~~~W  194 (229)
T 1l0b_A          115 EKLFEGLQIYCCEPFTNMPKDELERMLQLCGASVVKELPLLTRDTGAHPIVLVQPSAWTEDNDCPDIGQLCKGRLVMWDW  194 (229)
T ss_dssp             --CCTTCEEEECSCCSSSCHHHHHHHHHHTTCEEECSSSCGGGCCSSCCEEEEC-------------------CEEETHH
T ss_pred             CCCCCCCCEECCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEHHH
T ss_conf             43237861132587778789999999998698885226643457773279996577420147999999975995970999


Q ss_pred             HHHHHHHHC
Q ss_conf             999998828
Q gi|254781172|r  714 FLFLLQQYN  722 (731)
Q Consensus       714 f~~ll~~~~  722 (731)
                      +.+=|..+.
T Consensus       195 l~dsi~~~~  203 (229)
T 1l0b_A          195 VLDSISVYR  203 (229)
T ss_dssp             HHHHHHTTS
T ss_pred             HHHHHHHCC
T ss_conf             999999498


No 50 
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B
Probab=97.32  E-value=0.0028  Score=42.84  Aligned_cols=81  Identities=16%  Similarity=0.112  Sum_probs=64.1

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC----------CEEEEEECCCC-CCHHHHHHHCCCEEEC
Q ss_conf             468821686699972588998789999999829849981116----------32179977888-8637989974991737
Q gi|254781172|r  642 NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR----------KTDIIIVGDNP-GSKLEKAQQLGVKIMN  710 (731)
Q Consensus       642 ~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk----------kT~~LI~ge~~-gSKl~KA~~LgI~Ii~  710 (731)
                      ....+|.|..|++++....-.++.+..+++..||++..+..+          +++++|+.... +.+..+|++.||+|++
T Consensus       151 ~~~~lf~g~~i~~~~~~~~~~~~~~~~li~~~Ga~~~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~i~iv~  230 (259)
T 1kzy_C          151 PRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVS  230 (259)
T ss_dssp             CCCCTTTTCEEEEEESCTTTTHHHHHHHHHHTTCSEEEEEESSSSCCCSCGGGCSEEEECTTCCHHHHHHHHHHTCCEEC
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEC
T ss_conf             46876689889997689864699999999978998945256533222246787529998489868999999877996988


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999998828
Q gi|254781172|r  711 EEQFLFLLQQYN  722 (731)
Q Consensus       711 e~ef~~ll~~~~  722 (731)
                      .+.+.+=|-...
T Consensus       231 ~eWl~~sii~g~  242 (259)
T 1kzy_C          231 QEWVIQCLIVGE  242 (259)
T ss_dssp             HHHHHHHHHHTS
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999998198


No 51 
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A
Probab=97.31  E-value=0.00037  Score=49.62  Aligned_cols=65  Identities=17%  Similarity=0.236  Sum_probs=32.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCC-CCHHHHHHHCCCEEECHHHHHHHHHH
Q ss_conf             69997258899878999999982984998111632179977888-86379899749917379999999988
Q gi|254781172|r  651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP-GSKLEKAQQLGVKIMNEEQFLFLLQQ  720 (731)
Q Consensus       651 ~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~-gSKl~KA~~LgI~Ii~e~ef~~ll~~  720 (731)
                      .++|||    +..++.+++|+++||+++.+.+ ++++||++... +-|+..|-.+|++|++.+.+.+-++.
T Consensus        14 ~v~~tg----~~~~~~~~~i~~lGg~v~~~~~-~~THlI~~~~~rt~K~l~Ala~g~~IVs~~Wl~~~~~~   79 (209)
T 2etx_A           14 KVLFTG----VVDARGERAVLALGGSLAGSAA-EASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKA   79 (209)
T ss_dssp             EEEECS----SCCHHHHHHHHHTTCEECSSTT-TCSEEECSSCCCSHHHHHHHHHTCCEECTHHHHHHHHH
T ss_pred             EEEECC----CCCHHHHHHHHHCCCEEECCCC-CCEEEEECCCCCCHHHHHHHHCCCCEECHHHHHHHHHH
T ss_conf             899719----8978999999988989979888-87599989999989999999709979707999999986


No 52 
>1s68_A RNA ligase 2; ribonucleic acid ligase, RNA repair; HET: AMP; 1.90A {Enterobacteria phage T4} SCOP: d.142.2.4
Probab=97.26  E-value=0.003  Score=42.68  Aligned_cols=138  Identities=18%  Similarity=0.155  Sum_probs=71.3

Q ss_pred             CCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHH-------HH-HHHHHH
Q ss_conf             5702159999999999999986124677761199994158189999985998998886598655-------66-699977
Q gi|254781172|r   96 LSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHS-------GE-DVSACI  167 (731)
Q Consensus        96 lSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~-------Ge-DVT~n~  167 (731)
                      .|++|.|...-|.+-..        .+....+|++|-|+||..+++++.+|++ ++.||+ |..       |. .+++.+
T Consensus         6 ~~~~~~~~~~~l~~~~~--------~~~~g~ewiveEKlDG~n~~i~~~g~~v-~~~sR~-~~l~~~~~~~g~~~~~~~l   75 (249)
T 1s68_A            6 SSLENHYNSKFIEKLYS--------LGLTGGEWVAREKIHGTNFSLIIERDKV-TCAKRT-GPILPAEDFFGYEIILKNY   75 (249)
T ss_dssp             CCCEETTCHHHHHHHHH--------HTCSCSCEEEEECCCSEEEEEEEESSCE-EEEETT-EECCTTCCCTTTHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHH--------CCCCCCEEEEEEEECCCCEEEEEECCEE-EEEECC-CCCCCCCCCCHHHHHHHHH
T ss_conf             45522256777777774--------1567983899997878047999989999-998058-7168865541178888888


Q ss_pred             -HHHCCCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEEC--
Q ss_conf             -53102432233544550489999998520212345564314854334234567777523455553011105664102--
Q gi|254781172|r  168 -RAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLG--  244 (731)
Q Consensus       168 -~~i~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~--  244 (731)
                       ..+..+-..+........++=||.+=+.                             .+++.  ...++.|++|++.  
T Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~Ge~~g~~-----------------------------~~~~~--~~~~~~f~~Fdi~~~  124 (249)
T 1s68_A           76 ADSIKAVQDIMETSAVVSYQVFGEFAGPG-----------------------------IQKNV--DYCDKDFYVFDIIVT  124 (249)
T ss_dssp             HHHHHHHHHHHHHHTEEEEEEEEEEESTT-----------------------------TSSSC--CCCSCEEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCC-----------------------------CCCCC--CCCCCCEEEEEEEEE
T ss_conf             89999865332110355521320103555-----------------------------12465--547643047999971


Q ss_pred             -CCCCCCCCCCHHHHHHHHHCCCCCCCCEEE
Q ss_conf             -454332100003689999759966541488
Q gi|254781172|r  245 -KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQ  274 (731)
Q Consensus       245 -~~~~~~~~~~~e~l~~L~~~GF~v~~~~~~  274 (731)
                       ......+-...+...+|...|++.+|...+
T Consensus       125 ~d~~~~~~l~~~~~~~~l~~~~L~~VP~l~r  155 (249)
T 1s68_A          125 TESGDVTYVDDYMMESFCNTFKFKMAPLLGR  155 (249)
T ss_dssp             ETTCCEEECCHHHHHHHHHHHTCEESCEEEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             2577551313999999998669985774756


No 53 
>3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus}
Probab=97.21  E-value=4.1e-05  Score=57.03  Aligned_cols=50  Identities=22%  Similarity=0.260  Sum_probs=45.2

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0101111689999998829989999978977612511778761388867899999999966
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ  617 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~  617 (731)
                      ..|||||+++++.|.++|+|++++..+          +.++|.++ |||+++|+.|.+||+
T Consensus       176 d~I~GIG~~~~~~Ll~~Fgs~~~i~~A----------s~eeL~~v-gI~~~~A~~I~~~l~  225 (226)
T 3c65_A          176 DDIPGVGEKRKKALLNYFGSVKKMKEA----------TVEELQRA-NIPRAVAEKIYEKLH  225 (226)
T ss_dssp             -------------------------------------------------------------
T ss_pred             CCCCCCCHHHHHHHHHHCCCHHHHHHC----------CHHHHHHC-CCCHHHHHHHHHHHC
T ss_conf             026886999999999981899999738----------99999876-999999999999962


No 54 
>2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A
Probab=97.13  E-value=0.00043  Score=49.16  Aligned_cols=50  Identities=16%  Similarity=0.174  Sum_probs=44.1

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0101111689999998829989999978977612511778761388867899999999966
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ  617 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~  617 (731)
                      ..|||||+++.+.|.++|+|++++..          ++.++|.+++|++ ++|+.|.+||.
T Consensus       171 d~I~GIG~k~~~~Ll~~Fgs~~~I~~----------As~eeL~~v~g~~-k~A~~I~~~l~  220 (220)
T 2nrt_A          171 DNVPGIGPIRKKKLIEHFGSLENIRS----------ASLEEIARVIGST-EIARRVLDILG  220 (220)
T ss_dssp             TTSTTCCHHHHHHHHHHHCSHHHHHT----------SCHHHHHHHHTCH-HHHHHHHHHC-
T ss_pred             HHCCCCCHHHHHHHHHHCCCHHHHHH----------CCHHHHHHCCCCH-HHHHHHHHHHC
T ss_conf             00379699999999998189999971----------8999998686959-99999999719


No 55 
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1
Probab=97.12  E-value=0.00018  Score=52.07  Aligned_cols=63  Identities=10%  Similarity=0.179  Sum_probs=50.1

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             10354103555565305765404541011010677753100010001342100145689999875223466677630
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL  557 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~AL  557 (731)
                      |+..|+|++++++|+++|     +.++.+|...+..      +|.+++||++++|++|++++.+.-+.   .|+.|.
T Consensus        28 L~~~Gvg~~~i~KL~~aG-----~~Tv~~Ia~~t~~------eL~~i~Gi~e~~A~KIi~aark~~~~---~F~ta~   90 (114)
T 1b22_A           28 LEQCGINANDVKKLEEAG-----FHTVEAVAYAPKK------ELINIKGISEAKADKILAEAAKLVPM---GFTTAT   90 (114)
T ss_dssp             HHHTTCSHHHHHHHHTTC-----CSSGGGBTSSBHH------HHHTTTTCSTTHHHHHHHHHHHHSCC---C-----
T ss_pred             HHHCCCCHHHHHHHHHCC-----CCHHHHHHHCCHH------HHHHCCCCCHHHHHHHHHHHHHHCCC---CCCCHH
T ss_conf             976899999999999969-----7449999848999------99766698899999999999987478---874399


No 56 
>2hvq_A ORF1, hypothetical 37.6 kDa protein in GP24-HOC intergenic region; RNA, ligase, lysine adenylate; HET: APK; 2.40A {Enterobacteria phage T4} PDB: 2hvr_A* 2hvs_A*
Probab=96.82  E-value=0.014  Score=37.33  Aligned_cols=140  Identities=19%  Similarity=0.180  Sum_probs=78.0

Q ss_pred             CCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHH------------H
Q ss_conf             5702159999999999999986124677761199994158189999985998998886598655666------------9
Q gi|254781172|r   96 LSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGED------------V  163 (731)
Q Consensus        96 lSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeD------------V  163 (731)
                      .|++|.+...-+.+-..        .......|+|+-|+||.+.++.+.+|++ ++.+|+ +..-++            .
T Consensus         7 ~~i~n~~~~~~~~~~~~--------~~~~~~~~vvtEKlhGtN~~~~~~~~~i-~~~sR~-~~l~~~~~~~g~~~~~~~~   76 (335)
T 2hvq_A            7 SSLENHYNSKFIEKLYS--------LGLTGGEWVAREXIHGTNFSLIIERDKV-TCAKRT-GPILPAEDFFGYEIILKNY   76 (335)
T ss_dssp             CCCEETTCHHHHHHHHH--------TTCSCSCEEEEECCSSEEEEEEEETTEE-EEEETT-EECCTTCCCTTTHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHH--------HCCCCCCEEEEEEECCEEEEEEEECCEE-EEECCC-CCCCCCCCCCHHHHHHHHH
T ss_conf             65535456767777775--------2647983899996658678999989999-997587-1638987870189999999


Q ss_pred             HHHHHHHC-CCCCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEE
Q ss_conf             99775310-24322335445504899999985202123455643148543342345677775234555530111056641
Q gi|254781172|r  164 SACIRAIP-TIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHG  242 (731)
Q Consensus       164 T~n~~~i~-~iP~~l~~~~~~~ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~  242 (731)
                      +..++.+. .++    ......+.|-||++=+.-                             |+.. . .-++.|++|+
T Consensus        77 ~~~~~~~~~~~~----~~~~~~~~i~GE~~G~~i-----------------------------qk~~-~-~~~~~F~vFD  121 (335)
T 2hvq_A           77 ADSIKAVQDIME----TSAVVSYQVFGEFAGPGI-----------------------------QKNV-D-YGDKDFYVFD  121 (335)
T ss_dssp             HHHHHHHHTTHH----HHTEEEEEEEEEEESBTT-----------------------------BSSC-C-CCSSEEEEEE
T ss_pred             HHHHHHHHHHHH----HCCCCEEEEEEEECCCCC-----------------------------CCCC-C-CCCCCEEEEE
T ss_conf             999999986530----035754999988758986-----------------------------5674-1-3665479999


Q ss_pred             ECCCC---CCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCH
Q ss_conf             02454---3321000036899997599665414887403211
Q gi|254781172|r  243 LGKTS---EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGI  281 (731)
Q Consensus       243 ~~~~~---~~~~~~~~e~l~~L~~~GF~v~~~~~~~~~~~~~  281 (731)
                      +-...   ....-+..+...++...|++.+|...+ ..++++
T Consensus       122 I~~~~~~~~~~~l~~~~~~~~~e~~gl~~vp~l~r-G~~~e~  162 (335)
T 2hvq_A          122 IIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGR-GKFEEL  162 (335)
T ss_dssp             EEEEETTCCEEECCHHHHHHHHHHHTCEESCEEEE-ECHHHH
T ss_pred             EEEECCCCCEEECCHHHHHHHHHHCCCCCCCEEEE-ECHHHH
T ss_conf             99845888425379899999999739974662668-558886


No 57 
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A*
Probab=96.80  E-value=0.00032  Score=50.16  Aligned_cols=84  Identities=12%  Similarity=0.100  Sum_probs=59.5

Q ss_pred             CCCCCCCCEEEEECCCCCC-CHHHHHHHHHHCCCEEEEEE----------ECCEEEEEECCCCC---CHHH--HHHHCCC
Q ss_conf             6882168669997258899-87899999998298499811----------16321799778888---6379--8997499
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKI-QRHKAQEYVTQLGAVVSAIL----------SRKTDIIIVGDNPG---SKLE--KAQQLGV  706 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~-~R~e~~~~ie~~Ggkv~sSV----------SkkT~~LI~ge~~g---SKl~--KA~~LgI  706 (731)
                      ....|.|.+|+++|..... ++++++.+|+..||++.+..          +..+.++|+.++..   .+..  .++..+|
T Consensus       110 ~~~lF~g~~~~i~~~~~~~~~~~~l~~li~~~Gg~v~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~~~~~i  189 (220)
T 3l41_A          110 GPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTI  189 (220)
T ss_dssp             CSCTTTTSEEEEETTSSCGGGHHHHHHHHHHTTCEEEEECSCCHHHHHHHHHCCEEEEECGGGHHHHTTTHHHHTTCTTE
T ss_pred             CCCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCC
T ss_conf             75423782899954888873499999999978988970356643112345788518998276323414899998756898


Q ss_pred             EEECHHHHHHHHHHHCCCCC
Q ss_conf             17379999999988286568
Q gi|254781172|r  707 KIMNEEQFLFLLQQYNTTLR  726 (731)
Q Consensus       707 ~Ii~e~ef~~ll~~~~~~~~  726 (731)
                      ++++.+.|++-|-.+.-+.+
T Consensus       190 ~vv~~eWl~dsIl~q~l~~~  209 (220)
T 3l41_A          190 FLQNYDWLIKTVLRQEIDVN  209 (220)
T ss_dssp             EEEEHHHHHHHHHHTCCCTT
T ss_pred             EEECHHHHHHHHHHCCCCCC
T ss_conf             59879999999986783851


No 58 
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens}
Probab=96.77  E-value=0.0009  Score=46.68  Aligned_cols=79  Identities=11%  Similarity=0.180  Sum_probs=59.0

Q ss_pred             CCCCCCCCCEEEE--ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC-CHHHHHHH-----CCCEEECHHH
Q ss_conf             4688216866999--72588998789999999829849981116321799778888-63798997-----4991737999
Q gi|254781172|r  642 NVSSEIENKKLVF--TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQ-----LGVKIMNEEQ  713 (731)
Q Consensus       642 ~~~~~l~gk~vV~--TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g-SKl~KA~~-----LgI~Ii~e~e  713 (731)
                      .....|.+..+.|  || +..-+++.++++|+.+||++..+++.++++||+.+... .+..|+.+     -|++|++.+.
T Consensus         7 ~~~~~l~~~~~~i~~sG-~~~~~~~~l~~~i~~~GG~~~~~~~~~~ThvI~~~~~~~~~~~k~~~~~~~~~~i~vV~~~W   85 (106)
T 2jw5_A            7 EAEEWLSSLRAHVVRTG-IGRARAELFEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAW   85 (106)
T ss_dssp             CGGGCGGGSCCCBCTTT-CCSSSTTHHHHHHHHTTCCCCSTTCTTCCEEEECSSSCHHHHHHHTTCSSCCSSCEEEEHHH
T ss_pred             CHHHCCCCEEEEEEECC-CCHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEECHHH
T ss_conf             22340188089999579-98367999999999879999817658942999925876346899999864369947987169


Q ss_pred             HHHHHHHH
Q ss_conf             99999882
Q gi|254781172|r  714 FLFLLQQY  721 (731)
Q Consensus       714 f~~ll~~~  721 (731)
                      +.+=+.+.
T Consensus        86 l~dC~~~~   93 (106)
T 2jw5_A           86 LSLCLQER   93 (106)
T ss_dssp             HHHHHHTC
T ss_pred             HHHHHHHC
T ss_conf             99999829


No 59 
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae}
Probab=96.72  E-value=2.9e-05  Score=58.25  Aligned_cols=80  Identities=10%  Similarity=-0.021  Sum_probs=59.4

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHH----------------HHHHHCCC
Q ss_conf             68821686699972588998789999999829849981116321799778888637----------------98997499
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKL----------------EKAQQLGV  706 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl----------------~KA~~LgI  706 (731)
                      ....|.|..|++.|.+....++.++..|+..||++....+..+.+++..+......                ..+..-++
T Consensus       157 ~~~~F~~~~~~~~~~~~~~~~~~l~~~i~~~GG~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (264)
T 1z56_C          157 PLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHEKIKEQIKASDTIPKIA  236 (264)
T ss_dssp             CCC--------------------CHHHHHHHTTSCCCCSSSCSEEECCCSSTTTHHHHSSHHHHTTTTTTTSSSSCCCCC
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             62003784799808988038999999999769887425678649997689753114443211123444344443027888


Q ss_pred             EEECHHHHHHHHHHHC
Q ss_conf             1737999999998828
Q gi|254781172|r  707 KIMNEEQFLFLLQQYN  722 (731)
Q Consensus       707 ~Ii~e~ef~~ll~~~~  722 (731)
                      +|++++.+.+=|.+..
T Consensus       237 ~iV~~~Wi~dci~~~~  252 (264)
T 1z56_C          237 RVVAPEWVDHSINENC  252 (264)
T ss_dssp             EEECTHHHHHHHTTSC
T ss_pred             EECCHHHHHHHHHCCC
T ss_conf             8856799999997398


No 60 
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 1t2u_A 1n5o_X 3k15_A* 3k16_A* 2ing_X 1oqa_A
Probab=96.69  E-value=0.0045  Score=41.27  Aligned_cols=69  Identities=7%  Similarity=0.085  Sum_probs=41.3

Q ss_pred             CCEEEEECCCCCCC---HHHHHHHHHHCCCEEEEEEECCEEEEEECCCCC------CHHHHHHHCCCEEECHHHHHHHHH
Q ss_conf             86699972588998---789999999829849981116321799778888------637989974991737999999998
Q gi|254781172|r  649 NKKLVFTGTLQKIQ---RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG------SKLEKAQQLGVKIMNEEQFLFLLQ  719 (731)
Q Consensus       649 gk~vV~TGtl~~~~---R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~g------SKl~KA~~LgI~Ii~e~ef~~ll~  719 (731)
                      +.+||+||    ++   ++.++++++++||+++.+.+.++++||++...+      -|+..|-..|++|++.+.+.+-++
T Consensus         4 ~~~i~~sg----l~~~e~~~~~~~~~~~gg~~~~~~~~~~THlI~~~~~~~~~~rT~K~l~Al~~g~~IV~~~Wl~~c~~   79 (214)
T 1t15_A            4 RMSMVVSG----LTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIK   79 (214)
T ss_dssp             CCEEEEES----CCHHHHHHHHHHHHHHTCEECSSCCTTCCEEEECBCTTSEECCBHHHHHHHHTTCEEEETHHHHHHHH
T ss_pred             CEEEEECC----CCHHHHHHHHHHHHHCCCEEECCCCCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEHHHHHHHHH
T ss_conf             85999818----99899999999999859999587699972899807876310012999999985997980799999999


Q ss_pred             HH
Q ss_conf             82
Q gi|254781172|r  720 QY  721 (731)
Q Consensus       720 ~~  721 (731)
                      ..
T Consensus        80 ~~   81 (214)
T 1t15_A           80 ER   81 (214)
T ss_dssp             TT
T ss_pred             HC
T ss_conf             58


No 61 
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B
Probab=96.63  E-value=0.011  Score=38.28  Aligned_cols=10  Identities=10%  Similarity=0.105  Sum_probs=5.2

Q ss_pred             CCEEEEEEEE
Q ss_conf             5818999998
Q gi|254781172|r  134 IDGTMITIRY  143 (731)
Q Consensus       134 iDG~sisl~Y  143 (731)
                      +.|++-.+++
T Consensus        16 F~g~~F~lt~   25 (259)
T 1kzy_C           16 FLGYAFLLTM   25 (259)
T ss_dssp             TTTEEEEECC
T ss_pred             HCCCEEEEEC
T ss_conf             3798789853


No 62 
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin ligase, antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A
Probab=96.58  E-value=0.0037  Score=41.95  Aligned_cols=73  Identities=18%  Similarity=0.061  Sum_probs=53.3

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCC---CCHHHHHHHCCCEEECHHHHHHHHHHHC
Q ss_conf             8669997258899878999999982984998111632179977888---8637989974991737999999998828
Q gi|254781172|r  649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP---GSKLEKAQQLGVKIMNEEQFLFLLQQYN  722 (731)
Q Consensus       649 gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~---gSKl~KA~~LgI~Ii~e~ef~~ll~~~~  722 (731)
                      |..||.|| |+.=.+++++++++.+||++.++++.++++||++...   .-|+..|-..|++|++.+.+.+-+....
T Consensus         2 ~lv~~~sg-l~~~e~~~l~~~i~~lgg~~~~~~~~~~THli~~~~~~~rt~K~l~al~~g~~IV~~~Wl~~~~~~~~   77 (210)
T 2nte_A            2 PLVLIGSG-LSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKV   77 (210)
T ss_dssp             CCEEEESS-CCHHHHHHHHHHHHHTTCEEESSCCTTCCEEEESSSSCCCSHHHHHHHHTTCEEEETHHHHHHHHHTS
T ss_pred             CEEEEECC-CCHHHHHHHHHHHHHCCCEEECCCCCCCCEEEEECCCCCCCHHHHHHHHCCCEEEECHHHHHHHHCCC
T ss_conf             88999769-89899999999999829999485589988899807754342999999875993995318999987398


No 63 
>1xdn_A RNA editing ligase MP52; HET: MSE ATP; 1.20A {Trypanosoma brucei} SCOP: d.142.2.4
Probab=96.52  E-value=0.031  Score=34.78  Aligned_cols=172  Identities=16%  Similarity=0.156  Sum_probs=87.1

Q ss_pred             CCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEE---CCEEEEEEECCCCHHHHH------
Q ss_conf             66425702159999999999999986124677761199994158189999985---998998886598655666------
Q gi|254781172|r   92 SIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYE---KGKFVYAALRGDGHSGED------  162 (731)
Q Consensus        92 ~~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~---~G~L~~a~TRGdG~~GeD------  162 (731)
                      -.+.-|++|.+. .    +.+++..    .......|+|+-||+|+-.|+++.   +|..++.+.|- +..+++      
T Consensus         8 F~~Y~~ien~~~-~----~i~~~k~----~~l~~~eWVv~EKIHG~NFsfi~~~d~~~~~v~~akRt-~~l~~~e~Ffg~   77 (277)
T 1xdn_A            8 FSPYIEIDLPSE-S----RIQSLHK----SGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRS-GIMDPNENFFGY   77 (277)
T ss_dssp             CCCCCCCCCCCH-H----HHHHHHH----TTGGGSCEEEEEECCSEEEEEEEEEETTEEEEEEEETT-EECCTTCCCTTG
T ss_pred             HHCCCCCCCCCH-H----HHHHHHH----CCCCCCCEEEEEEECCEEEEEEEEECCCCEEEEEECCC-EECCCCCCCCCH
T ss_conf             323312316108-9----9999985----45567708999744361279999906894399985232-104776665403


Q ss_pred             ------HHHHHHHHCCCCCCCC----CCCCCEEEEEEEEEEEC---HHHHHHHH-HHHHCCCCCCCCHHHHHHHHHHCCC
Q ss_conf             ------9997753102432233----54455048999999852---02123455-6431485433423456777752345
Q gi|254781172|r  163 ------VSACIRAIPTIPRVLS----LNIPEIIEVRGEVYISK---NDFLALND-EMIAVGRKPYANPRNAASGILRRLN  228 (731)
Q Consensus       163 ------VT~n~~~i~~iP~~l~----~~~~~~ieiRGEv~m~~---~~F~~lN~-~~~~~g~~~f~NpRN~aaG~lr~~d  228 (731)
                            -+..++.+   ...|.    ..-...+.|=||+|=-+   .+-...-. .-...|     .||+ .+|..-|++
T Consensus        78 ~~v~~~~~~~~~~l---~~~l~~~~~~~~~~~v~vyGELfGG~Y~hp~v~~~~~~~~~~~G-----~~~~-~~~~~iQk~  148 (277)
T 1xdn_A           78 HILIDEFTAQIRIL---NDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNG-----KKFP-IAGVQIQRE  148 (277)
T ss_dssp             GGGHHHHHHHHHHH---HHHHHHHHTCSCCSEEEEEEEEEEEECCCTTSCCCCCEEECTTS-----CEEE-GGGCCSCCC
T ss_pred             HHHHHHHHHHHHHH---HHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCC-----CCCC-CCCCEECCC
T ss_conf             31578899999999---99999751557763899988852674688644332234434467-----5234-432000135


Q ss_pred             H-HHHHCCCEEEEEEECCCCCC-----CCCCCHHHHHHHHHC-CCCCCCCEEEEECCCCHHH
Q ss_conf             5-55301110566410245433-----210000368999975-9966541488740321134
Q gi|254781172|r  229 P-TDITRYLNFFVHGLGKTSEI-----FAKGQYEMLQKMRCL-GFPVNNGVRQANTFHGIVS  283 (731)
Q Consensus       229 ~-~~~~r~L~f~ay~~~~~~~~-----~~~~~~e~l~~L~~~-GF~v~~~~~~~~~~~~~~~  283 (731)
                      + ....-+++|+||++......     .+-+.-++++.+.+. |++..+... -.+++++++
T Consensus       149 v~~~Y~pd~~FyaFDI~~~~~~~~~~~~~l~~d~~~e~~~~~~gl~ya~~L~-rGtl~E~l~  209 (277)
T 1xdn_A          149 PFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALV-RGTLDECLA  209 (277)
T ss_dssp             SSCCCEEEEEEEEEEEEEESSCCGGGEEECCHHHHHHHHHTSTTCEECCCSE-EESHHHHHT
T ss_pred             CCCCCCCCCCEEEEEEEEECCCCCCEEEEECHHHHHHHHHHHCCCCCCHHHC-CCCHHHHHH
T ss_conf             6545587644489999961377642257603789999887607942112431-246999860


No 64 
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2
Probab=96.45  E-value=0.0094  Score=38.78  Aligned_cols=76  Identities=21%  Similarity=0.232  Sum_probs=53.7

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             01000134210014568999987522346667763010111168999999882998999997897761251177876138
Q gi|254781172|r  522 TKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV  601 (731)
Q Consensus       522 ~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I  601 (731)
                      ++-..|-||..+.-..++..+              +++.|||.++|-.|...+. .+.+..++.      ..+...|..+
T Consensus        54 Ed~~~LyGF~~~~Er~lF~~L--------------i~V~GIGpK~Al~ILs~~~-~~~l~~aI~------~~D~~~L~~v  112 (191)
T 1ixr_A           54 EEGLSLYGFPDEENLALFELL--------------LSVSGVGPKVALALLSALP-PRLLARALL------EGDARLLTSA  112 (191)
T ss_dssp             SSCCCEEEESSHHHHHHHHHH--------------HSSSCCCHHHHHHHHHHSC-HHHHHHHHH------TTCHHHHTTS
T ss_pred             ECCCEEECCCCHHHHHHHHHH--------------HCCCCCCHHHHHHHHHCCC-HHHHHHHHH------CCCHHHHHCC
T ss_conf             078667711828999999998--------------5768837788988872599-999999998------3999995018


Q ss_pred             CCCCHHHHHHHHHHHCC
Q ss_conf             88678999999999669
Q gi|254781172|r  602 PLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       602 ~GiG~~~A~si~~ff~~  618 (731)
                      +|||+|+|+.|+--+.+
T Consensus       113 pGIGkKtAerIilELk~  129 (191)
T 1ixr_A          113 SGVGRRLAERIALELKG  129 (191)
T ss_dssp             TTCCHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             88468899999999986


No 65 
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans}
Probab=96.43  E-value=0.015  Score=37.30  Aligned_cols=26  Identities=15%  Similarity=0.427  Sum_probs=19.2

Q ss_pred             HHHHHHCCCE---E---ECHHHHHHHHHHHCC
Q ss_conf             7989974991---7---379999999988286
Q gi|254781172|r  698 LEKAQQLGVK---I---MNEEQFLFLLQQYNT  723 (731)
Q Consensus       698 l~KA~~LgI~---I---i~e~ef~~ll~~~~~  723 (731)
                      +..|++-|++   |   ++.++|++.|++-..
T Consensus       530 v~~ar~~~~~~~~vln~~~~~~~~~~l~~~r~  561 (578)
T 2w9m_A          530 VMQARKAGLTPAHVVNSLGRAEFLDFVARQRA  561 (578)
T ss_dssp             HHHHHHTTCCGGGBGGGSCHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCHHHHHCCCCHHHHHHHHHHCCC
T ss_conf             99999859999991056899999999984477


No 66 
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination, helicase; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A
Probab=96.40  E-value=0.0096  Score=38.71  Aligned_cols=72  Identities=18%  Similarity=0.393  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             01000134210014568999987522346667763010111168999999882998999997897761251177876138
Q gi|254781172|r  522 TKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV  601 (731)
Q Consensus       522 ~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I  601 (731)
                      ++-..|-||..+.-..++..+              +++.|||.++|-.|...+ +.+.+..++.      +.+...|..+
T Consensus        55 Ed~~~LyGF~~~~Er~lF~~L--------------i~VsGIGPK~AL~ILs~~-~~~~l~~aI~------~~D~~~L~~v  113 (203)
T 1cuk_A           55 EDAQLLYGFNNKQERTLFKEL--------------IKTNGVGPKLALAILSGM-SAQQFVNAVE------REEVGALVKL  113 (203)
T ss_dssp             TTEEEEEEESSHHHHHHHHHH--------------HHSSSCCHHHHHHHHHHS-CHHHHHHHHH------TTCHHHHHTS
T ss_pred             CCCCEEEECCCHHHHHHHHHH--------------HCCCCCCHHHHHHHHHCC-CHHHHHHHHH------HCCHHHHHCC
T ss_conf             677468861946999999998--------------576885756688886127-9899999987------1899886069


Q ss_pred             CCCCHHHHHHHHH
Q ss_conf             8867899999999
Q gi|254781172|r  602 PLVGDIIAQAIVE  614 (731)
Q Consensus       602 ~GiG~~~A~si~~  614 (731)
                      +|||+|+|+.|+-
T Consensus       114 pGIGkKtA~rIil  126 (203)
T 1cuk_A          114 PGIGKKTAERLIV  126 (203)
T ss_dssp             TTCCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHH
T ss_conf             9877999999999


No 67 
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA binding, oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A
Probab=96.39  E-value=0.016  Score=37.10  Aligned_cols=76  Identities=21%  Similarity=0.303  Sum_probs=54.8

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             01000134210014568999987522346667763010111168999999882998999997897761251177876138
Q gi|254781172|r  522 TKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV  601 (731)
Q Consensus       522 ~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I  601 (731)
                      ++-..|-||....-..++..+              +++.|||.++|-.|...+ +.+.+..++.      ..+...|..|
T Consensus        70 Ed~~~LyGF~~~~Er~lF~~L--------------i~VsGIGPK~AL~ILs~~-~~~~l~~aI~------~~D~~~L~~v  128 (212)
T 2ztd_A           70 EDSMTLYGFPDGETRDLFLTL--------------LSVSGVGPRLAMAALAVH-DAPALRQVLA------DGNVAALTRV  128 (212)
T ss_dssp             TTEEEEEEESSHHHHHHHHHH--------------HTSTTCCHHHHHHHHHHS-CHHHHHHHHH------TTCHHHHHTS
T ss_pred             CCCCEEECCCCHHHHHHHHHH--------------HHCCCCCHHHHHHHHHCC-CHHHHHHHHH------HCCHHHHHHC
T ss_conf             688756565998999999999--------------834897746787888549-9999999998------0899998517


Q ss_pred             CCCCHHHHHHHHHHHCC
Q ss_conf             88678999999999669
Q gi|254781172|r  602 PLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       602 ~GiG~~~A~si~~ff~~  618 (731)
                      +|||+|+|+.|+--+.+
T Consensus       129 pGIGkKtAeRIilELkd  145 (212)
T 2ztd_A          129 PGIGKRGAERMVLELRD  145 (212)
T ss_dssp             TTCCHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             78248889999999975


No 68 
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*
Probab=96.22  E-value=0.0053  Score=40.69  Aligned_cols=51  Identities=24%  Similarity=0.317  Sum_probs=44.5

Q ss_pred             CHHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             1011116899999988-299899999789776125117787613888678999999999669
Q gi|254781172|r  558 GIRHVGAEIARSLAKY-YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       558 GI~~vG~~~Ak~La~~-f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~  618 (731)
                      .||+||...|+.|.++ |.++..+..          ++.++|..|+|||+++|+.|.++...
T Consensus       650 ~i~~ig~~~ar~L~~~G~~s~~~i~~----------~~~~~l~~v~g~g~k~a~~i~~~~~~  701 (720)
T 2zj8_A          650 QLPLVGRRRARALYNSGFRSIEDISQ----------ARPEELLKIEGIGVKTVEAIFKFLGK  701 (720)
T ss_dssp             TSTTCCHHHHHHHHTTTCCSHHHHHT----------CCHHHHHTSTTCCHHHHHHHHHHHC-
T ss_pred             CCCCCCHHHHHHHHHCCCCCHHHHHC----------CCHHHHHHCCCCCHHHHHHHHHHHCH
T ss_conf             78999999999999879999999974----------99889852769489999999974450


No 69 
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus}
Probab=96.14  E-value=0.0059  Score=40.36  Aligned_cols=61  Identities=10%  Similarity=0.111  Sum_probs=40.1

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHH--------HHHHHHHHHC-CHHHHHHHHHHHHHHH-CCCHHHHH
Q ss_conf             001000134210014568999987522--------3466677630-1011116899999988-29989999
Q gi|254781172|r  521 TTKIENILGFGDVSVTNLYDSINKRRN--------ISLERFIFSL-GIRHVGAEIARSLAKY-YLSYQNFA  581 (731)
Q Consensus       521 ~~~l~~l~GfgeKsa~nL~~sIe~sK~--------~~L~r~L~AL-GI~~vG~~~Ak~La~~-f~si~~l~  581 (731)
                      .+++.+++|+|++.+++|.+=++.-+-        .+....|.-| .|+|||.++|+.|-+. +.|++.+.
T Consensus        60 ~~~~~~i~gIG~~i~~kI~e~l~tG~~~~le~l~~~~~~~~l~~l~~i~GvGpk~a~~l~~~Gi~si~dL~  130 (360)
T 2ihm_A           60 LSQLHGLPYFGEHSTRVIQELLEHGTCEEVKQVRCSERYQTMKLFTQVFGVGVKTANRWYQEGLRTLDELR  130 (360)
T ss_dssp             GGGGTTCTTCCHHHHHHHHHHHHHSCCHHHHHHHHSHHHHHHHHHHTSTTCCHHHHHHHHHTTCCSHHHHH
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCHHHHH
T ss_conf             99983699987899999999995386899998862215799999975778789999999983988799998


No 70 
>1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ...
Probab=95.93  E-value=0.001  Score=46.25  Aligned_cols=19  Identities=21%  Similarity=0.468  Sum_probs=9.6

Q ss_pred             CCCCCCCCCCCHHHHHHHH
Q ss_conf             1000134210014568999
Q gi|254781172|r  523 KIENILGFGDVSVTNLYDS  541 (731)
Q Consensus       523 ~l~~l~GfgeKsa~nL~~s  541 (731)
                      .|..++|+|++.+.+|+++
T Consensus        16 ~l~~i~gvG~~~~~~l~~~   34 (241)
T 1vq8_Y           16 ELTDISGVGPSKAESLREA   34 (241)
T ss_dssp             -------------------
T ss_pred             HHCCCCCCCHHHHHHHHHC
T ss_conf             3258899899999999976


No 71 
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A*
Probab=95.37  E-value=0.0049  Score=40.97  Aligned_cols=62  Identities=13%  Similarity=0.151  Sum_probs=40.4

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH--------HHHHHC-CHHHHHHHHHHHHHHH-CCCHHHHHH
Q ss_conf             0010001342100145689999875223466--------677630-1011116899999988-299899999
Q gi|254781172|r  521 TTKIENILGFGDVSVTNLYDSINKRRNISLE--------RFIFSL-GIRHVGAEIARSLAKY-YLSYQNFAQ  582 (731)
Q Consensus       521 ~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~--------r~L~AL-GI~~vG~~~Ak~La~~-f~si~~l~~  582 (731)
                      .+++..++|+|.+.+++|.+=++.=+-..|.        ..+.-| .|+|||.++|+.+-+. +.|++.+..
T Consensus        79 ~~~l~~ipGIG~~i~~kI~Eil~tG~l~~le~l~~~~~~~~l~~l~~I~GiGpk~a~~l~~~Gi~tl~dL~~  150 (381)
T 1jms_A           79 MKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQS  150 (381)
T ss_dssp             GGGGTTCSSCCHHHHHHHHHHHHHSSCHHHHHHHHCHHHHHHHHHHTSTTCCHHHHHHHHHTTCCSHHHHHH
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHCCCCCHHHHHHHHHCCCCCHHHHHH
T ss_conf             999836999519999999999984985889998701533688998737787899999999869777999854


No 72 
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ...
Probab=95.34  E-value=0.023  Score=35.76  Aligned_cols=61  Identities=13%  Similarity=0.211  Sum_probs=38.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHH--------HHHHHHHHHHHC-CHHHHHHHHHHHHHHH-CCCHHHHHH
Q ss_conf             010001342100145689999875--------223466677630-1011116899999988-299899999
Q gi|254781172|r  522 TKIENILGFGDVSVTNLYDSINKR--------RNISLERFIFSL-GIRHVGAEIARSLAKY-YLSYQNFAQ  582 (731)
Q Consensus       522 ~~l~~l~GfgeKsa~nL~~sIe~s--------K~~~L~r~L~AL-GI~~vG~~~Ak~La~~-f~si~~l~~  582 (731)
                      +++.+++|+|++.+++|.+=++.=        +..+....|.-| .|+|||.++|+.+-+. +.|++.+..
T Consensus        57 ~~l~~i~GiG~~i~~kI~Eil~tG~~~~le~l~~~~~~~~l~~l~~I~GvGpk~a~~l~~~Gi~ti~dL~~  127 (335)
T 2fmp_A           57 AEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRK  127 (335)
T ss_dssp             HHHHTSTTCCHHHHHHHHHHHHHSSCHHHHHHHHCHHHHHHHHHTTSTTCCHHHHHHHHHTTCCSHHHHHT
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHCCCCCHHHHHHHHHCCCCCHHHHHH
T ss_conf             98836999748999999999982977899998717964678998745687989999999818875999987


No 73 
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A*
Probab=95.30  E-value=0.022  Score=35.89  Aligned_cols=95  Identities=8%  Similarity=0.034  Sum_probs=54.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             34210014568999987522346667763010111168999999882--9989999978977612511778761388867
Q gi|254781172|r  528 LGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYY--LSYQNFAQEINNIIAHNNDDWLSLIRVPLVG  605 (731)
Q Consensus       528 ~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f--~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG  605 (731)
                      +.|...+-.+-..+|+.-. .++...=-..+|||||.+++..|....  +++..+.......   ......+|++|+|||
T Consensus        55 d~fr~~AY~rAa~~i~~l~-~~i~~~~~l~~ipGIG~~i~~kI~Eil~tG~l~~le~l~~~~---~~~~l~~l~~I~GiG  130 (381)
T 1jms_A           55 NEGSCLAFMRASSVLKSLP-FPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDE---RYKSFKLFTSVFGVG  130 (381)
T ss_dssp             CHHHHHHHHHHHHHHHTCS-SCCCSGGGGTTCSSCCHHHHHHHHHHHHHSSCHHHHHHHHCH---HHHHHHHHHTSTTCC
T ss_pred             CCHHHHHHHHHHHHHHHCC-CCCCCHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHCC---CCHHHHHHHHCCCCC
T ss_conf             8087999999999998589-777999998369995199999999999849858899987015---336889987377878


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             89999999996697999999999973
Q gi|254781172|r  606 DIIAQAIVEFYQNPRNICAVEALLKE  631 (731)
Q Consensus       606 ~~~A~si~~ff~~~~n~~~i~~L~~~  631 (731)
                      +++|..+.+-     .+..+++|.+.
T Consensus       131 pk~a~~l~~~-----Gi~tl~dL~~~  151 (381)
T 1jms_A          131 LKTAEKWFRM-----GFRTLSKIQSD  151 (381)
T ss_dssp             HHHHHHHHHT-----TCCSHHHHHHC
T ss_pred             HHHHHHHHHC-----CCCCHHHHHHH
T ss_conf             9999999986-----97779998541


No 74 
>3kyh_C MRNA-capping enzyme subunit alpha; 5' modification, triphosphatase, guanylyltransferase, complex, hydrolase, mRNA processing, nucleus; 3.00A {Saccharomyces cerevisiae}
Probab=95.10  E-value=0.2  Score=28.57  Aligned_cols=167  Identities=13%  Similarity=0.047  Sum_probs=77.5

Q ss_pred             CEEEEEEECCEEEEEEEEE-----CCEEEEEEECCCCHHHHHHHHH-HHHHCCCCCCC----CCCCCCEEEEEEEEEEEC
Q ss_conf             1199994158189999985-----9989988865986556669997-75310243223----354455048999999852
Q gi|254781172|r  126 IFFTLEPKIDGTMITIRYE-----KGKFVYAALRGDGHSGEDVSAC-IRAIPTIPRVL----SLNIPEIIEVRGEVYISK  195 (731)
Q Consensus       126 ~~~~vepKiDG~sisl~Y~-----~G~L~~a~TRGdG~~GeDVT~n-~~~i~~iP~~l----~~~~~~~ieiRGEv~m~~  195 (731)
                      -.|+|+.|.||.=.-|..-     +...+..+.|.+=     ++.. -...+.++...    ....-....+=||+++..
T Consensus        65 ~~Y~V~eK~DG~R~ll~i~~~~~~~~~~~ylidR~~~-----~~~~~~~~fp~~~~~~~~~~~~~~~~~tilDGElV~~~  139 (461)
T 3kyh_C           65 HDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENN-----YYLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQT  139 (461)
T ss_dssp             SCEEEEEEECSEEEEEEEEECTTTCCEEEEEECSSSC-----EEEECCCCCCCCSSCCSSGGGTCCCCSEEEEEEEEEEE
T ss_pred             CCEEEEECCCCEEEEEEEEECCCCCCCEEEEEECCCC-----EEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEE
T ss_conf             9889998827738999997424489716999978984-----48814755764212232333434459959998897040


Q ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCCC--CCCHHHHHHHHHCC--------
Q ss_conf             02123455643148543342345677775234555530111056641024543321--00003689999759--------
Q gi|254781172|r  196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFA--KGQYEMLQKMRCLG--------  265 (731)
Q Consensus       196 ~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~~--~~~~e~l~~L~~~G--------  265 (731)
                      ..                                ..-...+.|++|++....+...  ....+.++.|...=        
T Consensus       140 ~~--------------------------------~~~~~~~~fliFDil~~~g~~l~~~~l~~R~~~l~~~v~~~~~~~~  187 (461)
T 3kyh_C          140 NP--------------------------------MTKLQELRYLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLR  187 (461)
T ss_dssp             CT--------------------------------TTCCEEEEEEEEEEEEETTEECSSSBHHHHHHHHHHTTHHHHHHHH
T ss_pred             CC--------------------------------CCCCCCEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             68--------------------------------7776530589998866688362138756778899999888887754


Q ss_pred             --C----CCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEE
Q ss_conf             --9----66541488740321134556655310011234376377731100011158765686631231145621589
Q gi|254781172|r  266 --F----PVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQAST  337 (731)
Q Consensus       266 --F----~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T  337 (731)
                        +    ...+.......+... ..+..+.+.-..++|++||+|++-.+..+.  .|     -||..-||+.+..-.|
T Consensus       188 ~~~~~~~~~~~f~i~~K~~~~~-~~~~~~~~~~~~~~~~~DGLIftp~~~~Y~--~g-----~~~~~~~KwKp~~~nt  257 (461)
T 3kyh_C          188 AAYPNRCTTFPFKISMKHMDFS-YQLVKVAKSLDKLPHLSDGLIFTPVKAPYT--AG-----GKDSLLLKWKPEQENT  257 (461)
T ss_dssp             HHCSTTCSCCCSEEEECCCEEG-GGHHHHHHHHTTCSSCEEEEEEEESSSBCC--SS-----SEEEEEEECCCTTTCC
T ss_pred             HCCCCCCCCCEEEEEEEECCCH-HHHHHHHHHHHCCCCCCCEEEEECCCCCEE--CC-----CCCCCCEEECCCCCCC
T ss_conf             1164102431379997402428-889999865012466777149950788533--15-----6446506874577783


No 75 
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus}
Probab=94.93  E-value=0.007  Score=39.75  Aligned_cols=83  Identities=11%  Similarity=-0.005  Sum_probs=50.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             34210014568999987522346667763010111168999999882--9989999978977612511778761388867
Q gi|254781172|r  528 LGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYY--LSYQNFAQEINNIIAHNNDDWLSLIRVPLVG  605 (731)
Q Consensus       528 ~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f--~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG  605 (731)
                      +.|..++-++-..+|+... .++...--..+|||||.+++..|...+  +++..+...-.+   .......+|++|+|||
T Consensus        36 ~~fr~~aY~~Aa~~i~~l~-~~i~~~~~~~~i~gIG~~i~~kI~e~l~tG~~~~le~l~~~---~~~~~l~~l~~i~GvG  111 (360)
T 2ihm_A           36 NEGRLLSFSRAASVLKSLP-CPVASLSQLHGLPYFGEHSTRVIQELLEHGTCEEVKQVRCS---ERYQTMKLFTQVFGVG  111 (360)
T ss_dssp             CHHHHHHHHHHHHHHHHCS-SCCCSGGGGTTCTTCCHHHHHHHHHHHHHSCCHHHHHHHHS---HHHHHHHHHHTSTTCC
T ss_pred             CCHHHHHHHHHHHHHHHCC-CCCCCHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHH---HHHHHHHHHHHCCCCC
T ss_conf             9487999999999998599-77899999836999878999999999953868999988622---1579999997577878


Q ss_pred             HHHHHHHHH
Q ss_conf             899999999
Q gi|254781172|r  606 DIIAQAIVE  614 (731)
Q Consensus       606 ~~~A~si~~  614 (731)
                      +++|..+.+
T Consensus       112 pk~a~~l~~  120 (360)
T 2ihm_A          112 VKTANRWYQ  120 (360)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999998


No 76 
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*
Probab=94.89  E-value=0.015  Score=37.13  Aligned_cols=26  Identities=27%  Similarity=0.553  Sum_probs=16.8

Q ss_pred             HHHHCCCCCCHHHHHHHHHH-HCCHHH
Q ss_conf             87613888678999999999-669799
Q gi|254781172|r  596 LSLIRVPLVGDIIAQAIVEF-YQNPRN  621 (731)
Q Consensus       596 e~L~~I~GiG~~~A~si~~f-f~~~~n  621 (731)
                      ..|++|+|||+..|..+.+. |.....
T Consensus       646 ~~L~~i~~ig~~~ar~L~~~G~~s~~~  672 (720)
T 2zj8_A          646 IPLMQLPLVGRRRARALYNSGFRSIED  672 (720)
T ss_dssp             GGGTTSTTCCHHHHHHHHTTTCCSHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCHHH
T ss_conf             562278999999999999879999999


No 77 
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7
Probab=94.43  E-value=0.095  Score=31.03  Aligned_cols=66  Identities=12%  Similarity=0.153  Sum_probs=43.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHH
Q ss_conf             10014568999987522346667763010111168999999882998999997897761251177876138886789999
Q gi|254781172|r  531 GDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ  610 (731)
Q Consensus       531 geKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~  610 (731)
                      .++..++++..|+.+-...|.+      +|+||...|+.|..+=       .     ....-.++++|..|+|||+++.+
T Consensus        23 ~~~~~~~~L~~iNtAs~~eL~~------lpgIg~~~A~~Iv~~R-------~-----~~G~f~sledL~~v~Gi~~k~~e   84 (98)
T 2edu_A           23 LAHGRQKILDLLNEGSARDLRS------LQRIGPKKAQLIVGWR-------E-----LHGPFSQVEDLERVEGITGKQME   84 (98)
T ss_dssp             HHHHHHHHHHHHHHSCHHHHHH------STTCCHHHHHHHHHHH-------H-----HHCCCSSGGGGGGSTTCCHHHHH
T ss_pred             HHHHHHHHCCCCCCCCHHHHHH------CCCCCHHHHHHHHHHH-------H-----HCCCCCCHHHHHCCCCCCHHHHH
T ss_conf             9887635410043789999964------7998999999999999-------9-----85992889998448998999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254781172|r  611 AIVE  614 (731)
Q Consensus       611 si~~  614 (731)
                      .|..
T Consensus        85 ki~k   88 (98)
T 2edu_A           85 SFLK   88 (98)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             9998


No 78 
>1imo_A DNA ligase III; parallel beta sheet; HET: DNA; NMR {Homo sapiens} SCOP: c.15.1.2 PDB: 1in1_A*
Probab=94.31  E-value=0.054  Score=32.91  Aligned_cols=75  Identities=5%  Similarity=0.087  Sum_probs=59.2

Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEE-CCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHH
Q ss_conf             32246882168669997258899878999999982984998111-63217997788886379899749917379999999
Q gi|254781172|r  639 HEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILS-RKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL  717 (731)
Q Consensus       639 ~~~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVS-kkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~l  717 (731)
                      +.+.....|.|.+|.+.|+.+  +|++++.+|.++||.+....+ +.++++|+......|        .+++..+.+.+-
T Consensus         9 ~~k~L~diF~G~~iyi~~~~p--~~~~L~r~i~a~GG~~~~~~~~~~vTHiI~~~~~~~~--------~~~V~p~WI~dc   78 (88)
T 1imo_A            9 QTKVLLDIFTGVRLYLPPSTP--DFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPA--------AQQVSPEWIWAC   78 (88)
T ss_dssp             STTCCCSSSTTCBCCCCTTST--THHHHHHHHHHHTCBCCCTTCCTTCCCEESCCTTCTT--------SCEECHHHHHHH
T ss_pred             CCCCCCHHHCCEEEEECCCCC--CHHHHHHHHHHCCCEEEEECCCCCCEEEEECCCCCCC--------CEEECHHHHHHH
T ss_conf             335361133896999799999--6899999999829988523367881499971788888--------579724999999


Q ss_pred             HHHHCC
Q ss_conf             988286
Q gi|254781172|r  718 LQQYNT  723 (731)
Q Consensus       718 l~~~~~  723 (731)
                      +++..-
T Consensus        79 i~~~kL   84 (88)
T 1imo_A           79 IRKRRL   84 (88)
T ss_dssp             HHHTSC
T ss_pred             HHCCCC
T ss_conf             873786


No 79 
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3
Probab=94.29  E-value=0.1  Score=30.75  Aligned_cols=68  Identities=13%  Similarity=0.197  Sum_probs=30.6

Q ss_pred             CCEEEEECCCCCCC---HHHHHHHHHHCCCEEEEEEECCEEEEEECCCC------CCHHHHHHHCCCEEECHHHHHHHHH
Q ss_conf             86699972588998---78999999982984998111632179977888------8637989974991737999999998
Q gi|254781172|r  649 NKKLVFTGTLQKIQ---RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP------GSKLEKAQQLGVKIMNEEQFLFLLQ  719 (731)
Q Consensus       649 gk~vV~TGtl~~~~---R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~------gSKl~KA~~LgI~Ii~e~ef~~ll~  719 (731)
                      +.+||+||    |+   ++.++++++.+||+++.+++..|++||+....      .-|+..|...|++|++.+.+.+-++
T Consensus         7 ~~~i~~sg----~~~~~~~~l~~~~~~~Gg~~~~~~~~~~THlI~~~~~~~~~~RT~K~l~A~~~g~~IVs~~Wl~~c~~   82 (229)
T 1l0b_A            7 DISMVVSG----LTPKEVMIVQKFAEKYRLALTDVITEETTHVIIKTDAEFVCERTLKYFLGIAGGKWIVSYSWVIKSIQ   82 (229)
T ss_dssp             CCEEEEES----CCHHHHHHHHHHHHHTTCEECSSCCSSCCEEEECBCTTSEECCCHHHHHHHHTTCEEEETHHHHHHHT
T ss_pred             CEEEEECC----CCHHHHHHHHHHHHHCCCEEECCCCCCCEEEEECCCCCCCCCCCHHHHHHHHCCCCEEEHHHHHHHHH
T ss_conf             86999918----99899999999999879999485599970899688876432244999999984996860799999998


Q ss_pred             H
Q ss_conf             8
Q gi|254781172|r  720 Q  720 (731)
Q Consensus       720 ~  720 (731)
                      .
T Consensus        83 ~   83 (229)
T 1l0b_A           83 E   83 (229)
T ss_dssp             T
T ss_pred             H
T ss_conf             3


No 80 
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3
Probab=94.22  E-value=0.013  Score=37.62  Aligned_cols=51  Identities=18%  Similarity=0.293  Sum_probs=39.3

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             103541035555653057654045410110106777531000100013421001456899998
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN  543 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe  543 (731)
                      -+|.|+|+++.++|++.-      .++.+|      ...+.++|.+++|+|++.|++|++.++
T Consensus        27 ~~IpGIG~k~ak~Ll~~F------~si~~i------~~As~eeL~~v~GIg~~~A~~I~~~l~   77 (78)
T 1kft_A           27 ETIEGVGPKRRQMLLKYM------GGLQGL------RNASVEEIAKVPGISQGLAEKIFWSLK   77 (78)
T ss_dssp             GGCTTCSSSHHHHHHHHH------SCHHHH------HHCCHHHHTTSSSTTSHHHHHHHHHHT
T ss_pred             CCCCCCCHHHHHHHHHHH------CCHHHH------HHHCHHHHHCCCCCCHHHHHHHHHHHC
T ss_conf             569993299999999992------994999------883799998079989999999999966


No 81 
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ...
Probab=94.15  E-value=0.0042  Score=41.46  Aligned_cols=60  Identities=13%  Similarity=0.189  Sum_probs=32.1

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHH------HHHH-CCHHHHHHHHHHHHHHH-CCCHHHHHH
Q ss_conf             100013421001456899998752234666------7763-01011116899999988-299899999
Q gi|254781172|r  523 KIENILGFGDVSVTNLYDSINKRRNISLER------FIFS-LGIRHVGAEIARSLAKY-YLSYQNFAQ  582 (731)
Q Consensus       523 ~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r------~L~A-LGI~~vG~~~Ak~La~~-f~si~~l~~  582 (731)
                      ++.+++|+|++.+++|.+=++.=+-..+..      .+.- +.|+|||.++|+.+-+. +.|++.+..
T Consensus        58 ~l~~ipGIGk~i~~kI~Eil~tG~~~~le~l~~~~p~~~~l~~I~GvGpk~a~~l~~~Gi~si~dL~~  125 (335)
T 2bcq_A           58 EACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRS  125 (335)
T ss_dssp             HHHTSTTCCHHHHHHHHHHHHSSSCGGGGGCCTTHHHHHHHHTSTTCCHHHHHHHHHTTCCSHHHHHH
T ss_pred             HHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHH
T ss_conf             97179997589999999999739686899886334015665118876889999999819256999998


No 82 
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation, base twisting, hydrolase; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.96.1.2
Probab=94.14  E-value=0.19  Score=28.69  Aligned_cols=24  Identities=17%  Similarity=0.339  Sum_probs=21.1

Q ss_pred             CCCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             117787613888678999999999
Q gi|254781172|r  592 NDDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       592 ~~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ..+.++|++++|||+++|..+..|
T Consensus       111 p~~~~eL~~LPGVG~ktA~~vl~~  134 (221)
T 1kea_A          111 PRNRKAILDLPGVGKYTCAAVMCL  134 (221)
T ss_dssp             CSCHHHHHTSTTCCHHHHHHHHHH
T ss_pred             CHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             012888744898765679999998


No 83 
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A*
Probab=94.05  E-value=0.024  Score=35.61  Aligned_cols=82  Identities=21%  Similarity=0.328  Sum_probs=44.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHH---HHHHHHHHHHHHHHH
Q ss_conf             31035410355556530576540454101101067775310001000134210014568999---987522346667763
Q gi|254781172|r  480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS---INKRRNISLERFIFS  556 (731)
Q Consensus       480 aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~s---Ie~sK~~~L~r~L~A  556 (731)
                      -+.++|+|++.++.|+++      |..--+. .|....     .=+.+++.|++.|..|...   ++.-.+.++..+   
T Consensus       477 l~~l~gfg~ksa~nll~s------Ie~sk~~-~l~r~L-----~aLGIp~vG~~~ak~L~~~f~~l~~l~~as~e~L---  541 (667)
T 1dgs_A          477 LLGLERMGEKSAQNLLRQ------IEESKHR-GLERLL-----YALGLPGVGEVLARNLARRFGTMDRLLEASLEEL---  541 (667)
T ss_dssp             HHTTSSCCSTTHHHHHHH------HHHGGGC-CHHHHH-----HHTTCSSCCHHHHHHHHHTTSBHHHHTTCCHHHH---
T ss_pred             HHCCCCCCCHHHHHHHHH------HHHHCCC-CHHHHH-----HHCCCCCCCHHHHHHHHHHCCCHHHHHCCCHHHH---
T ss_conf             635776340237899999------8764146-267777-----7506787448999999887599999860799998---


Q ss_pred             CCHHHHHHHHHHHHHHHCCC
Q ss_conf             01011116899999988299
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLS  576 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~s  576 (731)
                      +.|++||+.+|+.|...|.+
T Consensus       542 ~~I~GIG~~~A~si~~~f~~  561 (667)
T 1dgs_A          542 IEVEEVGELTARAILETLKD  561 (667)
T ss_dssp             HTSTTCCHHHHHHHHHHHHC
T ss_pred             HCCCCCCHHHHHHHHHHHCC
T ss_conf             57799489999999999759


No 84 
>2ziu_A MUS81 protein; helix-hairpin-helix, alternative splicing, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; 2.70A {Danio rerio} PDB: 2ziv_A 2ziw_A
Probab=93.91  E-value=0.099  Score=30.89  Aligned_cols=60  Identities=17%  Similarity=0.253  Sum_probs=43.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHH-HHHCCC------CCCHHHHHHHHHHHCC
Q ss_conf             0101111689999998829989999978977612511778-761388------8678999999999669
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWL-SLIRVP------LVGDIIAQAIVEFYQN  618 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e-~L~~I~------GiG~~~A~si~~ff~~  618 (731)
                      +.|||||...|..|.++|+++..+..+......  ....+ -|..+.      -+|++.++.|..||..
T Consensus       240 ~qIpGIs~~~A~~I~~~y~T~~~L~~a~~~~~~--~~e~~~ll~~~~~~~~~RkiG~~~S~~Iy~~~~~  306 (311)
T 2ziu_A          240 MQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSS--ETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCT  306 (311)
T ss_dssp             TTBTTCCHHHHHHHHHHCSSHHHHHHHHHHCSS--HHHHTTTTTTCEETTTTEECHHHHHHHHHHHHHC
T ss_pred             HHCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCC--HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             827999999999999976999999999985698--8889998764435655577389999999999677


No 85 
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ...
Probab=93.89  E-value=0.029  Score=35.02  Aligned_cols=25  Identities=28%  Similarity=0.474  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHH
Q ss_conf             103541035555653057654045410110
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADI  510 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DL  510 (731)
                      ++|-|+|++++.+|++.|     |+++.||
T Consensus        99 ~~I~GvGpk~a~~l~~~G-----i~si~dL  123 (335)
T 2bcq_A           99 SNIWGAGTKTAQMWYQQG-----FRSLEDI  123 (335)
T ss_dssp             HTSTTCCHHHHHHHHHTT-----CCSHHHH
T ss_pred             HCCCCCCHHHHHHHHHCC-----CCCHHHH
T ss_conf             118876889999999819-----2569999


No 86 
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans}
Probab=93.80  E-value=0.025  Score=35.54  Aligned_cols=44  Identities=14%  Similarity=0.145  Sum_probs=18.0

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             946889999999999999999999984331779820878999999999999
Q gi|254781172|r    8 PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAI   58 (731)
Q Consensus         8 ~~~~~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~l   58 (731)
                      |....|.+++-+..+++++.++       ..|...--=..|..-.+.|+.|
T Consensus         4 ~p~~~~n~~i~~~l~~~A~lle-------~~gen~fr~rAY~rAa~~l~~l   47 (578)
T 2w9m_A            4 PPDAPSRHRLVHALERTADLLD-------ILGGEDFKSRAYRSAARSLEEL   47 (578)
T ss_dssp             ----CCHHHHHHHHHHHHHHHH-------HC---CCSHHHHHHHHHHHHSC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHH-------HCCCCCHHHHHHHHHHHHHHHC
T ss_conf             9899999999999999999999-------7499817899999999999968


No 87 
>3bz1_U Photosystem II 12 kDa extrinsic protein; electron transport photosystem, membrane complex, transmembrane alpha-helix; HET: CLA PHO HEM PL9 BCR DGD LHG SQD LMG LMT; 2.90A {Thermosynechococcus elongatus} PDB: 2axt_U* 3bz2_U* 3kzi_U* 3a0b_U* 3a0h_U*
Probab=93.52  E-value=0.087  Score=31.31  Aligned_cols=44  Identities=14%  Similarity=0.150  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             011116899999988299899999789776125117787613888678999999999669
Q gi|254781172|r  559 IRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       559 I~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff~~  618 (731)
                      |||||...|+.|.++-+                -.+.++|.+|+|||++..+.|..|++.
T Consensus        38 lpGig~~~A~~Iv~~gp----------------f~s~~dL~~V~Gig~~~~e~ik~yl~~   81 (104)
T 3bz1_U           38 YRGLYPTLAKLIVKNAP----------------YESVEDVLNIPGLTERQKQILRENLEH   81 (104)
T ss_dssp             STTTTHHHHHHHHHSCC----------------CSSGGGGGGCTTCCHHHHHHHHHHGGG
T ss_pred             CCCCCHHHHHHHHHCCC----------------CCCHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             89979999999997499----------------798999963899899999999986545


No 88 
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus}
Probab=93.32  E-value=0.11  Score=30.52  Aligned_cols=24  Identities=13%  Similarity=0.147  Sum_probs=20.8

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             778761388867899999999966
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEFYQ  617 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~ff~  617 (731)
                      +.++|.+|+|||+++-+.+..|+.
T Consensus        87 svedl~~v~Gig~~~~e~l~~~l~  110 (134)
T 1s5l_U           87 SVEDVLNIPGLTERQKQILRENLE  110 (134)
T ss_dssp             SGGGGGGCTTCCHHHHHHHHHHHT
T ss_pred             CHHHHHCCCCCCHHHHHHHHHHHC
T ss_conf             799996177579999999998653


No 89 
>2owo_A DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12}
Probab=93.27  E-value=0.047  Score=33.35  Aligned_cols=86  Identities=15%  Similarity=0.224  Sum_probs=50.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH---HHHHHHHHHHHHHH
Q ss_conf             310354103555565305765404541011010677753100010001342100145689999---87522346667763
Q gi|254781172|r  480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI---NKRRNISLERFIFS  556 (731)
Q Consensus       480 aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sI---e~sK~~~L~r~L~A  556 (731)
                      -+.++|+|++..++|+++      |..--.. .|....     .-+.+++.|++.|..|.+..   +.-++.++..+   
T Consensus       482 l~~l~gfg~Ksa~nL~~s------Ie~sk~~-~l~r~L-----~ALGI~~vG~~~ak~La~~f~~l~~l~~as~eeL---  546 (671)
T 2owo_A          482 LTGLERMGPKSAQNVVNA------LEKAKET-TFARFL-----YALGIREVGEATAAGLAAYFGTLEALEAASIEEL---  546 (671)
T ss_dssp             HHTSTTCCHHHHHHHHHH------HHHHTBC-CHHHHH-----HHTTCTTCCHHHHHHHHHHHCSHHHHHTCCHHHH---
T ss_pred             HHHHHCCCHHHHHHHHHH------HHHHCCC-CHHHHH-----HHCCCCCCCHHHHHHHHHHCCCHHHHHCCCHHHH---
T ss_conf             766541142678999999------9875069-899999-----8643777547789999886299999873899999---


Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             010111168999999882998999
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNF  580 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l  580 (731)
                      ..|++||+.+|..|...|.+..+.
T Consensus       547 ~~I~gIG~~~A~si~~ff~~~~n~  570 (671)
T 2owo_A          547 QKVPDVGIVVASHVHNFFAEESNR  570 (671)
T ss_dssp             TTSTTCCHHHHHHHHHHHTCHHHH
T ss_pred             HCCCCCCHHHHHHHHHHHCCHHHH
T ss_conf             644981699999999997498999


No 90 
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1
Probab=92.99  E-value=0.37  Score=26.48  Aligned_cols=24  Identities=25%  Similarity=0.339  Sum_probs=19.0

Q ss_pred             CCCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             117787613888678999999999
Q gi|254781172|r  592 NDDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       592 ~~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ..+.++|.+++|||+++|..+..|
T Consensus       105 p~~~~~L~~LpGVG~kTA~~il~~  128 (211)
T 2abk_A          105 PEDRAALEALPGVGRKTANVVLNT  128 (211)
T ss_dssp             CSCHHHHHHSTTCCHHHHHHHHHH
T ss_pred             CCCHHHHHHCCCCCHHHHHHHHHH
T ss_conf             832999871788736999999998


No 91 
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A*
Probab=92.79  E-value=0.49  Score=25.53  Aligned_cols=82  Identities=9%  Similarity=0.134  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHC-CCEEECHHHHHHHHH
Q ss_conf             2468821686699972588998789999999829849981116321799778888637989974-991737999999998
Q gi|254781172|r  641 KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQL-GVKIMNEEQFLFLLQ  719 (731)
Q Consensus       641 ~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~L-gI~Ii~e~ef~~ll~  719 (731)
                      ...+..|.|+.||++..++...|.+++++|+.+||+++.+++++|++||++. .|.|..+|.+- +|+|++.+.+.+-+.
T Consensus         5 ~~~s~iF~g~~f~v~sg~~~~~r~~l~~~I~~~GG~~~~~l~~~t~~vi~~~-~~~k~~~~~~~~~i~iV~~~Wl~dci~   83 (263)
T 3ii6_X            5 SKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGS-ENIRVKNIILSNKHDVVKPAWLLECFK   83 (263)
T ss_dssp             -CCCCTTTTCEEEECCCC--CCHHHHHHHHHHTTCEECSSCCTTEEEEECSS-CCHHHHHHHHSCSCCEECHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCEEEEEEC-CCHHHHHHHHCCCCCEEEEHHHHHHHH
T ss_conf             7566246996899968988417999999999779999702699958999807-980899999829998994089999987


Q ss_pred             HHCC
Q ss_conf             8286
Q gi|254781172|r  720 QYNT  723 (731)
Q Consensus       720 ~~~~  723 (731)
                      +...
T Consensus        84 ~~~~   87 (263)
T 3ii6_X           84 TKSF   87 (263)
T ss_dssp             HTSC
T ss_pred             CCCC
T ss_conf             5882


No 92 
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A*
Probab=92.01  E-value=0.59  Score=24.87  Aligned_cols=23  Identities=22%  Similarity=0.128  Sum_probs=20.1

Q ss_pred             CCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             17787613888678999999999
Q gi|254781172|r  593 DDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       593 ~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ...++|..++|||+++|+.+.-|
T Consensus       118 ~~~~~L~~lpGIG~kTA~~il~~  140 (218)
T 1pu6_A          118 VTREWLLDQKGIGKESADAILCY  140 (218)
T ss_dssp             CCHHHHHTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             79999984899669999999999


No 93 
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ...
Probab=91.63  E-value=0.16  Score=29.34  Aligned_cols=82  Identities=15%  Similarity=0.112  Sum_probs=47.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCH
Q ss_conf             4210014568999987522346667763010111168999999882--99899999789776125117787613888678
Q gi|254781172|r  529 GFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYY--LSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD  606 (731)
Q Consensus       529 GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~~vG~~~Ak~La~~f--~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~  606 (731)
                      -|+.++-.+-..+|+..- .++...--..+|||||++.++.|....  +++..+...-..   ......+.|++|+|+||
T Consensus        33 ~fk~~AY~rAa~~i~~l~-~~i~~~~~l~~i~GiG~~i~~kI~Eil~tG~~~~le~l~~~---~~~~~l~~l~~I~GvGp  108 (335)
T 2fmp_A           33 IHKYNAYRKAASVIAKYP-HKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQD---DTSSSINFLTRVSGIGP  108 (335)
T ss_dssp             HHHHHHHHHHHHHHHHCS-SCCCCHHHHHTSTTCCHHHHHHHHHHHHHSSCHHHHHHHHC---HHHHHHHHHTTSTTCCH
T ss_pred             CHHHHHHHHHHHHHHHCC-CCCCCHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCC---CCHHHHHHHHHCCCCCH
T ss_conf             278999999999998599-56678898836999748999999999982977899998717---96467899874568798


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254781172|r  607 IIAQAIVE  614 (731)
Q Consensus       607 ~~A~si~~  614 (731)
                      ++|..+.+
T Consensus       109 k~a~~l~~  116 (335)
T 2fmp_A          109 SAARKFVD  116 (335)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
T ss_conf             99999998


No 94 
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A*
Probab=91.61  E-value=0.53  Score=25.25  Aligned_cols=23  Identities=30%  Similarity=0.439  Sum_probs=18.2

Q ss_pred             CCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             17787613888678999999999
Q gi|254781172|r  593 DDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       593 ~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      .+.++|.+++|||+++|.++..|
T Consensus       110 ~~~~~L~~LpGVG~kTA~~il~~  132 (226)
T 1orn_A          110 RDRDELMKLPGVGRKTANVVVSV  132 (226)
T ss_dssp             SCHHHHTTSTTCCHHHHHHHHHH
T ss_pred             CCHHHHHHCCCCCHHHHHHHHHH
T ss_conf             78999974877536799999999


No 95 
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosphoserine binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A*
Probab=91.35  E-value=0.73  Score=24.18  Aligned_cols=76  Identities=17%  Similarity=0.233  Sum_probs=56.2

Q ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEEC---------CEEEEEECCCCCCHHHHHHHCCCEEECHHH
Q ss_conf             68821686699972588998789999999829849981116---------321799778888637989974991737999
Q gi|254781172|r  643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR---------KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ  713 (731)
Q Consensus       643 ~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSk---------kT~~LI~ge~~gSKl~KA~~LgI~Ii~e~e  713 (731)
                      -.+.|.|++|++...     -..+..+++++|+.+....+.         .+++++..+..-+...-+...|+..++-++
T Consensus       222 r~~lf~g~t~~~~~~-----~~~~~~l~~~lg~~v~~~~~~~~~~k~~~~~~~~vv~~~~~~~~~~~~~~~g~~~~t~~~  296 (325)
T 3huf_A          222 CINSLEGFSCAMLNT-----SSESHHLLELLGLRISTFMSLGDIDKELISKTDFVVLNNAVYDSEKISFPEGIFCLTIEQ  296 (325)
T ss_dssp             HTTTTTTCEEEEETC-----CHHHHHHHHHTTCEEEEEC------CCSSSSCSEEEEC-------------CCCEEEHHH
T ss_pred             HHHHHCCCEEEEECC-----HHHHHHHHHHHCCCEECCCCHHHHHHHHCCCCCEEEEEEECCCHHHHHHHCCCEEECHHH
T ss_conf             888736956999466-----788899999716432123324367786445787699996327178776441567614999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999988286
Q gi|254781172|r  714 FLFLLQQYNT  723 (731)
Q Consensus       714 f~~ll~~~~~  723 (731)
                      |.+.|-+-+.
T Consensus       297 ~~~~il~~~~  306 (325)
T 3huf_A          297 LWKIIIERNS  306 (325)
T ss_dssp             HHHHHHSSSS
T ss_pred             HHHHHHHHHH
T ss_conf             9999997308


No 96 
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5
Probab=91.15  E-value=0.092  Score=31.12  Aligned_cols=52  Identities=13%  Similarity=0.235  Sum_probs=39.4

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             0354103555565305765404541011010677753100010001342100145689999875
Q gi|254781172|r  482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR  545 (731)
Q Consensus       482 dI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~s  545 (731)
                      .|.|+|+.+...|++.      -.++.+|+.      .+.++|..++|+|++.|++|.+.++..
T Consensus        18 ~IpgIG~~~a~~L~~~------F~s~~~i~~------As~eeL~~v~GIG~~~a~~i~~~~~~~   69 (75)
T 1x2i_A           18 GLPHVSATLARRLLKH------FGSVERVFT------ASVAELMKVEGIGEKIAKEIRRVITAP   69 (75)
T ss_dssp             TSTTCCHHHHHHHHHH------HCSHHHHHH------CCHHHHTTSTTCCHHHHHHHHHHHHSC
T ss_pred             CCCCCCHHHHHHHHHH------HCCHHHHHH------HHHHHHHHCCCCCHHHHHHHHHHHCCH
T ss_conf             8999429999999999------688898999------789999855897999999999998576


No 97 
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5
Probab=91.14  E-value=0.067  Score=32.20  Aligned_cols=61  Identities=11%  Similarity=0.299  Sum_probs=44.3

Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             66553321301231035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  468 QLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       468 ~~~~i~hF~SK~aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      ...++..+.+    .|.|+|+.....|++.      -.++.+|..      .+.++|.+++|+|++.|++|++.+..
T Consensus        13 ~~~~~~~~L~----~I~gIG~~~a~~L~~~------Fgsl~~i~~------As~eeL~~i~GiG~~~A~~I~~~f~~   73 (89)
T 1z00_A           13 FVSRVTECLT----TVKSVNKTDSQTLLTT------FGSLEQLIA------ASREDLALCPGLGPQKARRLFDVLHE   73 (89)
T ss_dssp             HHHHHHHHHT----TSSSCCHHHHHHHHHH------TCBHHHHHH------CCHHHHHTSTTCCHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHC----CCCCCCHHHHHHHHHH------HCCHHHHHH------HHHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             4999999875----8997599999999999------488899999------87877726899699999999999808


No 98 
>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A
Probab=90.86  E-value=0.8  Score=23.84  Aligned_cols=24  Identities=25%  Similarity=0.380  Sum_probs=20.2

Q ss_pred             CCCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             117787613888678999999999
Q gi|254781172|r  592 NDDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       592 ~~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ..+.++|++++|||+++|..+..|
T Consensus       105 p~~~~~L~~LpGVG~kTA~~il~~  128 (225)
T 1kg2_A          105 PETFEEVAALPGVGRSTAGAILSL  128 (225)
T ss_dssp             CCSHHHHHTSTTCCHHHHHHHHHH
T ss_pred             CCHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             742999975898747899999998


No 99 
>2csb_A Topoisomerase V, TOP61; topoisomerase IB, helix-turn-helix, helix- hairpin-helix, HHH motif, three helix bundle; 2.30A {Methanopyrus kandleri} SCOP: a.60.2.4 a.60.2.4 a.60.2.4 a.60.2.4 a.267.1.1 PDB: 2csd_A
Probab=90.67  E-value=0.49  Score=25.51  Aligned_cols=51  Identities=22%  Similarity=0.222  Sum_probs=38.2

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             111168999999882998999997897761251177876138886789999999996
Q gi|254781172|r  560 RHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY  616 (731)
Q Consensus       560 ~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff  616 (731)
                      .++|.++|..|.++|++-+...+..      ....++.|..++|+|+.+-.|++-.+
T Consensus       417 egvgrktaerllrafgnpervkqla------refeieklasvegvgervlrslvpgy  467 (519)
T 2csb_A          417 EGVGRKTAERLLRAFGNPERVKQLA------REFEIEKLASVEGVGERVLRSLVPGY  467 (519)
T ss_dssp             TTCCHHHHHHHHHHHSSHHHHHHHH------HTTCHHHHHTSTTCSHHHHHHHSTTH
T ss_pred             CCCCHHHHHHHHHHHCCHHHHHHHH------HHHHHHHHHHCCCHHHHHHHHHCCCH
T ss_conf             0645657999999709989999999------88758887500332899999865343


No 100
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5
Probab=90.62  E-value=0.082  Score=31.52  Aligned_cols=53  Identities=11%  Similarity=0.268  Sum_probs=40.8

Q ss_pred             CCC-HHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             310-35410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  480 AFN-IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       480 ald-I~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      +|. |.|+|+.....|.+.-      .++.+|.      ..+.++|.+++|+|++.|++|++.+++
T Consensus        33 ~L~~I~gIGk~~A~~L~~~F------~Si~~l~------~As~eeL~~i~GIG~~~A~~I~~~f~~   86 (91)
T 2a1j_B           33 CLTTVKSVNKTDSQTLLTTF------GSLEQLI------AASREDLALCPGLGPQKARRLFDVLHE   86 (91)
T ss_dssp             HHTTSTTCCHHHHHHHHHHH------SSHHHHH------SCCHHHHHTSSSCCSHHHHHHHHHHHS
T ss_pred             HHCCCCCCCHHHHHHHHHHH------CCCHHHH------HHHHHHHCCCCCCCHHHHHHHHHHHHC
T ss_conf             86468885999999999995------8829899------989997557799699999999999848


No 101
>1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A
Probab=89.95  E-value=0.6  Score=24.85  Aligned_cols=97  Identities=14%  Similarity=0.207  Sum_probs=54.6

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCC----CCCCCHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             23103541035555653057654045410110106777531000100013----4210014568999987522346667-
Q gi|254781172|r  479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENIL----GFGDVSVTNLYDSINKRRNISLERF-  553 (731)
Q Consensus       479 ~aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~----GfgeKsa~nL~~sIe~sK~~~L~r~-  553 (731)
                      ..+..++.++.....|...|..-+.++.=.|++.+-....     +..++    .+-....+.++....    .+...| 
T Consensus       145 ~~~~Ap~ea~aq~a~l~~~g~~d~i~s~D~Dll~~g~~~v-----i~~~~~~~~~~~~~~~~~~~~~~~----~~~~q~i  215 (326)
T 1a76_A          145 PYVEAPSEGEAQASYMAKKGDVWAVVSQDYDALLYGAPRV-----VRNLTTTKEMPELIELNEVLEDLR----ISLDDLI  215 (326)
T ss_dssp             CEEECSSCHHHHHHHHHHTTSSSEEECSSSGGGGGTCSEE-----EESSSSCSSCCEEEEHHHHHHHHT----CCHHHHH
T ss_pred             CEEECCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEE-----EEECCCCCCCCCCCHHHHHHHHCC----CCHHHHH
T ss_conf             8366671899999999965981454159855213588869-----993576656543101466554302----5879999


Q ss_pred             ----HHH-----CCHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             ----763-----0101111689999998829989999978
Q gi|254781172|r  554 ----IFS-----LGIRHVGAEIARSLAKYYLSYQNFAQEI  584 (731)
Q Consensus       554 ----L~A-----LGI~~vG~~~Ak~La~~f~si~~l~~~~  584 (731)
                          |.+     =|||+||.++|-.|.+.|++++.+.+..
T Consensus       216 d~~il~g~d~n~~gi~giG~k~A~~li~~~~s~e~i~~~~  255 (326)
T 1a76_A          216 DIAIFMGTDYNPGGVKGIGFKRAYELVRSGVAKDVLKKEV  255 (326)
T ss_dssp             HHHHHHCCTTSTTTTTTCCHHHHHHHHHHTCHHHHHHHHS
T ss_pred             HHHHEECCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHH
T ss_conf             8780279645788999424999999999849999998865


No 102
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2
Probab=89.64  E-value=0.54  Score=25.17  Aligned_cols=28  Identities=21%  Similarity=0.273  Sum_probs=22.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             0101111689999998829989999978
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEI  584 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~  584 (731)
                      =||||||.++|-.|.+.|++++++...+
T Consensus       235 ~gv~giG~ktA~kli~~~~sle~i~~~~  262 (379)
T 1ul1_X          235 ESIRGIGPKRAVDLIQKHKSIEEIVRRL  262 (379)
T ss_dssp             CCCTTCCHHHHHHHHHHSSSHHHHHTTC
T ss_pred             CCCCCCCHHHHHHHHHHCCCHHHHHHHH
T ss_conf             7678866899999999819999999999


No 103
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=89.61  E-value=0.92  Score=23.39  Aligned_cols=74  Identities=14%  Similarity=0.066  Sum_probs=51.2

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEE-----------CCEEEEEECCCCCCHHHHHHHCCCEEEC
Q ss_conf             46882168669997258899878999999982984998111-----------6321799778888637989974991737
Q gi|254781172|r  642 NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILS-----------RKTDIIIVGDNPGSKLEKAQQLGVKIMN  710 (731)
Q Consensus       642 ~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVS-----------kkT~~LI~ge~~gSKl~KA~~LgI~Ii~  710 (731)
                      .....|+|++|.+.|-   +++++++.+|.+.||+|....+           ...++.|+.-.+-+|    +..+-.++.
T Consensus         8 ~~~~LF~g~~F~i~~e---~p~~~l~~lI~s~GG~v~~~~~~~~~~~~~~~~~~iTh~I~~~~~~~k----~~~~~~~V~   80 (100)
T 2ep8_A            8 KHKKLFEGLKFFLNRE---VPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRITHQIVDRPGQQT----SVIGRCYVQ   80 (100)
T ss_dssp             CSCCTTSSCEEECCSS---SCHHHHHHHHHHTTCEEECCTTTSSCCCSCTTCTTCCEEECSCTTTSC----CBTTBEEEC
T ss_pred             CCCCCCCCCEEEEECC---CCHHHHHHHHHHCCCEEEECCCCCCCCCEECCCCCCCEEEEECCCHHH----HCCCCCEEC
T ss_conf             4121679978999587---998999999998698787513457886302247765468870755543----115786863


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999998828
Q gi|254781172|r  711 EEQFLFLLQQYN  722 (731)
Q Consensus       711 e~ef~~ll~~~~  722 (731)
                      .+...+=|++..
T Consensus        81 PqWI~Dci~~~~   92 (100)
T 2ep8_A           81 PQWVFDSVNARL   92 (100)
T ss_dssp             THHHHHHHHHTS
T ss_pred             CHHHHHHHHCCC
T ss_conf             049999876076


No 104
>2zix_A Crossover junction endonuclease MUS81; helix-hairpin-helix, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium, metal-binding, nucleus; 3.50A {Homo sapiens}
Probab=89.13  E-value=0.071  Score=31.98  Aligned_cols=61  Identities=15%  Similarity=0.257  Sum_probs=43.6

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCC------CCCHHHHHHHHHHHCC
Q ss_conf             0101111689999998829989999978977612511778761388------8678999999999669
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP------LVGDIIAQAIVEFYQN  618 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~------GiG~~~A~si~~ff~~  618 (731)
                      +.|||||...|+.|.++|+|+..+..+.+..... .....-|.++.      -||+..++.|.++|..
T Consensus       236 ~qIpGIs~~~A~~I~~~ypT~~~L~~ay~~~~~~-~e~~~ll~~~~~~~~~RkiG~~~Sk~I~~~~~~  302 (307)
T 2zix_A          236 MQVRGVSGEKAAALVDRYSTPASLLAAYDACATP-KEQETLLSTIKCGRLQRNLGPALSRTLSQLYCS  302 (307)
T ss_dssp             TCSTTCCSTTTTTSSSSSCSHHHHHHHHHCCSSG-GGTTTTTSCCCCTTTTCCCCHHHHHHHHHHHTC
T ss_pred             HCCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCH-HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             6278999999999999779999999999858988-899999874335656674299999999999715


No 105
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus HB8} SCOP: a.60.2.7
Probab=88.62  E-value=0.23  Score=28.02  Aligned_cols=23  Identities=13%  Similarity=0.228  Sum_probs=18.5

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             77876138886789999999996
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEFY  616 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~ff  616 (731)
                      +.++|.+|+|||+.+.+.|..|+
T Consensus        51 s~~dL~~v~gi~~~~~~~i~~~l   73 (75)
T 2duy_A           51 RVEDLLKVKGIGPATLERLRPYL   73 (75)
T ss_dssp             SGGGGGGSTTCCHHHHHHHGGGE
T ss_pred             CHHHHHHCCCCCHHHHHHHHHHC
T ss_conf             89999757898999999999772


No 106
>1ckm_A MRNA capping enzyme; nucleotidyltransferase; HET: GTP; 2.50A {Paramecium bursaria chlorella virus 1} SCOP: b.40.4.6 d.142.2.3 PDB: 1ckn_A* 1cko_A* 1ckn_B*
Probab=88.52  E-value=1.2  Score=22.56  Aligned_cols=152  Identities=16%  Similarity=0.176  Sum_probs=72.6

Q ss_pred             EEEEEEECCEEEEEEEE--ECC-EEEEEEECCCCHHHHHHHHHHHHH--CCCCCCCCCCCCCEEEEEEEEEEECHHHHHH
Q ss_conf             19999415818999998--599-899888659865566699977531--0243223354455048999999852021234
Q gi|254781172|r  127 FFTLEPKIDGTMITIRY--EKG-KFVYAALRGDGHSGEDVSACIRAI--PTIPRVLSLNIPEIIEVRGEVYISKNDFLAL  201 (731)
Q Consensus       127 ~~~vepKiDG~sisl~Y--~~G-~L~~a~TRGdG~~GeDVT~n~~~i--~~iP~~l~~~~~~~ieiRGEv~m~~~~F~~l  201 (731)
                      .|+|++|.||+=.-|.-  .+| ..+..++|-.-.         ..+  ...|..+   ..+.+ +=||++.....    
T Consensus        76 ~Y~VteK~DG~R~lL~i~~~~g~~~~ylIdR~~~~---------~~~~~~~~~~~~---~~~TL-lDGElV~~~~~----  138 (330)
T 1ckm_A           76 KYVVSEKTDGIRFMMFFTRVFGFKVCTIIDRAMTV---------YLLPFKNIPRVL---FQGSI-FDGELCVDIVE----  138 (330)
T ss_dssp             CEEEEEEECSEEEEEEEEEETTEEEEEEECTTCCE---------EECCCSCCCTTG---GGCEE-EEEEEEEETTT----
T ss_pred             CEEEEECCCCCEEEEEEEECCCCCEEEEECCCCCE---------EECCCCCCCCCC---CCCEE-EEEEEECCCCC----
T ss_conf             76999801784799999841886479998799967---------987777676231---46748-98899613688----


Q ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCCC--CCCHHHHHHHHHC--CCC---CCCCEEE
Q ss_conf             55643148543342345677775234555530111056641024543321--0000368999975--996---6541488
Q gi|254781172|r  202 NDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFA--KGQYEMLQKMRCL--GFP---VNNGVRQ  274 (731)
Q Consensus       202 N~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~~--~~~~e~l~~L~~~--GF~---v~~~~~~  274 (731)
                                                      ....|++|++....+...  ..-.+++..|+.+  .+.   ..+....
T Consensus       139 --------------------------------~~~~fliFDil~~~G~~v~~~~~~~Rl~~l~~~~~~~~~~~~~~~~i~  186 (330)
T 1ckm_A          139 --------------------------------KKFAFVLFDAVVVSGVTVSQMDLASRFFAMKRSLKEFKNVPEDPAILR  186 (330)
T ss_dssp             --------------------------------TEEEEEEEEEEEETTEECTTSCHHHHHHHHHHHHTTCCCCTTSSSEEE
T ss_pred             --------------------------------CCEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             --------------------------------744899988888788475669868999999998765541334561464


Q ss_pred             EEC---CCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEE
Q ss_conf             740---321134556655310011234376377731100011158765686631231145621589
Q gi|254781172|r  275 ANT---FHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQAST  337 (731)
Q Consensus       275 ~~~---~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T  337 (731)
                      ...   .+......+.+  .+..++|.+||+|+.-.+..+.        .=+|.-.|||.+.+..|
T Consensus       187 ~K~f~~~~~~~~i~~~~--~~~~~~y~~DGLIFtp~~~~y~--------~g~~~~~~KWKP~~~nT  242 (330)
T 1ckm_A          187 YKEWIPLEHPTIIKDHL--KKANAIYHTDGLIIMSVDEPVI--------YGRNFNLFKLKPGTHHT  242 (330)
T ss_dssp             ECCCEETTCHHHHHHHH--HHHHHHSCEEEEEEEESSSCCC--------CEEEEEEEEECSTTCCC
T ss_pred             EEEECCHHHHHHHHHHH--HHCCCCCCCCCEEEECCCCCCC--------CCCCCCEEEECCCCCEE
T ss_conf             11001377889999876--4023466768559951678522--------45573205525788658


No 107
>3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus}
Probab=88.41  E-value=0.072  Score=31.96  Aligned_cols=50  Identities=8%  Similarity=0.241  Sum_probs=34.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             103541035555653057654045410110106777531000100013421001456899998
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN  543 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe  543 (731)
                      -+|.|+|+++..+|++.-      .++..|.      ..+.++|.++ |++++.|++|++.++
T Consensus       176 d~I~GIG~~~~~~Ll~~F------gs~~~i~------~As~eeL~~v-gI~~~~A~~I~~~l~  225 (226)
T 3c65_A          176 DDIPGVGEKRKKALLNYF------GSVKKMK------EATVEELQRA-NIPRAVAEKIYEKLH  225 (226)
T ss_dssp             ---------------------------------------------------------------
T ss_pred             CCCCCCCHHHHHHHHHHC------CCHHHHH------HCCHHHHHHC-CCCHHHHHHHHHHHC
T ss_conf             026886999999999981------8999997------3899999876-999999999999962


No 108
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1
Probab=87.59  E-value=0.19  Score=28.77  Aligned_cols=47  Identities=13%  Similarity=0.108  Sum_probs=36.8

Q ss_pred             HHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011116899999988-299899999789776125117787613888678999999999
Q gi|254781172|r  559 IRHVGAEIARSLAKY-YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       559 I~~vG~~~Ak~La~~-f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      .+|||..+++.|-.+ |.++..+          -..+.++|.+|+||++..|+.|+..
T Consensus        30 ~~Gvg~~~i~KL~~aG~~Tv~~I----------a~~t~~eL~~i~Gi~e~~A~KIi~a   77 (114)
T 1b22_A           30 QCGINANDVKKLEEAGFHTVEAV----------AYAPKKELINIKGISEAKADKILAE   77 (114)
T ss_dssp             HTTCSHHHHHHHHTTCCSSGGGB----------TSSBHHHHHTTTTCSTTHHHHHHHH
T ss_pred             HCCCCHHHHHHHHHCCCCHHHHH----------HHCCHHHHHHCCCCCHHHHHHHHHH
T ss_conf             68999999999999697449999----------8489999976669889999999999


No 109
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A*
Probab=87.58  E-value=0.85  Score=23.68  Aligned_cols=23  Identities=9%  Similarity=-0.055  Sum_probs=18.9

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             77876138886789999999996
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEFY  616 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~ff  616 (731)
                      ..+.|.+++|||+++|..+..|-
T Consensus       123 ~~~~L~~l~GIG~ktA~~~L~~~  145 (214)
T 3fhf_A          123 REFLVRNIKGIGYKEASHFLRNV  145 (214)
T ss_dssp             HHHHHHHSTTCCHHHHHHHHHHT
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             39999748887699999999997


No 110
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, ssogg, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus}
Probab=87.37  E-value=0.42  Score=26.00  Aligned_cols=25  Identities=12%  Similarity=-0.021  Sum_probs=20.4

Q ss_pred             CCHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             1778761388867899999999966
Q gi|254781172|r  593 DDWLSLIRVPLVGDIIAQAIVEFYQ  617 (731)
Q Consensus       593 ~~~e~L~~I~GiG~~~A~si~~ff~  617 (731)
                      +..+.|++++|||+++|+.|.-|..
T Consensus       114 e~~~~L~~l~GIG~ktA~~~L~~~~  138 (207)
T 3fhg_A          114 LARERLLNIKGIGMQEASHFLRNVG  138 (207)
T ss_dssp             HHHHHHTTSTTCCHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHC
T ss_conf             9999999878872999999999976


No 111
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerization motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11
Probab=87.27  E-value=0.23  Score=28.04  Aligned_cols=55  Identities=9%  Similarity=0.181  Sum_probs=32.8

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             231035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       479 ~aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      ...++.|+|+.++++|-++|     +.++.||...+..      +|.++-|+.+..|.+|+.+..+
T Consensus        36 ~l~~l~gv~~~~~~kL~~aG-----~~t~~~l~~~~~~------~L~~~~gis~~~a~kii~~a~~   90 (349)
T 1pzn_A           36 SIEDLPGVGPATAEKLREAG-----YDTLEAIAVASPI------ELKEVAGISEGTALKIIQAARK   90 (349)
T ss_dssp             CSSCCTTCCHHHHHHHHTTT-----CCSHHHHHTCCHH------HHHHHHCCCHHHHHHHHHHHHH
T ss_pred             CHHHCCCCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHHHHCCCHHHHHHHHHHHHH
T ss_conf             76337996999999999869-----9729999708999------9998649899999999999997


No 112
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A*
Probab=87.17  E-value=0.84  Score=23.68  Aligned_cols=14  Identities=21%  Similarity=0.548  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             54103555565305
Q gi|254781172|r  484 EGLGKQQLDFFFKS  497 (731)
Q Consensus       484 ~GLG~k~Ie~L~e~  497 (731)
                      -|+|+-|+.-|+++
T Consensus       273 GGVGp~Tva~L~~N  286 (301)
T 1a4i_A          273 GGVGPMTVAMLMQS  286 (301)
T ss_dssp             SSHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             97239999999999


No 113
>1ngn_A Methyl-CPG binding protein MBD4; mismacth repair in methylated DNA, DNA binding protein; 2.10A {Mus musculus} SCOP: a.96.1.2 PDB: 3iho_A
Probab=87.14  E-value=0.98  Score=23.17  Aligned_cols=25  Identities=20%  Similarity=0.262  Sum_probs=20.5

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             7787613888678999999999669
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~ff~~  618 (731)
                      +.++|.+++|||+.+|+++.-|+-+
T Consensus       102 ~~~~l~~LpGVG~ytad~~~if~~~  126 (155)
T 1ngn_A          102 QWRYPIELHGIGKYGNDSYRIFCVN  126 (155)
T ss_dssp             CCSSGGGSTTCCHHHHHHHHHHTSS
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             2331675898219999999999879


No 114
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase/DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A
Probab=87.03  E-value=1.4  Score=22.02  Aligned_cols=28  Identities=21%  Similarity=0.248  Sum_probs=23.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             0101111689999998829989999978
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEI  584 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~  584 (731)
                      =||||||.++|-.|.+.|++++++.+.+
T Consensus       238 ~gv~giG~ktA~kli~~~~~i~~i~~~~  265 (336)
T 1rxw_A          238 EGVKGVGVKKALNYIKTYGDIFRALKAL  265 (336)
T ss_dssp             CCCTTCCHHHHHHHHHHHSSHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHCCHHHHHHHH
T ss_conf             9999968899999999929999999987


No 115
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp}
Probab=86.70  E-value=0.46  Score=25.71  Aligned_cols=13  Identities=15%  Similarity=0.606  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             4103555565305
Q gi|254781172|r  485 GLGKQQLDFFFKS  497 (731)
Q Consensus       485 GLG~k~Ie~L~e~  497 (731)
                      |+|+-|+.-|+++
T Consensus       263 GVGp~T~a~L~~N  275 (285)
T 3p2o_A          263 GVGPMTIAMLLEN  275 (285)
T ss_dssp             SHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHH
T ss_conf             5619999999999


No 116
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A*
Probab=86.30  E-value=0.14  Score=29.63  Aligned_cols=52  Identities=19%  Similarity=0.402  Sum_probs=35.4

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             10354103555565305765404541011010677753100010001342100145689999875
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR  545 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~s  545 (731)
                      ..|.|+|++++..|+..      ..++.+|-.      .+.++|.+++| +++.|.+|++-++.+
T Consensus         7 ~~IPGIg~~~~~~Ll~~------fgSi~~l~~------as~eeL~~v~G-~~~~A~~i~~~l~~~   58 (63)
T 2a1j_A            7 LKMPGVNAKNCRSLMHH------VKNIAELAA------LSQDELTSILG-NAANAKQLYDFIHTS   58 (63)
T ss_dssp             HTSTTCCHHHHHHHHHH------CSSHHHHHT------CCHHHHHHHHS-CHHHHHHHHHHHHCC
T ss_pred             HCCCCCCHHHHHHHHHH------CCCHHHHHH------CCHHHHHHCCC-CHHHHHHHHHHHCCC
T ss_conf             52999889999999998------679999987------99999987869-899999999998021


No 117
>1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A
Probab=86.02  E-value=0.44  Score=25.88  Aligned_cols=17  Identities=18%  Similarity=0.337  Sum_probs=10.0

Q ss_pred             CCHHHHHHHHHHHHHCC
Q ss_conf             10354103555565305
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKS  497 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~  497 (731)
                      -+|.|+|+++..+|+..
T Consensus       206 pGV~GiG~KtA~kLl~~  222 (290)
T 1exn_A          206 RGVEGIGAKRGYNIIRE  222 (290)
T ss_dssp             CCCTTCCHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHH
T ss_conf             99998589999999987


No 118
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination, helicase; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A
Probab=86.02  E-value=0.33  Score=26.79  Aligned_cols=19  Identities=11%  Similarity=0.169  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCHHHHHHHH
Q ss_conf             1000134210014568999
Q gi|254781172|r  523 KIENILGFGDVSVTNLYDS  541 (731)
Q Consensus       523 ~l~~l~GfgeKsa~nL~~s  541 (731)
                      .|.++.|.|.|.|-+++..
T Consensus        74 ~Li~VsGIGPK~AL~ILs~   92 (203)
T 1cuk_A           74 ELIKTNGVGPKLALAILSG   92 (203)
T ss_dssp             HHHHSSSCCHHHHHHHHHH
T ss_pred             HHHCCCCCCHHHHHHHHHC
T ss_conf             9857688575668888612


No 119
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ewa_A* 3ew9_A* 3etl_A* 2gdj_A*
Probab=85.91  E-value=0.27  Score=27.45  Aligned_cols=10  Identities=10%  Similarity=0.086  Sum_probs=3.7

Q ss_pred             CCHHHHHHHH
Q ss_conf             0878999999
Q gi|254781172|r   43 ILDSEYDALK   52 (731)
Q Consensus        43 isD~eYD~L~   52 (731)
                      ||+..-..+.
T Consensus        44 ~~~~~~~~i~   53 (322)
T 2i1q_A           44 ISEKAAAKMI   53 (322)
T ss_dssp             CCHHHHHHHH
T ss_pred             CCHHHHHHHH
T ss_conf             9999999999


No 120
>3gfk_B DNA-directed RNA polymerase subunit alpha; protein-protein complex, cytoplasm, redox-active center, stress response, transcription; 2.30A {Bacillus subtilis}
Probab=85.85  E-value=0.38  Score=26.37  Aligned_cols=53  Identities=8%  Similarity=0.172  Sum_probs=41.7

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      ++--+|+..+...|-.+|     |.++.||..++..      +|.++++||.||.+-|.+.+++
T Consensus        18 I~~L~LS~R~~n~L~~~g-----I~tv~dL~~~s~~------dLl~i~n~G~kSl~EI~~~L~~   70 (79)
T 3gfk_B           18 IEELDLSVRSYNCLKRAG-----INTVQELANKTEE------DMMKVRNLGRKSLEEVKAKLEE   70 (79)
T ss_dssp             GGGSCCBHHHHHHHHHTT-----CCBHHHHTTCCHH------HHTTSTTCHHHHHHHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHHCCCCCHHHHHHHHHHHHH
T ss_conf             998479899999998928-----9679999868899------9975789867379999999998


No 121
>1z3e_B DNA-directed RNA polymerase alpha chain; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: a.60.3.1 PDB: 3ihq_B
Probab=85.35  E-value=0.36  Score=26.53  Aligned_cols=53  Identities=8%  Similarity=0.172  Sum_probs=39.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      ++--+|+..+...|-.++     |.++.||..++..      +|.++++||+||.+-|.+.+++
T Consensus        11 I~~L~LS~R~~N~L~~~~-----I~tv~dL~~~s~~------dLl~i~n~G~kSl~EI~~~L~~   63 (73)
T 1z3e_B           11 IEELDLSVRSYNCLKRAG-----INTVQELANKTEE------DMMKVRNLGRKSLEEVKAKLEE   63 (73)
T ss_dssp             GGGSCCBHHHHHHHHHTT-----CCBHHHHHTSCHH------HHHTSTTCCHHHHHHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHHCCCCCHHHHHHHHHHHHH
T ss_conf             988469899999998948-----9679999868999------9974789866059999999998


No 122
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA binding, oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A
Probab=85.26  E-value=0.4  Score=26.20  Aligned_cols=55  Identities=7%  Similarity=0.163  Sum_probs=24.9

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             3103541035555653057654045410110106777531000100013421001456899998
Q gi|254781172|r  480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN  543 (731)
Q Consensus       480 aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe  543 (731)
                      -+.|.|+||++.-.+...       -+|.+|...=.  .-+...|.+++|.|.|.|++|+-+++
T Consensus        90 Li~VsGIGPK~AL~ILs~-------~~~~~l~~aI~--~~D~~~L~~vpGIGkKtAeRIilELk  144 (212)
T 2ztd_A           90 LLSVSGVGPRLAMAALAV-------HDAPALRQVLA--DGNVAALTRVPGIGKRGAERMVLELR  144 (212)
T ss_dssp             HHTSTTCCHHHHHHHHHH-------SCHHHHHHHHH--TTCHHHHHTSTTCCHHHHHHHHHHHT
T ss_pred             HHHCCCCCHHHHHHHHHC-------CCHHHHHHHHH--HCCHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             983489774678788854-------99999999998--08999985177824888999999997


No 123
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP, oxidoreductase, PSI; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A
Probab=84.87  E-value=0.81  Score=23.82  Aligned_cols=14  Identities=21%  Similarity=0.513  Sum_probs=8.1

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             54103555565305
Q gi|254781172|r  484 EGLGKQQLDFFFKS  497 (731)
Q Consensus       484 ~GLG~k~Ie~L~e~  497 (731)
                      -|+|+-|+..|+++
T Consensus       260 GGVGp~T~a~L~~N  273 (281)
T 2c2x_A          260 GGVGPLTRAFLLTN  273 (281)
T ss_dssp             SSSHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             95149999999999


No 124
>1p16_A GTP--RNA, mRNA capping enzyme alpha subunit; guanylyltransferase, transcription, capping, CTD, mRNA; HET: SEP G GTP; 2.70A {Candida albicans} SCOP: b.40.4.6 d.142.2.3
Probab=84.29  E-value=1.9  Score=20.98  Aligned_cols=160  Identities=14%  Similarity=0.066  Sum_probs=74.7

Q ss_pred             EEEEEEECCEEEEEEEE---ECC-EEEEEEECCCCHHHHHHHHHHHHHC--CCCCCCC------CCCCCEEEEEEEEEEE
Q ss_conf             19999415818999998---599-8998886598655666999775310--2432233------5445504899999985
Q gi|254781172|r  127 FFTLEPKIDGTMITIRY---EKG-KFVYAALRGDGHSGEDVSACIRAIP--TIPRVLS------LNIPEIIEVRGEVYIS  194 (731)
Q Consensus       127 ~~~vepKiDG~sisl~Y---~~G-~L~~a~TRGdG~~GeDVT~n~~~i~--~iP~~l~------~~~~~~ieiRGEv~m~  194 (731)
                      .|+|++|.||.=.-|..   .+| .-+..++|.+         ++..+.  .+|....      ....+ -.+=||++..
T Consensus        61 ~Y~VteK~DG~R~lL~i~~~~~~~~~~ylidR~~---------~~~~~~~~~~p~~~~~~~~~~~~~~~-TllDGElV~~  130 (395)
T 1p16_A           61 DYFVCEKTDGLRCLLFLINDPDKGEGVFLVTREN---------DYYFIPNIHFPLSVNETREKPTYHHG-TLLDGELVLE  130 (395)
T ss_dssp             CEEEEEEECSEEEEEEEEEETTTEEEEEEEETTC---------CEEECCSCCCCSCTTCCSSSCCCCSS-EEEEEEEEEE
T ss_pred             CEEEEECCCCEEEEEEEEEECCCCEEEEEECCCC---------CEEECCCCCCCCCCCCCCCCCCCCCC-EEEEEEEEEE
T ss_conf             8799988377088999998289877999997899---------66985673323444322245320157-5899999852


Q ss_pred             CHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHCCCEEEEEEECCCCCCCC--CCCHHHHHHHHHCCC------
Q ss_conf             202123455643148543342345677775234555530111056641024543321--000036899997599------
Q gi|254781172|r  195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFA--KGQYEMLQKMRCLGF------  266 (731)
Q Consensus       195 ~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~~r~L~f~ay~~~~~~~~~~--~~~~e~l~~L~~~GF------  266 (731)
                      +..-          +                       .....|++|++....+...  ....+.++.|...-.      
T Consensus       131 ~~~~----------~-----------------------~~~~~fliFDil~~~g~~v~~~~~~~R~~~l~~~v~~~~~~~  177 (395)
T 1p16_A          131 NRNV----------S-----------------------EPVLRYVIFDALAIHGKCIIDRPLPKRLGYITENVMKPFDNF  177 (395)
T ss_dssp             CCSS----------S-----------------------CCEEEEEEEEEEEETTEECTTSCHHHHHHHHHHHTHHHHHHH
T ss_pred             CCCC----------C-----------------------CCEEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             3667----------7-----------------------512689998899888835244987899999998766677665


Q ss_pred             ----------CCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEE
Q ss_conf             ----------6654148874032113455665531001123437637773110001115876568663123114562158
Q gi|254781172|r  267 ----------PVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQAS  336 (731)
Q Consensus       267 ----------~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~  336 (731)
                                ...+.......+-... ....+...-..++|++||+++.-.+..+.  .      =+|--.|||.+....
T Consensus       178 ~~~~~~~~~~~~~~~~i~~K~~~~~~-~~~~i~~~~~~~~~~~DGLIFtp~~~~y~--~------g~~~~~~KWKP~~~n  248 (395)
T 1p16_A          178 KKHNPDIVNSPEFPFKVGFKTMLTSY-HADDVLSKMDKLFHASDGLIYTCAETPYV--F------GTDQTLLKWKPAEEN  248 (395)
T ss_dssp             HHHCHHHHSCTTSCCEEEECCCEEGG-GTHHHHTTGGGCSSCEEEEEEEESSSCCC--S------EEEEEEEEECCGGGC
T ss_pred             HCCCCCCCCCCCCCEEEEECCCCCHH-HHHHHHHHCCCCCCCCCEEEEECCCCCCC--C------CCCCEEEEECCCCCE
T ss_conf             20475200245552788401012257-79999754302476678389924767742--4------553114897168860


Q ss_pred             EE
Q ss_conf             99
Q gi|254781172|r  337 TR  338 (731)
Q Consensus       337 T~  338 (731)
                      |.
T Consensus       249 TI  250 (395)
T 1p16_A          249 TV  250 (395)
T ss_dssp             CE
T ss_pred             EE
T ss_conf             69


No 125
>3k4g_A DNA-directed RNA polymerase subunit alpha; bacterial transcription regulation, DNA-directed RNA polymer nucleotidyltransferase; HET: MLY; 2.05A {Escherichia coli k-12} PDB: 1lb2_B* 1xs9_D
Probab=83.89  E-value=0.52  Score=25.33  Aligned_cols=53  Identities=13%  Similarity=0.185  Sum_probs=34.7

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      ++--+|+..+...|-.+|     |+++.||-.++..      +|+++.+||.||.+-|.+.+++
T Consensus        14 I~eL~LSvR~~N~Lk~~g-----I~tvgdLv~~se~------dLl~i~NfG~kSl~EI~~~L~~   66 (86)
T 3k4g_A           14 VDDLELTVRSANCLXAEA-----IHYIGDLVQRTEV------ELLXTPNLGXXSLTEIXDVLAS   66 (86)
T ss_dssp             GGGGCCCHHHHHHHHHTT-----CCBHHHHHHSCHH------HHHTSTTCCHHHHHHHHHHHHT
T ss_pred             HHHHCCCHHHHHHHCCCC-----CCCHHHHHHCCHH------HHCCCCCCCHHHHHHHHHHHHH
T ss_conf             987278899998725543-----9379999848999------9817889877269999999998


No 126
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis}
Probab=83.81  E-value=1.4  Score=21.99  Aligned_cols=13  Identities=15%  Similarity=0.388  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             4103555565305
Q gi|254781172|r  485 GLGKQQLDFFFKS  497 (731)
Q Consensus       485 GLG~k~Ie~L~e~  497 (731)
                      |+|+-|+.-|+++
T Consensus       263 GVGp~Tva~L~~N  275 (285)
T 3l07_A          263 GVGPMTITELLYN  275 (285)
T ss_dssp             SSHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHH
T ss_conf             6249999999999


No 127
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A*
Probab=83.40  E-value=0.28  Score=27.40  Aligned_cols=52  Identities=19%  Similarity=0.410  Sum_probs=35.8

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             10354103555565305765404541011010677753100010001342100145689999875
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR  545 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~s  545 (731)
                      ..|.|+|++.+..|+..      .+++.+|      ...+.++|..++| +++.|.+|++-++..
T Consensus        21 ~~iPGIg~k~~~~Ll~~------f~sl~~i------~~AS~eeL~~v~G-~~~~Ak~i~~~lh~~   72 (84)
T 1z00_B           21 LKMPGVNAKNCRSLMHH------VKNIAEL------AALSQDELTSILG-NAANAKQLYDFIHTS   72 (84)
T ss_dssp             HTCSSCCHHHHHHHHHH------SSCHHHH------HHSCHHHHHHHHS-CHHHHHHHHHHHTSB
T ss_pred             HCCCCCCHHHHHHHHHH------CCCHHHH------HHCCHHHHHHCCC-CHHHHHHHHHHHCCC
T ss_conf             83899999999999999------6699999------8599999988759-799999999998553


No 128
>2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A
Probab=82.92  E-value=0.27  Score=27.51  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=11.4

Q ss_pred             HHCCCCCCHHHHHHHHHHHCCHH
Q ss_conf             61388867899999999966979
Q gi|254781172|r  598 LIRVPLVGDIIAQAIVEFYQNPR  620 (731)
Q Consensus       598 L~~I~GiG~~~A~si~~ff~~~~  620 (731)
                      |.+|+|||++..+.+...|..-+
T Consensus       170 Ld~I~GIG~k~~~~Ll~~Fgs~~  192 (220)
T 2nrt_A          170 LDNVPGIGPIRKKKLIEHFGSLE  192 (220)
T ss_dssp             HTTSTTCCHHHHHHHHHHHCSHH
T ss_pred             CHHCCCCCHHHHHHHHHHCCCHH
T ss_conf             10037969999999999818999


No 129
>2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-binding, excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus}
Probab=82.39  E-value=0.28  Score=27.39  Aligned_cols=28  Identities=29%  Similarity=0.313  Sum_probs=21.8

Q ss_pred             CHHHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             1011116899999988299899999789
Q gi|254781172|r  558 GIRHVGAEIARSLAKYYLSYQNFAQEIN  585 (731)
Q Consensus       558 GI~~vG~~~Ak~La~~f~si~~l~~~~~  585 (731)
                      ||||||.++|-.|.+.|++++++.+.++
T Consensus       238 gv~giG~ktA~kli~~~~sle~i~~~~~  265 (346)
T 2izo_A          238 GIRGIGPERALKIIKKYGKIEKAMEYGE  265 (346)
T ss_dssp             CSTTCCHHHHHHHHHHSSCC--------
T ss_pred             CCCCCCHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             6898379999999999399999999899


No 130
>1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A
Probab=82.15  E-value=2.3  Score=20.38  Aligned_cols=53  Identities=17%  Similarity=0.266  Sum_probs=39.7

Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHH
Q ss_conf             4666776301011116899999988-29989999978977612511778761388867899999999
Q gi|254781172|r  549 SLERFIFSLGIRHVGAEIARSLAKY-YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       549 ~L~r~L~ALGI~~vG~~~Ak~La~~-f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~  614 (731)
                      .+..|+-+|+|   -+..|.+|... |.|++.+..          .+.++|..|+||.+.+|+.+.+
T Consensus         4 ~~~~F~e~Ldv---De~iA~lLv~EGF~siEeIAy----------~~~~eL~~IegfDee~a~eL~~   57 (70)
T 1u9l_A            4 AIDTFTKYLDI---DEDFATVLVEEGFSTLEELAY----------VPMKELLEIEGLDEPTVEALRE   57 (70)
T ss_dssp             HHHHHHHHHTC---CHHHHHHHHHTTCCCHHHHHH----------SCHHHHTTSTTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCC---CHHHHHHHHHHCCCCHHHHHC----------CCHHHHHHCCCCCHHHHHHHHH
T ss_conf             89999998486---399999999865597999875----------9999997631558999999999


No 131
>1coo_A RNA polymerase alpha subunit; transcription regulation, nucleotidyl transferase; NMR {Escherichia coli K12} SCOP: a.60.3.1 PDB: 2jzb_A
Probab=82.06  E-value=0.82  Score=23.78  Aligned_cols=52  Identities=13%  Similarity=0.151  Sum_probs=39.7

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             103541035555653057654045410110106777531000100013421001456899998
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN  543 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe  543 (731)
                      ++--+|+..+...|-.+|     |.++.||..++..      +|+++++||.||.+-|.+.+.
T Consensus        26 I~eL~LSvRs~N~L~~~g-----I~tvgdLv~~se~------dLl~~~n~G~KSl~EIk~~L~   77 (98)
T 1coo_A           26 VDDLELTVRSANCLKAEA-----IHYIGDLVQRTEV------ELLKTPNLGKKSLTEIKDVLA   77 (98)
T ss_dssp             GGGGTCCTTTHHHHHTTT-----CCBHHHHHTSCHH------HHTTSTTCCHHHHHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHHHC-----CCCHHHHHHCCHH------HHHHCCCCCHHHHHHHHHHHH
T ss_conf             988277899999873817-----9389999857999------997588976878999999999


No 132
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4}
Probab=80.77  E-value=2.4  Score=20.19  Aligned_cols=18  Identities=22%  Similarity=0.300  Sum_probs=8.3

Q ss_pred             CCCCEEEE-ECCHHCCCCC
Q ss_conf             43763777-3110001115
Q gi|254781172|r  298 DIDGLVYK-VDEFSLQKQL  315 (731)
Q Consensus       298 ~iDGiVik-vn~~~~q~~l  315 (731)
                      +-+|.+|- .||....+.+
T Consensus       251 ~~~g~~V~n~dd~~~~~~~  269 (524)
T 3hn7_A          251 PSTGKIIMPAATISLEDTL  269 (524)
T ss_dssp             CTTSEEEEESSCHHHHHHH
T ss_pred             CCCCCEEECCCHHHHHHHH
T ss_conf             8788547534045699999


No 133
>3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens}
Probab=80.33  E-value=2.6  Score=19.94  Aligned_cols=16  Identities=38%  Similarity=0.424  Sum_probs=7.7

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             3888678999999999
Q gi|254781172|r  600 RVPLVGDIIAQAIVEF  615 (731)
Q Consensus       600 ~I~GiG~~~A~si~~f  615 (731)
                      .++|||+++|..|..|
T Consensus       133 ~LPGVG~kTA~aIl~~  148 (287)
T 3n5n_X          133 LLPGVGRYTAGAIASI  148 (287)
T ss_dssp             HSTTCCHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             6887568999999998


No 134
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2
Probab=79.97  E-value=0.89  Score=23.50  Aligned_cols=13  Identities=15%  Similarity=0.457  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             4103555565305
Q gi|254781172|r  485 GLGKQQLDFFFKS  497 (731)
Q Consensus       485 GLG~k~Ie~L~e~  497 (731)
                      |+|+-|+.-|+++
T Consensus       262 GVGp~T~a~L~~N  274 (288)
T 1b0a_A          262 GVGPMTVATLIEN  274 (288)
T ss_dssp             SSHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHH
T ss_conf             5649999999999


No 135
>2ziu_B Crossover junction endonuclease EME1; helix-hairpin-helix, alternative splicing, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; 2.70A {Homo sapiens} PDB: 2ziw_B 2zix_B 2ziv_B
Probab=78.29  E-value=2.9  Score=19.49  Aligned_cols=61  Identities=16%  Similarity=0.177  Sum_probs=40.7

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCC------------CCCCHHHHHHHHHHHCC
Q ss_conf             010111168999999882998999997897761251177876138------------88678999999999669
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV------------PLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I------------~GiG~~~A~si~~ff~~  618 (731)
                      .-||+|....|..|+.+|+|+..+..+...-... .....-|..|            .-||+..++.|..+|..
T Consensus       258 ~qi~~vs~~~A~aI~~~Ypt~~~L~~ay~~~~~~-~e~~~lL~~i~~~~~~~~~~~~rriG~~lSkriy~~~ts  330 (341)
T 2ziu_B          258 QQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSD-KERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTT  330 (341)
T ss_dssp             TTSTTCCHHHHHHHHHHSCSHHHHHHHHHTCSCH-HHHTTTTTTCBTTTTC----CCCBCCHHHHHHHHHHHHC
T ss_pred             HHCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCH-HHHHHHHHHCEECCCCCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             8714999999999999789999999999836875-678888643232347887756674379999999999846


No 136
>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B
Probab=78.04  E-value=0.84  Score=23.71  Aligned_cols=48  Identities=17%  Similarity=0.227  Sum_probs=23.8

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             10354103555565305765404541011010677753100010001342100145689
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY  539 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~  539 (731)
                      ++++|+++.++.+|-+++     |++.-||=.|      ..++|..+.+..+..|.+|+
T Consensus        10 ~~leG~~~~~~~~L~e~g-----I~t~edLAdl------s~dEL~ei~~i~ee~A~~lI   57 (70)
T 1wcn_A           10 LNLEGVDRDLAFKLAARG-----VCTLEDLAEQ------GIDDLADIEGLTDEKAGALI   57 (70)
T ss_dssp             HSSTTCCHHHHHHHHTTT-----CCSHHHHHTS------CHHHHHTSSSCCHHHHHHHH
T ss_pred             HHCCCCCHHHHHHHHHCC-----CCCHHHHHHH------CHHHHHHHCCCCHHHHHHHH
T ss_conf             717898999999999969-----9749999872------89999876168999999999


No 137
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-binding, nucleotide-binding; 2.30A {Sulfolobus solfataricus}
Probab=77.84  E-value=3  Score=19.39  Aligned_cols=18  Identities=28%  Similarity=0.608  Sum_probs=8.3

Q ss_pred             CCCCEEEEEECCCCHHHH
Q ss_conf             407689998358702566
Q gi|254781172|r  396 RVGDRVLVKRAGEVIPKV  413 (731)
Q Consensus       396 ~iGd~V~I~RaGdVIP~I  413 (731)
                      ..|..+.+..+.+-..+.
T Consensus       397 ~~G~~~i~~~~~~~~~~~  414 (715)
T 2va8_A          397 QIGESIVVVRDKEDVDRV  414 (715)
T ss_dssp             SCEEEEEECSCGGGHHHH
T ss_pred             CEEEEEEEECCCHHHHHH
T ss_conf             703899995882779999


No 138
>1nnq_A Rubrerythrin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.35A {Pyrococcus furiosus} SCOP: a.25.1.1 g.41.5.1 PDB: 2hr5_A
Probab=77.55  E-value=0.52  Score=25.31  Aligned_cols=11  Identities=18%  Similarity=0.108  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHH
Q ss_conf             44665533213
Q gi|254781172|r  466 AQQLERLKHFV  476 (731)
Q Consensus       466 aq~~~~i~hF~  476 (731)
                      .|...+..+|+
T Consensus        20 s~A~~rY~~~A   30 (171)
T 1nnq_A           20 SMAHMRYLIFA   30 (171)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 139
>2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A
Probab=77.54  E-value=0.57  Score=25.02  Aligned_cols=21  Identities=29%  Similarity=0.418  Sum_probs=10.9

Q ss_pred             HHCCCCCCHHHHHHHHHHHCC
Q ss_conf             613888678999999999669
Q gi|254781172|r  598 LIRVPLVGDIIAQAIVEFYQN  618 (731)
Q Consensus       598 L~~I~GiG~~~A~si~~ff~~  618 (731)
                      |..|+|+|+..|+.+.+-|..
T Consensus       164 L~~Ipgi~~~~A~~Ll~~f~S  184 (219)
T 2bgw_A          164 LQSFPGIGRRTAERILERFGS  184 (219)
T ss_dssp             HHTSTTCCHHHHHHHHHHHSS
T ss_pred             HHCCCCCCHHHHHHHHHHCCC
T ss_conf             840799899999999998699


No 140
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A
Probab=76.38  E-value=3.3  Score=19.10  Aligned_cols=22  Identities=27%  Similarity=0.235  Sum_probs=17.9

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             7787613888678999999999
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ..+.|++|+|||+++|+.+.=|
T Consensus       209 ~~~~L~~i~GIG~wtAd~ilLf  230 (290)
T 3i0w_A          209 CHEELKKFMGVGPQVADCIMLF  230 (290)
T ss_dssp             HHHHHTTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHHH
T ss_conf             9999986799488999999999


No 141
>1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A
Probab=75.80  E-value=3.4  Score=19.00  Aligned_cols=23  Identities=22%  Similarity=0.273  Sum_probs=11.7

Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             67763010111168999999882
Q gi|254781172|r  552 RFIFSLGIRHVGAEIARSLAKYY  574 (731)
Q Consensus       552 r~L~ALGI~~vG~~~Ak~La~~f  574 (731)
                      .+|.|++-.-=|+.||-.|.+.+
T Consensus       136 EVIlA~~~t~EGe~Ta~yi~~~L  158 (228)
T 1vdd_A          136 EVILATGTTVEGDATALYLQRLL  158 (228)
T ss_dssp             EEEECCCSSHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCHHHHHHHHHHHH
T ss_conf             79998179855189999999985


No 142
>2c5u_A RNA ligase, T4 RNA ligase 1; nucleotidyl transferase, ATP-binding; HET: APC; 2.21A {Bacteriophage T4}
Probab=75.36  E-value=1.3  Score=22.29  Aligned_cols=54  Identities=17%  Similarity=0.236  Sum_probs=38.2

Q ss_pred             CCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCC
Q ss_conf             6425702159999999999999986124677761199994158189999985998998886598
Q gi|254781172|r   93 IPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGD  156 (731)
Q Consensus        93 ~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGd  156 (731)
                      +...|.+|-|+..|...|..         ......+.+..|+||.=+.+.|.+|.+ ...|||.
T Consensus        69 Iv~r~~~KFFN~~E~~~~~~---------~~~~~~~~v~eK~DGsLi~~~~~~g~~-~~~TK~s  122 (375)
T 2c5u_A           69 IASRPMEKFFNLNENPFTMN---------IDLNDVDYILTKEDGSLVSTYLDGDEI-LFKSKGS  122 (375)
T ss_dssp             EEECCCCCCCBTTSSGGGSS---------CCGGGEEEEEEECCSEEEEEEEETTEE-EEEETTB
T ss_pred             EEEECCCHHCCCCCCCCCCC---------CCCCCCEEEEEECCCEEEEEEEECCEE-EEEECCC
T ss_conf             99808423026366534444---------577887189996084899999989999-9980798


No 143
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-diaminopimelate ligase; structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis MC58}
Probab=73.16  E-value=3.9  Score=18.53  Aligned_cols=13  Identities=23%  Similarity=0.327  Sum_probs=6.5

Q ss_pred             HHH-HHHHHCCCCC
Q ss_conf             368-9999759966
Q gi|254781172|r  256 EML-QKMRCLGFPV  268 (731)
Q Consensus       256 e~l-~~L~~~GF~v  268 (731)
                      .++ ..|+..|+.+
T Consensus       124 ~mi~~iL~~~g~~~  137 (326)
T 3eag_A          124 SMLAWVLEYAGLAP  137 (326)
T ss_dssp             HHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             99999998619983


No 144
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubredoxin-like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A
Probab=72.52  E-value=0.93  Score=23.37  Aligned_cols=26  Identities=4%  Similarity=-0.176  Sum_probs=9.9

Q ss_pred             CHHHHHHHHHHHCC--HHHHHHHHHHHH
Q ss_conf             78999999999669--799999999997
Q gi|254781172|r  605 GDIIAQAIVEFYQN--PRNICAVEALLK  630 (731)
Q Consensus       605 G~~~A~si~~ff~~--~~n~~~i~~L~~  630 (731)
                      |...+..+.+++..  ..+...+.+++.
T Consensus       113 Gd~~~a~~f~~i~~~E~~H~~~f~~~l~  140 (191)
T 1lko_A          113 GYEEIARVFASIAVAEEFHEKRFLDFAR  140 (191)
T ss_dssp             TCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999999999999999


No 145
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*
Probab=72.36  E-value=1.8  Score=21.12  Aligned_cols=16  Identities=25%  Similarity=0.374  Sum_probs=10.7

Q ss_pred             HHHHHHHCCCCCCCCE
Q ss_conf             6899997599665414
Q gi|254781172|r  257 MLQKMRCLGFPVNNGV  272 (731)
Q Consensus       257 ~l~~L~~~GF~v~~~~  272 (731)
                      -.+.|+.-||.+....
T Consensus        95 ~i~kL~~aG~~t~~~i  110 (400)
T 3lda_A           95 DVKKLRESGLHTAEAV  110 (400)
T ss_dssp             HHHHHHHTTCCBHHHH
T ss_pred             HHHHHHHCCCCCHHHH
T ss_conf             9999998698519999


No 146
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A
Probab=71.27  E-value=1.8  Score=21.12  Aligned_cols=18  Identities=22%  Similarity=0.529  Sum_probs=8.6

Q ss_pred             HHHCCCCCCHHHHHHHHH
Q ss_conf             761388867899999999
Q gi|254781172|r  597 SLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       597 ~L~~I~GiG~~~A~si~~  614 (731)
                      .|++|+|+|...|..+.+
T Consensus       633 ~L~~i~~v~~~~ar~L~~  650 (702)
T 2p6r_A          633 ELVRIRHIGRVRARKLYN  650 (702)
T ss_dssp             HHHTSTTCCHHHHHHHHT
T ss_pred             HHCCCCCCCHHHHHHHHH
T ss_conf             670889999999999998


No 147
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33
Probab=69.82  E-value=1.4  Score=21.97  Aligned_cols=22  Identities=9%  Similarity=0.240  Sum_probs=15.4

Q ss_pred             CCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             1489899975023454322246844076899983
Q gi|254781172|r  372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKR  405 (731)
Q Consensus       372 tlhN~~~I~~l~~~~~~~~~~~~I~iGd~V~I~R  405 (731)
                      ++|+.+++.+.            +++|-.+.+.-
T Consensus       157 ~~~~~~e~~r~------------LkpgG~l~~~~  178 (269)
T 1p91_A          157 APCKAEELARV------------VKPGGWVITAT  178 (269)
T ss_dssp             CCCCHHHHHHH------------EEEEEEEEEEE
T ss_pred             CHHHHHHHHHH------------CCCCCEEEEEE
T ss_conf             77899999987------------15298999998


No 148
>2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, structural genomics, PSI-2, protein structure initiative; 2.55A {Bacillus halodurans}
Probab=69.15  E-value=3.6  Score=18.78  Aligned_cols=21  Identities=19%  Similarity=0.249  Sum_probs=17.6

Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             787613888678999999999
Q gi|254781172|r  595 WLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       595 ~e~L~~I~GiG~~~A~si~~f  615 (731)
                      .+.|+.|+|||+.+|+.+.=|
T Consensus       137 ~~~L~~ikGIGpWTA~~illf  157 (233)
T 2h56_A          137 IEKLTAIKGIGQWTAEMFMMF  157 (233)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHCCCCCHHHHHHHHHH
T ss_conf             999880688487899999999


No 149
>2qkd_A Zinc finger protein ZPR1; helical hairpins, beta helix, anti-parrallel beta sheet, double straded anti-parallel beta helix, metal binding protein; 2.00A {Mus musculus}
Probab=68.46  E-value=1.4  Score=21.98  Aligned_cols=19  Identities=21%  Similarity=0.588  Sum_probs=15.1

Q ss_pred             CCEEEECCCCCCCCCCCCC
Q ss_conf             3047770432657750103
Q gi|254781172|r  425 AQPFSFPSFCPICQSRVVR  443 (731)
Q Consensus       425 ~~~~~~P~~CP~Cgs~l~~  443 (731)
                      ...+.||..||+||.+...
T Consensus       214 ~ev~~f~~~CP~C~~~~~~  232 (404)
T 2qkd_A          214 NEVLQFNTNCPECNAPAQT  232 (404)
T ss_dssp             CCEEEEEECCTTTCCTTCE
T ss_pred             CCEEEECCCCCCCCCCCEE
T ss_conf             6358956989877872457


No 150
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIRON center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A
Probab=68.03  E-value=1.2  Score=22.50  Aligned_cols=12  Identities=8%  Similarity=0.022  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999999733
Q gi|254781172|r  621 NICAVEALLKEV  632 (731)
Q Consensus       621 n~~~i~~L~~~~  632 (731)
                      +...+.+++..+
T Consensus       152 H~~~f~~~le~l  163 (202)
T 1yuz_A          152 HAERYLAAYNDI  163 (202)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999987


No 151
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protein structure initiative, midwest center for structural genomics; 2.00A {Nitrosomonas europaea atcc 19718}
Probab=67.34  E-value=2.1  Score=20.61  Aligned_cols=27  Identities=22%  Similarity=0.581  Sum_probs=14.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             43265775010337865445210100354
Q gi|254781172|r  432 SFCPICQSRVVRDLNPKTGKLVAAHRCTG  460 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n  460 (731)
                      .+||.||++++.....  ++....++|++
T Consensus         4 ~yCp~CG~~~~~~~~~--g~~~~~~~C~~   30 (189)
T 3cng_A            4 KFCSQCGGEVILRIPE--GDTLPRYICPK   30 (189)
T ss_dssp             CBCTTTCCBCEEECCT--TCSSCEEEETT
T ss_pred             EECCCCCCCCEECCCC--CCCCEEEECCC
T ss_conf             0584678756403468--89724753799


No 152
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1
Probab=67.24  E-value=5.1  Score=17.62  Aligned_cols=10  Identities=30%  Similarity=0.587  Sum_probs=5.6

Q ss_pred             EEEECCCCHH
Q ss_conf             8886598655
Q gi|254781172|r  150 YAALRGDGHS  159 (731)
Q Consensus       150 ~a~TRGdG~~  159 (731)
                      -|+|=-||.+
T Consensus       117 IaITGTnGKT  126 (469)
T 1j6u_A          117 FAVTGTDGKT  126 (469)
T ss_dssp             EEEECSSSHH
T ss_pred             EEEECCCCHH
T ss_conf             9996899614


No 153
>1m3q_A 8-oxoguanine DNA glycosylase; DNA repair, END product, HOGG, 8-aminoguanine, RE-ligation, hydrolase/DNA complex; HET: DRZ ANG; 1.90A {Homo sapiens} SCOP: a.96.1.3 d.129.1.2 PDB: 1m3h_A* 1n39_A* 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 1fn7_A* 1n3a_A* 1n3c_A* 1ebm_A* 1ko9_A 2noe_A* 2noh_A* 2nol_A* 3ktu_A* 1yqk_A 2noz_A* 2nof_A* 1yqr_A* 1yql_A* ...
Probab=66.59  E-value=5.3  Score=17.53  Aligned_cols=22  Identities=27%  Similarity=0.320  Sum_probs=18.7

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             7787613888678999999999
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~f  615 (731)
                      ..+.|++++|||+++|+.+.=|
T Consensus       228 ~~~~L~~l~GIG~wtAd~ilLf  249 (317)
T 1m3q_A          228 AHKALCILPGVGTKVADCICLM  249 (317)
T ss_dssp             HHHHHTTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHHH
T ss_conf             9999985489488999999998


No 154
>2a6h_A DNA-directed RNA polymerase alpha chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: d.74.3.1 d.181.1.1 PDB: 1smy_A* 1zyr_A* 1iw7_A* 2a69_A* 2a6e_A 2a68_A* 2be5_A* 2cw0_A 2o5i_A 2o5j_A* 2ppb_A* 3dxj_A* 3eql_A* 1i6v_A* 1ynj_A* 1l9z_A 1l9u_A* 1ynn_A* 2gho_A 1hqm_A ...
Probab=66.26  E-value=0.99  Score=23.14  Aligned_cols=52  Identities=21%  Similarity=0.379  Sum_probs=38.0

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             035410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       482 dI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      +--.|+.++..-|-.++     |..+.||..++..      +|+++.+||+||.+-+.+.+++
T Consensus       257 e~L~LSvRs~NcLk~a~-----I~ti~dLv~~s~~------eLl~i~N~G~KSl~EI~ekL~~  308 (315)
T 2a6h_A          257 EELGLSTRVLHSLKEEG-----IESVRALLALNLK------DLKNIPGIGERSLEEIKEALEK  308 (315)
T ss_dssp             ---------------------------------------------------------------
T ss_pred             HHHCCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHCCCCCCCCCHHHHHHHHHH
T ss_conf             98228798886787859-----9489998739999------9847999851039999999998


No 155
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}
Probab=66.15  E-value=2.6  Score=19.90  Aligned_cols=60  Identities=23%  Similarity=0.354  Sum_probs=32.9

Q ss_pred             CCCCCEEEEEECCCCHHHHH---HHCCC--CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHH
Q ss_conf             44076899983587025665---41012--35787304777043265775010337865445210100354344114466
Q gi|254781172|r  395 IRVGDRVLVKRAGEVIPKVV---DIIVN--ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQL  469 (731)
Q Consensus       395 I~iGd~V~I~RaGdVIP~I~---~Vi~~--~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~  469 (731)
                      =||||+|.|+-++|-.-.|.   +.+..  .|... .+|  - .||.||-... +           +     ...-+++.
T Consensus       234 dGIGDTIRvSlt~~p~~EV~va~~ILqal~lR~~~-~~~--I-SCP~CGRt~~-d-----------l-----~~~~~~i~  292 (366)
T 3noy_A          234 MGIGDTVRVSLTDDPVVEVETAYEILKSLGLRRRG-VEI--V-ACPTCGRIEV-D-----------L-----PKVVKEVQ  292 (366)
T ss_dssp             TTCCSEECCCCSSCHHHHHHHHHHHHHHTTSCCSS-CEE--E-ECCCCTTCCS-C-----------H-----HHHHHHHH
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCC-CCC--C-CCCCCCCCCH-H-----------H-----HHHHHHHH
T ss_conf             59876499957889788778899999973866479-971--3-1799776501-1-----------9-----99999999


Q ss_pred             HHHHHH
Q ss_conf             553321
Q gi|254781172|r  470 ERLKHF  475 (731)
Q Consensus       470 ~~i~hF  475 (731)
                      +++.|.
T Consensus       293 ~~l~~~  298 (366)
T 3noy_A          293 EKLSGV  298 (366)
T ss_dssp             HHTTTC
T ss_pred             HHHCCC
T ss_conf             971189


No 156
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular switch, RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus P2} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*
Probab=65.81  E-value=1  Score=23.03  Aligned_cols=12  Identities=17%  Similarity=0.307  Sum_probs=4.8

Q ss_pred             HHHHHHCCCCCC
Q ss_conf             899997599665
Q gi|254781172|r  258 LQKMRCLGFPVN  269 (731)
Q Consensus       258 l~~L~~~GF~v~  269 (731)
                      .+.|++-||.+.
T Consensus        25 ~~kL~~~g~~t~   36 (324)
T 2z43_A           25 INKLIEAGYSSL   36 (324)
T ss_dssp             ------------
T ss_pred             HHHHHHCCCCCH
T ss_conf             999998699619


No 157
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A
Probab=65.52  E-value=5.4  Score=17.46  Aligned_cols=23  Identities=13%  Similarity=0.162  Sum_probs=11.9

Q ss_pred             EECCCCCCCHHHCCCHHHHHHHHH
Q ss_conf             451664257021599999999999
Q gi|254781172|r   89 VTHSIPTLSLEKIWNIEDLRKFIT  112 (731)
Q Consensus        89 v~H~~pMlSL~k~~~~~el~~w~~  112 (731)
                      .+|..|.+..++..+ +++.++.+
T Consensus        50 ~~~~ip~~~~~~~~~-~~~~~~l~   72 (305)
T 2bln_A           50 AERGIPVYAPDNVNH-PLWVERIA   72 (305)
T ss_dssp             HHHTCCEECCSCCCS-HHHHHHHH
T ss_pred             HHCCCCEECCCCCCC-HHHHHHHH
T ss_conf             986998984598998-99999998


No 158
>2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F
Probab=64.83  E-value=2.2  Score=20.53  Aligned_cols=24  Identities=50%  Similarity=0.872  Sum_probs=18.8

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHCC
Q ss_conf             68440768999835870256654101
Q gi|254781172|r  393 RDIRVGDRVLVKRAGEVIPKVVDIIV  418 (731)
Q Consensus       393 ~~I~iGd~V~I~RaGdVIP~I~~Vi~  418 (731)
                      .+|.+||.|.| ++||.|| .-.++.
T Consensus        28 ~~l~~GDiv~v-~~Gd~IP-aDg~v~   51 (113)
T 2hc8_A           28 EEVAVGDIVIV-RPGEKIP-VDGVVV   51 (113)
T ss_dssp             GGCCTTCEEEE-CTTCBCC-SEEEEE
T ss_pred             HHCCCCCEEEE-CCCCEEE-CCEEEE
T ss_conf             99766999998-8999995-172672


No 159
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-binding, ssDNA binding; 2.8A {Sulfolobus solfataricus}
Probab=62.52  E-value=1.6  Score=21.48  Aligned_cols=40  Identities=15%  Similarity=0.388  Sum_probs=22.5

Q ss_pred             EEEEECCCCHHHHHHHCCCCCC-------------CCCCEEEECCCCCCCCCC
Q ss_conf             9998358702566541012357-------------873047770432657750
Q gi|254781172|r  401 VLVKRAGEVIPKVVDIIVNERH-------------PDAQPFSFPSFCPICQSR  440 (731)
Q Consensus       401 V~I~RaGdVIP~I~~Vi~~~r~-------------~~~~~~~~P~~CP~Cgs~  440 (731)
                      -.|.|+++|-|++......-..             .....+..|+.||.|+..
T Consensus       125 GiV~r~s~vkp~~~~~~~~c~~~~c~~~~~~~~~~~~~~~~~~p~~C~~c~~~  177 (268)
T 2vl6_A          125 GILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKP  177 (268)
T ss_dssp             EEEEEECCCEEEEEECEEEEECTTCCCEEESSTTSCCCTTCCCCSBCTTTCCB
T ss_pred             EEEEEECCCCHHHEEEEEEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999167546347769778707984289956652036656787647888989


No 160
>2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus}
Probab=61.94  E-value=5.6  Score=17.34  Aligned_cols=23  Identities=13%  Similarity=0.030  Sum_probs=15.6

Q ss_pred             CHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             77876138886789999999996
Q gi|254781172|r  594 DWLSLIRVPLVGDIIAQAIVEFY  616 (731)
Q Consensus       594 ~~e~L~~I~GiG~~~A~si~~ff  616 (731)
                      +..++..++|||+++|+.|.+++
T Consensus        56 s~~~l~~l~GIG~~i~~ki~e~L   78 (87)
T 2kp7_A           56 SGKEAKILQHFGDRLCRMLDEKL   78 (87)
T ss_dssp             SHHHHHTCTTTCHHHHHHHHHHH
T ss_pred             CHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             89999727997789999999999


No 161
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1
Probab=59.85  E-value=2  Score=20.86  Aligned_cols=11  Identities=27%  Similarity=0.963  Sum_probs=8.6

Q ss_pred             CCCCCCCCCCC
Q ss_conf             43265775010
Q gi|254781172|r  432 SFCPICQSRVV  442 (731)
Q Consensus       432 ~~CP~Cgs~l~  442 (731)
                      -.||+||.++.
T Consensus        48 GkCPvCgreLt   58 (112)
T 1l8d_A           48 GKCPVCGRELT   58 (112)
T ss_dssp             EECTTTCCEEC
T ss_pred             CCCCCCCCCCC
T ss_conf             87998899376


No 162
>1d8b_A SGS1 RECQ helicase; five helices, three-helical bundle flanked by two helices, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.8.1
Probab=59.77  E-value=6.9  Score=16.65  Aligned_cols=35  Identities=11%  Similarity=0.138  Sum_probs=24.5

Q ss_pred             CCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             51177876138886789999999996697999999999973
Q gi|254781172|r  591 NNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE  631 (731)
Q Consensus       591 ~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~  631 (731)
                      .-.+.++|..|+|||+..++.+ .+|     +..+.+|.+.
T Consensus        43 ~P~t~~eL~~I~Gvg~~k~~kY-~~F-----~~~i~~~~~~   77 (81)
T 1d8b_A           43 LPMNDSAFATLGTVEDKYRRRF-KYF-----KATIADLSKK   77 (81)
T ss_dssp             CCCSHHHHGGGSCCCHHHHHHG-GGT-----HHHHHHHHHH
T ss_pred             CCCCHHHHCCCCCCCHHHHHHH-HHH-----HHHHHHHHHH
T ss_conf             8999999827999998999999-999-----9999999997


No 163
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structural genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens}
Probab=59.56  E-value=4  Score=18.48  Aligned_cols=12  Identities=8%  Similarity=0.163  Sum_probs=4.1

Q ss_pred             ECCCCHHHHHHH
Q ss_conf             659865566699
Q gi|254781172|r  153 LRGDGHSGEDVS  164 (731)
Q Consensus       153 TRGdG~~GeDVT  164 (731)
                      |=|-+-+|.-|.
T Consensus        11 TG~s~GIG~aia   22 (260)
T 2qq5_A           11 TGASRGIGRGIA   22 (260)
T ss_dssp             SSTTSHHHHHHH
T ss_pred             ECCCCHHHHHHH
T ss_conf             585869999999


No 164
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A
Probab=58.17  E-value=2.5  Score=20.00  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             354103555565305
Q gi|254781172|r  483 IEGLGKQQLDFFFKS  497 (731)
Q Consensus       483 I~GLG~k~Ie~L~e~  497 (731)
                      |.|+|+++.-+|+..
T Consensus       242 i~giG~ktA~~li~~  256 (340)
T 1b43_A          242 IKGIGLKKALEIVRH  256 (340)
T ss_dssp             STTCCHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHH
T ss_conf             798279999999999


No 165
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: MSE; 2.20A {Escherichia coli K12} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A
Probab=57.85  E-value=3.5  Score=18.89  Aligned_cols=12  Identities=17%  Similarity=0.686  Sum_probs=5.7

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             432657750103
Q gi|254781172|r  432 SFCPICQSRVVR  443 (731)
Q Consensus       432 ~~CP~Cgs~l~~  443 (731)
                      .+||.||+++..
T Consensus       108 rfC~~CG~~~~~  119 (269)
T 1vk6_A          108 KYCGYCGHEMYP  119 (269)
T ss_dssp             SBCTTTCCBEEE
T ss_pred             CCCCCCCCCCCC
T ss_conf             868667987743


No 166
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A*
Probab=57.06  E-value=0.18  Score=28.83  Aligned_cols=16  Identities=13%  Similarity=0.106  Sum_probs=10.3

Q ss_pred             CCHHHHHHHHHCCCCC
Q ss_conf             0003689999759966
Q gi|254781172|r  253 GQYEMLQKMRCLGFPV  268 (731)
Q Consensus       253 ~~~e~l~~L~~~GF~v  268 (731)
                      +......++.+++|..
T Consensus       265 ~~~~~~~~~~~~ef~~  280 (832)
T 1bgx_T          265 DRERLRAFLERLEFGS  280 (832)
T ss_dssp             CHHHHHHHHTTTTCCS
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             7788999999852676


No 167
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A
Probab=56.63  E-value=7.7  Score=16.27  Aligned_cols=14  Identities=14%  Similarity=0.263  Sum_probs=7.9

Q ss_pred             CEEEEEECCCCHHH
Q ss_conf             68999835870256
Q gi|254781172|r  399 DRVLVKRAGEVIPK  412 (731)
Q Consensus       399 d~V~I~RaGdVIP~  412 (731)
                      |.+++.--|.+||+
T Consensus       101 Dl~v~~~~~~iip~  114 (329)
T 2bw0_A          101 ELNVLPFCSQFIPM  114 (329)
T ss_dssp             SEEEESSCSSCCCH
T ss_pred             CEEEEECCHHHCCH
T ss_conf             99999061243779


No 168
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}
Probab=56.61  E-value=7.7  Score=16.27  Aligned_cols=16  Identities=13%  Similarity=0.036  Sum_probs=8.5

Q ss_pred             EEECCCCHHHHHHHHH
Q ss_conf             8865986556669997
Q gi|254781172|r  151 AALRGDGHSGEDVSAC  166 (731)
Q Consensus       151 a~TRGdG~~GeDVT~n  166 (731)
                      .+|=|.+-+|.-+...
T Consensus        12 lITGas~GIG~a~a~~   27 (319)
T 3ioy_A           12 FVTGGANGVGIGLVRQ   27 (319)
T ss_dssp             EEETTTSTHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHH
T ss_conf             9928887899999999


No 169
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; structural genomics, short-chain dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2
Probab=55.49  E-value=7.7  Score=16.25  Aligned_cols=11  Identities=9%  Similarity=0.202  Sum_probs=5.8

Q ss_pred             CCCCEEEEECC
Q ss_conf             16866999725
Q gi|254781172|r  647 IENKKLVFTGT  657 (731)
Q Consensus       647 l~gk~vV~TGt  657 (731)
                      ++|.++.+.|-
T Consensus       240 itG~~i~VdGG  250 (267)
T 2gdz_A          240 LNGAIMKITTS  250 (267)
T ss_dssp             CSSCEEEEETT
T ss_pred             CCCCEEEECCC
T ss_conf             99888998999


No 170
>3lu0_A DNA-directed RNA polymerase subunit alpha; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_A
Probab=55.49  E-value=2  Score=20.78  Aligned_cols=49  Identities=14%  Similarity=0.190  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             410355556530576540454101101067775310001000134210014568999987
Q gi|254781172|r  485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       485 GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~  544 (731)
                      +|+-+...-|-.++     |.++.||...+..      +|+++.+||.||.+-+.+.+++
T Consensus       261 eLSvRs~NcLkra~-----I~ti~dLv~~s~~------dLl~ikNfGkKSl~EI~~kL~~  309 (329)
T 3lu0_A          261 ELTVRSANCLKAEA-----IHYIGDLVQRTEV------ELLKTPNLGKKSLTEIKDVLAS  309 (329)
T ss_dssp             ------------------------------------------------------------
T ss_pred             CCCHHHHHHHHHCC-----CCCHHHHHHCCHH------HHHCCCCCCCCCHHHHHHHHHH
T ss_conf             27788886575718-----9189997647999------9955899762009999999997


No 171
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, structural genomics; HET: NAP; 2.25A {Homo sapiens}
Probab=55.01  E-value=5.8  Score=17.22  Aligned_cols=15  Identities=7%  Similarity=0.034  Sum_probs=8.1

Q ss_pred             EECCCCHHHHHHHHH
Q ss_conf             865986556669997
Q gi|254781172|r  152 ALRGDGHSGEDVSAC  166 (731)
Q Consensus       152 ~TRGdG~~GeDVT~n  166 (731)
                      +|=|.+-+|.-+...
T Consensus        50 VTGas~GIG~aiA~~   64 (346)
T 3kvo_A           50 ITGASRGIGKAIALK   64 (346)
T ss_dssp             EETTTSHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHH
T ss_conf             938576899999999


No 172
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A*
Probab=54.11  E-value=8.4  Score=15.98  Aligned_cols=27  Identities=15%  Similarity=0.415  Sum_probs=14.4

Q ss_pred             CCEEEEE-C--CCCCCC----HH-HHHHHHHHCCC
Q ss_conf             8669997-2--588998----78-99999998298
Q gi|254781172|r  649 NKKLVFT-G--TLQKIQ----RH-KAQEYVTQLGA  675 (731)
Q Consensus       649 gk~vV~T-G--tl~~~~----R~-e~~~~ie~~Gg  675 (731)
                      |-+|+|+ |  +|..|+    |- ..+++++++|.
T Consensus       404 gDvVLlSP~~aSfd~f~~~~~RG~~F~~~v~~l~~  438 (439)
T 2x5o_A          404 GDMVLLSPACASLDQFKNFEQRGNEFARLAKELGS  438 (439)
T ss_dssp             TCEEEECCSSBSTTTSSSHHHHHHHHHHHHHHHTC
T ss_pred             CCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             29999797440302327999999999999998606


No 173
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2
Probab=54.10  E-value=7.6  Score=16.28  Aligned_cols=16  Identities=13%  Similarity=0.111  Sum_probs=9.8

Q ss_pred             EEECCCCHHHHHHHHH
Q ss_conf             8865986556669997
Q gi|254781172|r  151 AALRGDGHSGEDVSAC  166 (731)
Q Consensus       151 a~TRGdG~~GeDVT~n  166 (731)
                      .+|=|.+-+|.-+...
T Consensus        22 lITGgs~GIG~aiA~~   37 (303)
T 1yxm_A           22 IVTGGATGIGKAIVKE   37 (303)
T ss_dssp             EEETTTSHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHH
T ss_conf             9938986899999999


No 174
>2hl7_A Cytochrome C-type biogenesis protein CCMH; three-helices bundle, oxidoreductase; HET: PG4; 1.70A {Pseudomonas aeruginosa}
Probab=52.66  E-value=4.5  Score=18.03  Aligned_cols=47  Identities=15%  Similarity=0.237  Sum_probs=27.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             43265775010337865445210100354344114466553321301231035410355556530576
Q gi|254781172|r  432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSED  499 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GLG~k~Ie~L~e~~~  499 (731)
                      -.||+|.+..+.                   +|.+.+.+.+..++-  -|=-+|..+.-|..++...|
T Consensus        27 lrCpvC~~qsI~-------------------~S~s~~A~dmr~~I~--~~i~~G~sd~eI~~~l~~rY   73 (84)
T 2hl7_A           27 LRCPKCQNQDIA-------------------DSNAPIAADLRKQIY--GQLQQGKSDGEIVDYMVARY   73 (84)
T ss_dssp             EECTTSSSCBTT-------------------TCCSHHHHHHHHHHH--HHHHHTCCHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCHH-------------------CCCCHHHHHHHHHHH--HHHHCCCCHHHHHHHHHHHC
T ss_conf             679887997550-------------------078789999999999--99996999999999999862


No 175
>3gqc_A DNA repair protein REV1; protein-DNA complex, alternative splicing, DNA damage, DNA repair, DNA synthesis; HET: DNA DOC DCP; 2.50A {Homo sapiens}
Probab=51.87  E-value=8.5  Score=15.92  Aligned_cols=48  Identities=19%  Similarity=0.272  Sum_probs=35.4

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             1035410355556530576540454101101067775310001000134210014568999
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS  541 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~s  541 (731)
                      =++-|+|.++.++|-..|     |.++.||..++...      |.+  .||.+.+..|++.
T Consensus       318 ~~lpGIG~~~~~kL~~lG-----I~Ti~DL~~l~~~~------L~~--~fG~k~g~~L~~~  365 (504)
T 3gqc_A          318 TNLPGVGHSMESKLASLG-----IKTCGDLQYMTMAK------LQK--EFGPKTGQMLYRF  365 (504)
T ss_dssp             GGSTTCCHHHHHHHHHTT-----CCBHHHHTTSCHHH------HHH--HHCHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHC-----CCCHHHHHCCCHHH------HHH--HHCCHHHHHHHHH
T ss_conf             344787878999998616-----85099985599999------998--8471789999996


No 176
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reductase; structural genomics, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}
Probab=51.51  E-value=7.1  Score=16.54  Aligned_cols=13  Identities=0%  Similarity=0.184  Sum_probs=4.7

Q ss_pred             CCHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254781172|r  102 WNIEDLRKFITRI  114 (731)
Q Consensus       102 ~~~~el~~w~~~~  114 (731)
                      .+.+++.++.+.+
T Consensus        67 ~~~~~v~~~~~~~   79 (255)
T 3icc_A           67 ESLHGVEALYSSL   79 (255)
T ss_dssp             TSHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHH
T ss_conf             9989999999999


No 177
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2
Probab=51.32  E-value=9.1  Score=15.69  Aligned_cols=13  Identities=23%  Similarity=0.238  Sum_probs=7.1

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +..+|.++++.|-
T Consensus       236 ~~iTGq~i~vDGG  248 (270)
T 1yde_A          236 NFCTGIELLVTGG  248 (270)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             8975864898979


No 178
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structural genomics, PSI; NMR {Pyrococcus furiosus dsm 3638} SCOP: a.4.5.82
Probab=51.18  E-value=3.7  Score=18.74  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=13.4

Q ss_pred             CCCCCCEEEECCCCCCCCCC
Q ss_conf             57873047770432657750
Q gi|254781172|r  421 RHPDAQPFSFPSFCPICQSR  440 (731)
Q Consensus       421 r~~~~~~~~~P~~CP~Cgs~  440 (731)
                      +..+.+-...|-.|-.||-.
T Consensus        57 kr~g~~L~v~Pp~CrkCGfv   76 (105)
T 2gmg_A           57 KREGMVLLIKPAQCRKCGFV   76 (105)
T ss_dssp             TTTTEEEEECCCBBTTTCCB
T ss_pred             HCCCCEEEEECHHHCCCCCE
T ss_conf             22895799879202308577


No 179
>1bdb_A CIS-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase; NAD-dependent oxidoreductase, short-chain alcohol dehydrogenase, PCB degradation; HET: NAD; 2.00A {Pseudomonas SP} SCOP: c.2.1.2
Probab=50.42  E-value=8.3  Score=15.99  Aligned_cols=13  Identities=15%  Similarity=0.210  Sum_probs=4.9

Q ss_pred             ECCCCHHHHHHHH
Q ss_conf             6598655666999
Q gi|254781172|r  153 LRGDGHSGEDVSA  165 (731)
Q Consensus       153 TRGdG~~GeDVT~  165 (731)
                      |=|.+-+|.-+..
T Consensus        11 TGas~GIG~aiA~   23 (277)
T 1bdb_A           11 TGGASGLGRALVD   23 (277)
T ss_dssp             ETTTSHHHHHHHH
T ss_pred             ECCCCHHHHHHHH
T ss_conf             4878799999999


No 180
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli}
Probab=50.22  E-value=9.5  Score=15.55  Aligned_cols=27  Identities=15%  Similarity=0.187  Sum_probs=11.5

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHCCCEEE
Q ss_conf             866999725889987899999998298499
Q gi|254781172|r  649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVS  678 (731)
Q Consensus       649 gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~  678 (731)
                      |-.|+|-|+-. |  ..+.+.+.+.-.|..
T Consensus       457 gDvVL~~Gsg~-i--~~~~~~l~e~~~k~~  483 (491)
T 2f00_A          457 NDLILVQGAGN-I--GKIARSLAEIKLKPQ  483 (491)
T ss_dssp             EEEEEEECSTT-H--HHHHHHHHHTTTCCC
T ss_pred             CCEEEEECCCC-H--HHHHHHHHHHHCCCC
T ss_conf             89999988998-8--899999999870745


No 181
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A
Probab=49.96  E-value=8.5  Score=15.92  Aligned_cols=15  Identities=20%  Similarity=0.279  Sum_probs=10.6

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       229 a~~itG~~i~vDGG~  243 (247)
T 1uzm_A          229 ASYISGAVIPVDGGM  243 (247)
T ss_dssp             GTTCCSCEEEESTTT
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             259768648879581


No 182
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2
Probab=49.95  E-value=8.8  Score=15.80  Aligned_cols=14  Identities=14%  Similarity=0.221  Sum_probs=10.1

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++.++|..+.+.|-
T Consensus       249 s~~itG~~i~vDGG  262 (267)
T 1iy8_A          249 ASYVNATVVPIDGG  262 (267)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEECCCC
T ss_conf             24967844775948


No 183
>1a87_A Colicin N; bacteriocin, toxin, pore-forming activity; 3.10A {Escherichia coli K12} SCOP: f.1.1.1
Probab=49.37  E-value=7.1  Score=16.52  Aligned_cols=23  Identities=35%  Similarity=0.533  Sum_probs=12.8

Q ss_pred             ECCEEEE-EEEEECCEEEEEEECCC
Q ss_conf             1581899-99985998998886598
Q gi|254781172|r  133 KIDGTMI-TIRYEKGKFVYAALRGD  156 (731)
Q Consensus       133 KiDG~si-sl~Y~~G~L~~a~TRGd  156 (731)
                      |+||++. ++.|+.|.++ ++||||
T Consensus        61 ~~~g~~~y~~~~~~~~~~-~v~~~d   84 (321)
T 1a87_A           61 SIKGTEVYTFHTRKGQYV-KVTVPD   84 (321)
T ss_dssp             EETTEEEEEEECSTTCEE-EEEEGG
T ss_pred             HCCCEEEEEEEECCCCEE-EEECCC
T ss_conf             036705788872377248-984378


No 184
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, short chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2
Probab=48.82  E-value=8.5  Score=15.92  Aligned_cols=12  Identities=25%  Similarity=0.368  Sum_probs=6.3

Q ss_pred             CCCCCCEEEEEC
Q ss_conf             821686699972
Q gi|254781172|r  645 SEIENKKLVFTG  656 (731)
Q Consensus       645 ~~l~gk~vV~TG  656 (731)
                      +..+|.++.+.|
T Consensus       260 ~~iTG~~i~VDG  271 (274)
T 1ja9_A          260 EWINGQVIKLTG  271 (274)
T ss_dssp             TTCCSCEEEEST
T ss_pred             CCCCCCEEEECC
T ss_conf             596686389678


No 185
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protein structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2
Probab=48.71  E-value=9.9  Score=15.40  Aligned_cols=15  Identities=20%  Similarity=0.231  Sum_probs=8.4

Q ss_pred             CCCCCCEEEEECCCC
Q ss_conf             821686699972588
Q gi|254781172|r  645 SEIENKKLVFTGTLQ  659 (731)
Q Consensus       645 ~~l~gk~vV~TGtl~  659 (731)
                      +..+|.++.+.|-+.
T Consensus       226 ~~itG~~i~vDGG~s  240 (263)
T 2a4k_A          226 AYITGQALYVDGGRS  240 (263)
T ss_dssp             TTCCSCEEEESTTTT
T ss_pred             CCCCCCEEEECCCCC
T ss_conf             696686699696906


No 186
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 2.30A {Agrobacterium tumefaciens str}
Probab=47.96  E-value=10  Score=15.30  Aligned_cols=14  Identities=7%  Similarity=0.109  Sum_probs=6.1

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +..+|.++.+.|-+
T Consensus       235 ~~iTG~~i~VDGG~  248 (259)
T 3edm_A          235 AYVTGACYDINGGV  248 (259)
T ss_dssp             TTCCSCEEEESBCS
T ss_pred             CCCCCCEEEECCCE
T ss_conf             59758789988777


No 187
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2
Probab=47.13  E-value=11  Score=15.21  Aligned_cols=15  Identities=27%  Similarity=0.264  Sum_probs=10.3

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       231 s~~itG~~i~VDGG~  245 (256)
T 2d1y_A          231 ASFITGAILPVDGGM  245 (256)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             249668778839365


No 188
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, ATP-binding cassette, cytoplasm; HET: ADP; 3.20A {Geobacillus stearothermophilus 10}
Probab=47.08  E-value=11  Score=15.20  Aligned_cols=15  Identities=0%  Similarity=-0.188  Sum_probs=9.3

Q ss_pred             CCCCHHHHHHHHHHH
Q ss_conf             886789999999996
Q gi|254781172|r  602 PLVGDIIAQAIVEFY  616 (731)
Q Consensus       602 ~GiG~~~A~si~~ff  616 (731)
                      .|........+.+.+
T Consensus       877 sGLD~~~~~~ll~lL  891 (972)
T 2r6f_A          877 TGLHVDDIARLLDVL  891 (972)
T ss_dssp             TTCCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHH
T ss_conf             677899999999999


No 189
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short- chain oxidoreductase, tetramer; 2.00A {Escherichia coli}
Probab=46.06  E-value=11  Score=15.13  Aligned_cols=15  Identities=27%  Similarity=0.364  Sum_probs=10.1

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       232 a~~itG~~i~VDGG~  246 (250)
T 2fwm_X          232 ASHITLQDIVVDGGS  246 (250)
T ss_dssp             GTTCCSCEEEESTTT
T ss_pred             HCCCCCEEEEECCCC
T ss_conf             359615578889572


No 190
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A
Probab=45.53  E-value=11  Score=15.03  Aligned_cols=16  Identities=13%  Similarity=0.281  Sum_probs=6.5

Q ss_pred             EEEEECCCCHHHHHHH
Q ss_conf             9998358702566541
Q gi|254781172|r  401 VLVKRAGEVIPKVVDI  416 (731)
Q Consensus       401 V~I~RaGdVIP~I~~V  416 (731)
                      +.+.++|+.-|.+.+-
T Consensus       159 ~~v~~~g~~~~~L~~~  174 (286)
T 3d8t_A          159 AALQLYGKPLPLLENA  174 (286)
T ss_dssp             EEEECSSSCCHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
T ss_conf             9997489882789999


No 191
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*
Probab=45.38  E-value=11  Score=15.01  Aligned_cols=14  Identities=21%  Similarity=0.304  Sum_probs=7.7

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       229 ~~itG~~i~VDGG~  242 (254)
T 1hdc_A          229 SYVTGAELAVDGGW  242 (254)
T ss_dssp             TTCCSCEEEESTTT
T ss_pred             CCCCCCEEEECCCC
T ss_conf             69778768879788


No 192
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A
Probab=45.19  E-value=11  Score=14.99  Aligned_cols=61  Identities=13%  Similarity=0.398  Sum_probs=33.6

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHH
Q ss_conf             68440768999835870256654101235787304777043265775010337865445210100354344114466553
Q gi|254781172|r  393 RDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERL  472 (731)
Q Consensus       393 ~~I~iGd~V~I~RaGdVIP~I~~Vi~~~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i  472 (731)
                      .-+++||.|.-.=.+   |.+   ...-+.++.-  +.-..||.|+..+...++.        +.|++   |-..-.+++
T Consensus       110 d~~~~GDiIrAkVi~---~~~---~LSt~~~~LG--Vv~a~c~~c~~~l~~~~~~--------~~C~~---cg~~e~RKv  170 (179)
T 3m7n_A          110 EAVGYLDILKARVIG---DNL---RLSTKEEEMG--VLRALCSNCKTEMVREGDI--------LKCPE---CGRVEKRKI  170 (179)
T ss_dssp             GTCCTTCEEEEEEEE---TTT---EEECCSTTCE--EEECBCTTTCCBCEECSSS--------EECSS---SCCEECCCB
T ss_pred             HHCCCCCEEEEEEEC---CCE---EEEECCCCCC--EEEEECCCCCCEEEEECCE--------EECCC---CCCEEEEEE
T ss_conf             741799889999936---857---9886288885--7999678778607770999--------99999---998783225


No 193
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural genomics consortium, SGC; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2
Probab=45.17  E-value=11  Score=15.12  Aligned_cols=15  Identities=13%  Similarity=0.333  Sum_probs=11.2

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       229 a~~itG~~i~vDGG~  243 (246)
T 2ag5_A          229 SAYVTGNPVIIDGGW  243 (246)
T ss_dssp             GTTCCSCEEEECTTG
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             379768548889661


No 194
>1vmc_A Stromal cell-derived factor 1; CXC-chemokine, cytokine; NMR {Homo sapiens} SCOP: d.9.1.1
Probab=45.15  E-value=3.9  Score=18.56  Aligned_cols=48  Identities=25%  Similarity=0.336  Sum_probs=27.0

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             73047770432657750103378654452101003543441144665533213
Q gi|254781172|r  424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFV  476 (731)
Q Consensus       424 ~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~  476 (731)
                      +++|+..-..|| |-+...... .....-...+.|+   +||-|++.++.+=-
T Consensus         2 ~~kpiSl~~Rc~-cr~~~s~vp-r~~i~~Lk~l~tp---nC~~qviArLK~nn   49 (71)
T 1vmc_A            2 DYKPVSLSYRCP-CRFFESHVA-RANVKHLKILNTP---NCALQIVARLKNNN   49 (71)
T ss_dssp             ---------CCS-CSSCBSSCC-GGGEEEEEEEEET---TTEEEEEEEETTTT
T ss_pred             CCCCCCHHHCCC-HHHHHCCCC-HHCCCCCCCCCCC---CCHHHHHHHHHCCC
T ss_conf             977402422043-033323474-2117446514599---96899999986188


No 195
>3h9i_A Cation efflux system protein CUSB; three-helix bundle, beta barrel, copper, copper transport, ION transport, transport, transport protein; 3.40A {Escherichia coli k-12} PDB: 3h94_A 3h9t_B
Probab=44.96  E-value=3.7  Score=18.72  Aligned_cols=12  Identities=8%  Similarity=0.290  Sum_probs=9.1

Q ss_pred             CCCCCCCEEEEE
Q ss_conf             684407689998
Q gi|254781172|r  393 RDIRVGDRVLVK  404 (731)
Q Consensus       393 ~~I~iGd~V~I~  404 (731)
                      ..+++|..+.+.
T Consensus       305 ~~L~pG~~v~v~  316 (407)
T 3h9i_A          305 EALKPGMNAWLQ  316 (407)
T ss_dssp             SCCCTTCEEEEE
T ss_pred             CCCCCCCEEEEE
T ss_conf             777999889999


No 196
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}
Probab=44.91  E-value=11  Score=14.96  Aligned_cols=13  Identities=23%  Similarity=0.243  Sum_probs=7.8

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +..+|.++.+.|-
T Consensus       259 ~~iTG~~i~VDGG  271 (277)
T 3gvc_A          259 SMITGTTQIADGG  271 (277)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             6966877998945


No 197
>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A
Probab=44.70  E-value=11  Score=14.94  Aligned_cols=21  Identities=14%  Similarity=0.219  Sum_probs=16.4

Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             787613888678999999999
Q gi|254781172|r  595 WLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       595 ~e~L~~I~GiG~~~A~si~~f  615 (731)
                      .+.|+.|+|||+.+|+.+.=|
T Consensus       209 ~~~L~~i~GIGpWTA~~ill~  229 (295)
T 2jhn_A          209 YEYLTSFKGIGRWTAELVLSI  229 (295)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHCCCCCHHHHHHHHHH
T ss_conf             889984599488999999998


No 198
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A
Probab=44.54  E-value=3.2  Score=19.25  Aligned_cols=51  Identities=8%  Similarity=-0.085  Sum_probs=20.4

Q ss_pred             HHHHHHCCCCCC---C--CEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHH
Q ss_conf             899997599665---4--1488740321134556655310011234376377731100
Q gi|254781172|r  258 LQKMRCLGFPVN---N--GVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS  310 (731)
Q Consensus       258 l~~L~~~GF~v~---~--~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~  310 (731)
                      .+....+++...   .  ....+.+.++.......+......-.+.++-+||  |++.
T Consensus       174 ~~i~~~~~~d~~~~l~~i~~~~~~~~e~~~~~l~~l~~~~~~~~~~i~LviI--DSi~  229 (343)
T 1v5w_A          174 RDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLII--DSIM  229 (343)
T ss_dssp             HHHHHHTTCCHHHHHHTEEEEECCSTTHHHHHHHHHHHHHHHSCSSEEEEEE--ETSG
T ss_pred             HHHHHHCCCCHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEE--CHHH
T ss_conf             9999860787677752341452176999998999999876530466404662--1134


No 199
>1k3x_A Endonuclease VIII; hydrolase/DNA; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A*
Probab=44.14  E-value=6  Score=17.09  Aligned_cols=10  Identities=30%  Similarity=0.760  Sum_probs=6.0

Q ss_pred             CCCCCCCCCC
Q ss_conf             2657750103
Q gi|254781172|r  434 CPICQSRVVR  443 (731)
Q Consensus       434 CP~Cgs~l~~  443 (731)
                      ||.||+++.+
T Consensus       237 C~~Cg~~I~~  246 (262)
T 1k3x_A          237 CERCGSIIEK  246 (262)
T ss_dssp             CTTTCCBCEE
T ss_pred             CCCCCCEEEE
T ss_conf             9999988999


No 200
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11
Probab=43.92  E-value=3.7  Score=18.73  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=6.6

Q ss_pred             EEECCCCHHHHHH
Q ss_conf             9835870256654
Q gi|254781172|r  403 VKRAGEVIPKVVD  415 (731)
Q Consensus       403 I~RaGdVIP~I~~  415 (731)
                      |.|++.|.|++..
T Consensus       120 V~~~s~v~~~~~~  132 (279)
T 1ltl_A          120 VRKTDEIRPRIVK  132 (279)
T ss_dssp             EEEECCCEEEEEE
T ss_pred             EEECCCEEEEEEE
T ss_conf             9976765789999


No 201
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1
Probab=43.90  E-value=9.9  Score=15.40  Aligned_cols=12  Identities=25%  Similarity=0.451  Sum_probs=5.6

Q ss_pred             CEEEEEEEEEEE
Q ss_conf             504899999985
Q gi|254781172|r  183 EIIEVRGEVYIS  194 (731)
Q Consensus       183 ~~ieiRGEv~m~  194 (731)
                      +...++|++++.
T Consensus       248 GT~v~~G~~~~~  259 (920)
T 1mhs_A          248 SSAVKRGEAFVV  259 (920)
T ss_dssp             CBCCSCCCEEEE
T ss_pred             CEEEEEEEEEEE
T ss_conf             205853369999


No 202
>3ndi_A Methyltransferase; S-adenosylmethionine, kijanose, tetronitrose, tetradeoxysuga micromonospora chalcea, TCAB9, SUGA methylation; HET: SAM TMP; 1.50A {Micromonospora chalcea} PDB: 3ndj_A*
Probab=43.67  E-value=5  Score=17.74  Aligned_cols=17  Identities=12%  Similarity=-0.078  Sum_probs=8.3

Q ss_pred             HHHHHHHH---HHCCCEEEE
Q ss_conf             78999999---982984998
Q gi|254781172|r  663 RHKAQEYV---TQLGAVVSA  679 (731)
Q Consensus       663 R~e~~~~i---e~~Ggkv~s  679 (731)
                      .+|+.+.+   -..||+...
T Consensus       389 ~~EI~~~~~~~~~~g~k~i~  408 (416)
T 3ndi_A          389 AEEIMAKEQEFHQAGGRWIL  408 (416)
T ss_dssp             HHHHHHHCHHHHHTTCEEEE
T ss_pred             HHHHHHHHHHHHHCCCEEEE
T ss_conf             99999999999856999999


No 203
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*
Probab=43.64  E-value=12  Score=14.82  Aligned_cols=14  Identities=21%  Similarity=0.197  Sum_probs=9.6

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++.++|.++.+.|-
T Consensus       227 a~~itG~~i~vDGG  240 (244)
T 3d3w_A          227 SGMTTGSTLPVEGG  240 (244)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             26976887887924


No 204
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus}
Probab=43.37  E-value=5  Score=17.71  Aligned_cols=14  Identities=36%  Similarity=0.750  Sum_probs=10.1

Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             04326577501033
Q gi|254781172|r  431 PSFCPICQSRVVRD  444 (731)
Q Consensus       431 P~~CP~Cgs~l~~~  444 (731)
                      -..||.||+.+.|.
T Consensus         8 MakCPlCG~~ldW~   21 (95)
T 2k5c_A            8 MAKCPICGSPLKWE   21 (95)
T ss_dssp             CEECSSSCCEECHH
T ss_pred             HHCCCCCCCCCCHH
T ss_conf             42388678826799


No 205
>3i1j_A Oxidoreductase, short chain dehydrogenase/reductase family; dimer, mixed alpha-beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV}
Probab=43.29  E-value=12  Score=14.79  Aligned_cols=14  Identities=7%  Similarity=0.019  Sum_probs=5.9

Q ss_pred             EECCCCHHHHHHHH
Q ss_conf             86598655666999
Q gi|254781172|r  152 ALRGDGHSGEDVSA  165 (731)
Q Consensus       152 ~TRGdG~~GeDVT~  165 (731)
                      +|=|.+-+|.-+..
T Consensus        19 ITGas~GIG~aiA~   32 (247)
T 3i1j_A           19 VTGAARGIGAAAAR   32 (247)
T ss_dssp             ESSTTSHHHHHHHH
T ss_pred             EECCCCHHHHHHHH
T ss_conf             96847599999999


No 206
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2
Probab=43.25  E-value=12  Score=14.78  Aligned_cols=13  Identities=31%  Similarity=0.330  Sum_probs=7.7

Q ss_pred             CCCCCCCEEEEEC
Q ss_conf             8821686699972
Q gi|254781172|r  644 SSEIENKKLVFTG  656 (731)
Q Consensus       644 ~~~l~gk~vV~TG  656 (731)
                      ++.++|.++.+.|
T Consensus       249 a~~itG~~i~vDG  261 (262)
T 1zem_A          249 SSFMTGVNLPIAG  261 (262)
T ss_dssp             GTTCCSCEEEESC
T ss_pred             HCCCCCCEEEECC
T ss_conf             2596685688289


No 207
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A
Probab=43.24  E-value=8  Score=16.11  Aligned_cols=22  Identities=23%  Similarity=0.685  Sum_probs=15.0

Q ss_pred             CCCCEEEECCCCCCCCCCCCCC
Q ss_conf             8730477704326577501033
Q gi|254781172|r  423 PDAQPFSFPSFCPICQSRVVRD  444 (731)
Q Consensus       423 ~~~~~~~~P~~CP~Cgs~l~~~  444 (731)
                      ..-..+.+-+.||.||+++..-
T Consensus        10 ~~C~~YTL~~~Cp~CG~~t~~a   31 (60)
T 2apo_B           10 PKCGLYTLKEICPKCGEKTVIP   31 (60)
T ss_dssp             TTTCCEESSSBCSSSCSBCBCC
T ss_pred             CCCCCEECCCCCCCCCCCCCCC
T ss_conf             7466653545376787846767


No 208
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii OT3}
Probab=42.69  E-value=12  Score=14.72  Aligned_cols=44  Identities=30%  Similarity=0.513  Sum_probs=32.1

Q ss_pred             CCHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEEC
Q ss_conf             0003689999759966541488740321134556655310011234376377731
Q gi|254781172|r  253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD  307 (731)
Q Consensus       253 ~~~e~l~~L~~~GF~v~~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn  307 (731)
                      +.++..+.|+..|++|++. ..+.+.+++....+++       +|+   +|+|.-
T Consensus        21 ~E~qak~lL~~~GIpvP~~-~~~~s~~ea~~~a~~i-------g~P---vVlK~~   64 (238)
T 1wr2_A           21 VEYEAKQVLKAYGLPVPEE-KLAKTLDEALEYAKEI-------GYP---VVLKLM   64 (238)
T ss_dssp             CHHHHHHHHHTTTCCCCCC-EEESSHHHHHHHHHHH-------CSS---EEEEEE
T ss_pred             CHHHHHHHHHHCCCCCCCC-CEECCHHHHHHHHHHC-------CCC---EEEEEE
T ss_conf             9999999999769999995-1769999999999981-------997---899984


No 209
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}
Probab=42.44  E-value=12  Score=14.69  Aligned_cols=13  Identities=15%  Similarity=0.248  Sum_probs=7.9

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++.+.|-
T Consensus       263 ~~iTG~~i~VDGG  275 (279)
T 3ctm_A          263 TFTTGSDVVIDGG  275 (279)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             5966845886878


No 210
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolidine carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis H37RV} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 2aqh_A* 2aqk_A* ...
Probab=42.09  E-value=12  Score=14.66  Aligned_cols=15  Identities=7%  Similarity=0.005  Sum_probs=10.2

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      .+..+|.++.+-|-+
T Consensus       250 a~~iTG~~i~VDGG~  264 (269)
T 2h7i_A          250 LPATTGDIIYADGGA  264 (269)
T ss_dssp             CTTCCSEEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             269368888889484


No 211
>1k2w_A Sorbitol dehydrogenase; short-chain dehydrogenase, enzyme, oxidoreductase; 2.40A {Rhodobacter sphaeroides} SCOP: c.2.1.2
Probab=42.06  E-value=10  Score=15.24  Aligned_cols=14  Identities=14%  Similarity=0.138  Sum_probs=8.9

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|..+.+.|-
T Consensus       239 s~~iTG~~i~vDGG  252 (256)
T 1k2w_A          239 ADYIVAQTYNVDGG  252 (256)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCH
T ss_conf             35966852887860


No 212
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A
Probab=42.01  E-value=12  Score=14.65  Aligned_cols=15  Identities=20%  Similarity=0.228  Sum_probs=8.7

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       234 s~~itG~~i~VDGG~  248 (251)
T 1zk4_A          234 SKFATGSEFVVDGGY  248 (251)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             259668778879344


No 213
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 1mg5_A*
Probab=41.95  E-value=12  Score=14.64  Aligned_cols=12  Identities=33%  Similarity=0.329  Sum_probs=4.0

Q ss_pred             ECCCCHHHHHHH
Q ss_conf             659865566699
Q gi|254781172|r  153 LRGDGHSGEDVS  164 (731)
Q Consensus       153 TRGdG~~GeDVT  164 (731)
                      |=|.+-+|.-+.
T Consensus        11 TGas~GIG~aiA   22 (254)
T 1sby_A           11 VAALGGIGLDTS   22 (254)
T ss_dssp             ETTTSHHHHHHH
T ss_pred             ECCCCHHHHHHH
T ss_conf             538888999999


No 214
>1jx4_A DNA polymerase IV (family Y); protein-DNA complex, Y-family, transferase/DNA complex; HET: DNA MSE ADI; 1.70A {Sulfolobus solfataricus} SCOP: d.240.1.1 e.8.1.7 PDB: 1jxl_A* 1n48_A* 1n56_A* 1ryr_A* 1rys_A* 1s0m_A* 1s0n_A* 1s0o_A* 1s10_A* 1s97_A* 1s9f_A* 2ia6_A* 2ibk_A* 2r8g_A* 2r8h_A* 2r8i_A* 2rdj_A* 3fds_A* 3m9m_B* 3m9n_B* ...
Probab=41.44  E-value=9.9  Score=15.40  Aligned_cols=46  Identities=15%  Similarity=0.299  Sum_probs=29.4

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             03541035555653057654045410110106777531000100013421001456899
Q gi|254781172|r  482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD  540 (731)
Q Consensus       482 dI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~  540 (731)
                      ++-|+|+++.++|-..|     |+++.||..+....      |.+  .||++.+..+++
T Consensus       182 ~l~Gig~~~~~~L~~~G-----i~ti~dl~~~~~~~------L~~--~fG~~~~~~l~~  227 (352)
T 1jx4_A          182 DVPGIGNITAEKLKKLG-----INKLVDTLSIEFDK------LKG--MIGEAKAKYLIS  227 (352)
T ss_dssp             GSTTCCHHHHHHHHTTT-----CCBGGGGGSSCHHH------HHH--HHCHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHC-----CCCHHHHHCCCHHH------HHH--HHCHHHHHHHHH
T ss_conf             41488704688999846-----86825413279789------997--858487999999


No 215
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}
Probab=41.36  E-value=10  Score=15.34  Aligned_cols=17  Identities=18%  Similarity=0.293  Sum_probs=12.5

Q ss_pred             CCCCCCCCCCCCCCCCC
Q ss_conf             04326577501033786
Q gi|254781172|r  431 PSFCPICQSRVVRDLNP  447 (731)
Q Consensus       431 P~~CP~Cgs~l~~~~~~  447 (731)
                      ...||.||--|.|+...
T Consensus       222 i~~C~~CgRiL~~~~~~  238 (256)
T 3na7_A          222 MITCPYCGRILYAEGAY  238 (256)
T ss_dssp             CEECTTTCCEEECSCC-
T ss_pred             EEECCCCCCEEEECCCC
T ss_conf             04898999778506634


No 216
>1wpg_A Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; membrane protein, P-type ATPase, HAD fold, hydrolase; HET: ADP TG1; 2.30A {Oryctolagus cuniculus} SCOP: b.82.7.1 c.108.1.7 d.220.1.1 f.33.1.1 PDB: 1kju_A 1iwo_A 1t5s_A* 1t5t_A* 1vfp_A* 1su4_A* 1xp5_A* 2agv_A* 2by4_A* 2c88_A* 2c8k_A* 2c8l_A* 2c9m_A 2o9j_A* 2oa0_A* 3b9b_A 3b9r_A* 3fgo_A* 3fpb_A* 3fps_A* ...
Probab=41.34  E-value=9.7  Score=15.49  Aligned_cols=13  Identities=8%  Similarity=-0.135  Sum_probs=6.7

Q ss_pred             CCEEEEEEEEEEE
Q ss_conf             5504899999985
Q gi|254781172|r  182 PEIIEVRGEVYIS  194 (731)
Q Consensus       182 ~~~ieiRGEv~m~  194 (731)
                      .+...++|+..+.
T Consensus       210 ~gT~v~~G~~~~~  222 (994)
T 1wpg_A          210 SGTNIAAGKALGI  222 (994)
T ss_dssp             TTCEEEECEEEEE
T ss_pred             EEEEECCCCEEEE
T ss_conf             5048714754799


No 217
>1tdz_A Formamidopyrimidine-DNA glycosylase; DNA repair, FPG, MUTM, FAPY G, hydrolase/DNA complex; HET: FOX; 1.80A {Lactococcus lactis} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1pji_A* 1pm5_A* 1xc8_A* 3c58_A* 1nnj_A 1kfv_A 1pjj_A*
Probab=41.32  E-value=7.1  Score=16.55  Aligned_cols=11  Identities=18%  Similarity=0.667  Sum_probs=5.7

Q ss_pred             CCCCCCCCCCC
Q ss_conf             26577501033
Q gi|254781172|r  434 CPICQSRVVRD  444 (731)
Q Consensus       434 CP~Cgs~l~~~  444 (731)
                      ||-||+++.+.
T Consensus       246 Cp~Cg~~I~~~  256 (272)
T 1tdz_A          246 CSRCGAEIQKI  256 (272)
T ss_dssp             CTTTCCBCEEE
T ss_pred             CCCCCCEEEEE
T ss_conf             99999989999


No 218
>2zkr_y 60S ribosomal protein L32; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 2zkr_9
Probab=41.06  E-value=4.6  Score=17.97  Aligned_cols=57  Identities=14%  Similarity=0.164  Sum_probs=37.2

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHHH-HHHHHHHHCCCCCCEEEEEHHHHCCH
Q ss_conf             210100354344114466553321301231035410-35555653057654045410110106
Q gi|254781172|r  452 LVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG-KQQLDFFFKSEDPAFSIRIPADIFTL  513 (731)
Q Consensus       452 ~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GLG-~k~Ie~L~e~~~~~g~I~~~~DLy~L  513 (731)
                      ....||.+.+.++.-  -.   +|-++..|---|.| ++.+.-|.-.|+...+|.++.||-.|
T Consensus        31 l~~~WRkPrGidnk~--R~---~~kg~~~~p~iGYgs~k~~Rgl~psG~~~~lV~N~~dLe~L   88 (135)
T 2zkr_y           31 IKRNWRKPRGIDNRV--RR---RFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVL   88 (135)
T ss_dssp             SCC-CCCCCCSSCTT--TC---C-CCSCCCSCTTSCCCTTCC---------------------
T ss_pred             CCCCCCCCCCCCCCC--CC---CCCCCCCCCCCCCCCCHHHCCCCCCCCEEEEECCHHHHHHH
T ss_conf             553443788987640--15---13686688755667666553658687879986688898998


No 219
>3gpu_A DNA glycosylase; DNA glycosylase, DNA repair, damage search, base extrusion; HET: DNA 8OG; 1.62A {Geobacillus stearothermophilus} PDB: 3gpx_A* 3gq3_A* 3go8_A* 2f5n_A 2f5o_A 2f5p_A 3gp1_A* 3gq4_A* 3gpy_A* 3gq5_A* 3gpp_A* 2f5q_A* 2f5s_A* 1l1z_A* 1l1t_A* 1l2b_A* 1l2c_A* 1l2d_A* 1r2z_A* 1r2y_A* ...
Probab=40.87  E-value=7.2  Score=16.46  Aligned_cols=22  Identities=18%  Similarity=0.514  Sum_probs=11.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             26577501033786544521010035
Q gi|254781172|r  434 CPICQSRVVRDLNPKTGKLVAAHRCT  459 (731)
Q Consensus       434 CP~Cgs~l~~~~~~~~~~~~~~~rC~  459 (731)
                      ||.||+++++..-.    .-..++|+
T Consensus       231 C~~Cg~~I~~~~~~----gR~t~~Cp  252 (256)
T 3gpu_A          231 CKRCGTPIEKTVVA----GRGTHYCP  252 (256)
T ss_dssp             CTTTCCBCEEEEET----TEEEEECT
T ss_pred             CCCCCCEEEEEEEC----CCCEEECC
T ss_conf             79999989999999----98209871


No 220
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.10A {Pseudomonas aeruginosa PAO1} SCOP: e.59.1.1
Probab=40.73  E-value=6.2  Score=16.98  Aligned_cols=11  Identities=36%  Similarity=0.936  Sum_probs=7.3

Q ss_pred             CCCCCCCCCCC
Q ss_conf             04326577501
Q gi|254781172|r  431 PSFCPICQSRV  441 (731)
Q Consensus       431 P~~CP~Cgs~l  441 (731)
                      ..+||+||+.=
T Consensus       182 ~g~CPvCGs~P  192 (309)
T 2fiy_A          182 RTLCPACGSPP  192 (309)
T ss_dssp             CSSCTTTCCCE
T ss_pred             CCCCCCCCCCC
T ss_conf             99499999803


No 221
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase/structural protein complex; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B
Probab=40.65  E-value=8.6  Score=15.87  Aligned_cols=21  Identities=14%  Similarity=0.583  Sum_probs=14.9

Q ss_pred             CCCEEEECCCCCCCCCCCCCC
Q ss_conf             730477704326577501033
Q gi|254781172|r  424 DAQPFSFPSFCPICQSRVVRD  444 (731)
Q Consensus       424 ~~~~~~~P~~CP~Cgs~l~~~  444 (731)
                      .-..+.+-+.||.||+++..-
T Consensus        10 ~C~~YTLk~~CP~CG~~t~~a   30 (60)
T 2aus_D           10 KCGRYTLKETCPVCGEKTKVA   30 (60)
T ss_dssp             TTCCEESSSBCTTTCSBCEES
T ss_pred             CCCCEECCCCCCCCCCCCCCC
T ss_conf             466663556376787855767


No 222
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} SCOP: b.171.1.1
Probab=40.47  E-value=8.8  Score=15.82  Aligned_cols=15  Identities=27%  Similarity=0.713  Sum_probs=12.1

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             326577501033786
Q gi|254781172|r  433 FCPICQSRVVRDLNP  447 (731)
Q Consensus       433 ~CP~Cgs~l~~~~~~  447 (731)
                      .||.|+++|.++...
T Consensus        10 ~CP~ck~~L~~~~~~   24 (69)
T 2pk7_A           10 ACPICKGPLKLSADK   24 (69)
T ss_dssp             CCTTTCCCCEECTTS
T ss_pred             CCCCCCCEEEEECCC
T ss_conf             687999970696889


No 223
>3bqs_A Uncharacterized protein; 10114F, NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.42A {Listeria monocytogenes str} PDB: 3bqt_A 3mab_A
Probab=40.31  E-value=13  Score=14.46  Aligned_cols=28  Identities=18%  Similarity=0.302  Sum_probs=20.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCC
Q ss_conf             310354103555565305765404541011010
Q gi|254781172|r  480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFT  512 (731)
Q Consensus       480 aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~  512 (731)
                      --++.++|+++.+.|...|     |.++.||-.
T Consensus         6 L~~LPNig~~~e~~L~~iG-----I~~~~~L~~   33 (93)
T 3bqs_A            6 LSELPNIGKVLEQDLIKAG-----IKTPVELKD   33 (93)
T ss_dssp             GGGSTTCCHHHHHHHHHTT-----CCSHHHHHH
T ss_pred             HHHCCCCCHHHHHHHHHCC-----CCCHHHHHH
T ss_conf             7248999999999999939-----998999986


No 224
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A
Probab=40.25  E-value=13  Score=14.45  Aligned_cols=15  Identities=13%  Similarity=0.211  Sum_probs=11.0

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       238 a~~iTG~~i~vDGG~  252 (255)
T 2q2v_A          238 GSQVRGAAWNVDGGW  252 (255)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             269768669989472


No 225
>2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens}
Probab=39.79  E-value=8.5  Score=15.91  Aligned_cols=25  Identities=24%  Similarity=0.383  Sum_probs=18.0

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHCCC
Q ss_conf             684407689998358702566541012
Q gi|254781172|r  393 RDIRVGDRVLVKRAGEVIPKVVDIIVN  419 (731)
Q Consensus       393 ~~I~iGd~V~I~RaGdVIP~I~~Vi~~  419 (731)
                      ..|.+||.|.| ++||.|| +-+++.+
T Consensus        40 ~~l~~GDii~v-~~G~~vP-~Dg~vi~   64 (124)
T 2kij_A           40 ELVQRGDIIKV-VPGGKFP-VDGRVIE   64 (124)
T ss_dssp             TTCCTTCEEEC-CTTCBCS-SCEEECS
T ss_pred             HHCCCCCEEEE-CCCCEEE-EEEEEEE
T ss_conf             99786999999-9999986-5179994


No 226
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor}
Probab=39.58  E-value=9.2  Score=15.65  Aligned_cols=15  Identities=20%  Similarity=0.536  Sum_probs=11.8

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             326577501033786
Q gi|254781172|r  433 FCPICQSRVVRDLNP  447 (731)
Q Consensus       433 ~CP~Cgs~l~~~~~~  447 (731)
                      .||.|+++|+++..+
T Consensus        12 ~CP~ck~~L~~~~~~   26 (56)
T 2kpi_A           12 ACPACHAPLEERDAE   26 (56)
T ss_dssp             CCSSSCSCEEEETTE
T ss_pred             CCCCCCCCCEECCCC
T ss_conf             388999945182876


No 227
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} SCOP: b.171.1.1
Probab=39.56  E-value=8.8  Score=15.81  Aligned_cols=16  Identities=31%  Similarity=0.777  Sum_probs=12.5

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             4326577501033786
Q gi|254781172|r  432 SFCPICQSRVVRDLNP  447 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~  447 (731)
                      -.||.|+++|.++...
T Consensus         9 L~CP~ck~~L~~~~~~   24 (68)
T 2hf1_A            9 LVCPLCKGPLVFDKSK   24 (68)
T ss_dssp             CBCTTTCCBCEEETTT
T ss_pred             HCCCCCCCEEEEECCC
T ss_conf             3687989861792889


No 228
>2hu9_A MERP, mercuric transport protein periplasmic component; copper chaperone, iron-sufur protein, COPZ, ATX1, ATOX1, metal transport; 1.78A {Archaeoglobus fulgidus}
Probab=39.40  E-value=12  Score=14.87  Aligned_cols=37  Identities=22%  Similarity=0.267  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCCCC----------CCCCCCCCEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             3265775010337----------8654452101003543441144665533213
Q gi|254781172|r  433 FCPICQSRVVRDL----------NPKTGKLVAAHRCTGGLACSAQQLERLKHFV  476 (731)
Q Consensus       433 ~CP~Cgs~l~~~~----------~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~  476 (731)
                      .||.||.+-....          .....-....++|+|+ +|+      +.||-
T Consensus         3 ~CP~Cg~~G~~V~~~Tvk~ll~~~~~~~l~~~yyfC~n~-~C~------VVYf~   49 (130)
T 2hu9_A            3 RCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLE-SCE------VVYFN   49 (130)
T ss_dssp             BCTTTCCBCEEECHHHHHHHBCGGGGGGCCSCEEECCCT-TCS------EEEEC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCC-CCC------EEEEC
T ss_conf             588888767484188999986578885127977876899-998------89977


No 229
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491}
Probab=39.28  E-value=8.9  Score=15.76  Aligned_cols=16  Identities=19%  Similarity=0.517  Sum_probs=12.3

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             4326577501033786
Q gi|254781172|r  432 SFCPICQSRVVRDLNP  447 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~  447 (731)
                      -.||.|+++|.++...
T Consensus         9 L~CP~ck~~L~~~~~~   24 (68)
T 2jr6_A            9 LVCPVTKGRLEYHQDK   24 (68)
T ss_dssp             CBCSSSCCBCEEETTT
T ss_pred             HCCCCCCCEEEEECCC
T ss_conf             0787989872896889


No 230
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2
Probab=39.23  E-value=14  Score=14.34  Aligned_cols=12  Identities=25%  Similarity=0.277  Sum_probs=6.2

Q ss_pred             CCCCCEEEEECC
Q ss_conf             216866999725
Q gi|254781172|r  646 EIENKKLVFTGT  657 (731)
Q Consensus       646 ~l~gk~vV~TGt  657 (731)
                      ..+|.++.+.|-
T Consensus       250 ~itG~~i~VDGG  261 (280)
T 1xkq_A          250 YILGQSIVADGG  261 (280)
T ss_dssp             TCCSCEEEESTT
T ss_pred             CCCCCEEEECCC
T ss_conf             812825784959


No 231
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase; 2.09A {Bartonella henselae str} PDB: 3enn_A 3emk_A
Probab=39.06  E-value=14  Score=14.32  Aligned_cols=15  Identities=13%  Similarity=0.357  Sum_probs=10.0

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++++.|-+
T Consensus       249 s~~iTG~~i~VdGG~  263 (266)
T 3grp_A          249 AAYLTGQTLHINGGM  263 (266)
T ss_dssp             GTTCCSCEEEESTTC
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             259768659979781


No 232
>3imf_A Short chain dehydrogenase; structural genomics, infectious diseases, center for structural genomics of infectious diseases, oxidoreductase; HET: MSE; 1.99A {Bacillus anthracis str}
Probab=39.03  E-value=13  Score=14.51  Aligned_cols=14  Identities=14%  Similarity=0.223  Sum_probs=7.5

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       237 ~~itG~~i~VDGG~  250 (257)
T 3imf_A          237 AYINGTCMTMDGGQ  250 (257)
T ss_dssp             TTCCSCEEEESTTT
T ss_pred             CCCCCCEEEECCCH
T ss_conf             59768658879791


No 233
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*
Probab=38.51  E-value=14  Score=14.26  Aligned_cols=16  Identities=13%  Similarity=0.144  Sum_probs=8.3

Q ss_pred             EEECCCCHHHHHHHHH
Q ss_conf             8865986556669997
Q gi|254781172|r  151 AALRGDGHSGEDVSAC  166 (731)
Q Consensus       151 a~TRGdG~~GeDVT~n  166 (731)
                      .+|=|.+-+|.-+...
T Consensus        30 lVTGgs~GIG~aiA~~   45 (302)
T 1w6u_A           30 FITGGGTGLGKGMTTL   45 (302)
T ss_dssp             EEETTTSHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHH
T ss_conf             9937986899999999


No 234
>2riq_A Poly [ADP-ribose] polymerase 1; Zn-binding domain, Zn ribbon, Zn finger, ADP-ribosylation, DNA damage, DNA repair, DNA-binding, glycosyltransferase; 1.70A {Homo sapiens} PDB: 2jvn_A
Probab=38.38  E-value=6.8  Score=16.66  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999984331
Q gi|254781172|r   20 ELSSLEQEISYHDDCYYQ   37 (731)
Q Consensus        20 ~i~~L~~~i~~~~~~Yy~   37 (731)
                      .-.++.+.++..+.++|.
T Consensus        16 ~~~~~e~~lk~Q~~~lw~   33 (160)
T 2riq_A           16 KDSKLEKALKAQNDLIWN   33 (160)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHH
T ss_conf             207888879999999999


No 235
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*
Probab=38.24  E-value=14  Score=14.23  Aligned_cols=17  Identities=18%  Similarity=0.309  Sum_probs=7.2

Q ss_pred             HCCCHHHHHHHHHHHHH
Q ss_conf             15999999999999998
Q gi|254781172|r  100 KIWNIEDLRKFITRIYR  116 (731)
Q Consensus       100 k~~~~~el~~w~~~~~~  116 (731)
                      ++.+.+++..+.+.+.+
T Consensus        72 Dvt~~~~v~~~~~~~~~   88 (278)
T 2bgk_A           72 DVTKDEDVRNLVDTTIA   88 (278)
T ss_dssp             CTTCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             78999999999999999


No 236
>3bq0_A POL IV, DBH, DNA polymerase IV; Y-family, lesion bypass; HET: DNA; 2.60A {Sulfolobus acidocaldarius} SCOP: d.240.1.1 e.8.1.7 PDB: 3bq1_A* 3bq2_A* 1k1q_A 1k1s_A
Probab=38.23  E-value=12  Score=14.78  Aligned_cols=46  Identities=20%  Similarity=0.227  Sum_probs=29.0

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             03541035555653057654045410110106777531000100013421001456899
Q gi|254781172|r  482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD  540 (731)
Q Consensus       482 dI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~  540 (731)
                      ++-|+|+++.++|-..|     |+++.||..+....      |.+  .||.+....|++
T Consensus       183 ~l~GiG~~~~~~L~~~G-----i~t~~dl~~~~~~~------l~~--~fG~~~g~~l~~  228 (354)
T 3bq0_A          183 EIPGIGSVLARRLNELG-----IQKLRDILSKNYNE------LEK--ITGKAKALYLLK  228 (354)
T ss_dssp             TSTTCCHHHHHHHTTTT-----CCBGGGGGGSCHHH------HHH--HHCHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHHHCC-----CCCHHHHHCCCHHH------HHH--HHCHHHHHHHHH
T ss_conf             61596478999999818-----96999954589878------998--848178899999


No 237
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A*
Probab=38.08  E-value=14  Score=14.21  Aligned_cols=16  Identities=19%  Similarity=0.254  Sum_probs=9.8

Q ss_pred             CCCCCCCEEEEECCCC
Q ss_conf             8821686699972588
Q gi|254781172|r  644 SSEIENKKLVFTGTLQ  659 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~  659 (731)
                      ++.++|.++.+.|-+.
T Consensus       236 a~~itG~~i~vDGG~~  251 (261)
T 1gee_A          236 ASYVTGITLFADGGMT  251 (261)
T ss_dssp             GTTCCSCEEEESTTGG
T ss_pred             HCCCCCCEEEECCCEE
T ss_conf             2696687699798836


No 238
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*
Probab=38.01  E-value=14  Score=14.21  Aligned_cols=15  Identities=27%  Similarity=0.326  Sum_probs=9.2

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       242 s~~iTG~~i~VDGG~  256 (260)
T 2zat_A          242 ASYITGETVVVGGGT  256 (260)
T ss_dssp             GTTCCSCEEEESTTC
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             269668578879455


No 239
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B}
Probab=38.01  E-value=14  Score=14.21  Aligned_cols=14  Identities=7%  Similarity=0.140  Sum_probs=7.0

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       246 ~~iTG~~i~VDGG~  259 (271)
T 3ek2_A          246 SGVTAEVMHVDSGF  259 (271)
T ss_dssp             TTCCSEEEEESTTG
T ss_pred             CCCCCCEEEECCCH
T ss_conf             69566288989686


No 240
>1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A
Probab=37.84  E-value=14  Score=14.19  Aligned_cols=62  Identities=13%  Similarity=0.104  Sum_probs=27.1

Q ss_pred             HHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHH--HHHHHHHHCCHH
Q ss_conf             3555565305765404541011010677753100010001342100145689999875223--466677630101
Q gi|254781172|r  488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI--SLERFIFSLGIR  560 (731)
Q Consensus       488 ~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~--~L~r~L~ALGI~  560 (731)
                      ...++.|.+.    |.|..-.+++.|..+..       .++.-.++..++|.+.++++.-.  .+..+.-.+|++
T Consensus       107 ~~lL~~L~~~----g~l~~~~~~v~l~~~~~-------~l~~~~~~~~~~i~~~l~~~g~~pp~~~el~~~l~~~  170 (258)
T 1lva_A          107 QALLEEWSRE----GRLQLAANTVALAGFTP-------SFSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLD  170 (258)
T ss_dssp             HHHHHHHHHT----TSEEEETTEEEETTCCC-------CCCHHHHHHHHHHHHHHHHHTTSCCBHHHHHHHTTCC
T ss_pred             HHHHHHHHHC----CCEEEECCEEECCCCCC-------CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCC
T ss_conf             9999999868----98798699997578777-------7899999999999999997699999889999894989


No 241
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}
Probab=37.76  E-value=14  Score=14.21  Aligned_cols=15  Identities=27%  Similarity=0.348  Sum_probs=9.8

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       231 a~~itG~~i~vDGG~  245 (247)
T 2hq1_A          231 SNYITGQVINIDGGL  245 (247)
T ss_dssp             GTTCCSCEEEESTTC
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             169768869969687


No 242
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2
Probab=37.71  E-value=14  Score=14.17  Aligned_cols=14  Identities=7%  Similarity=0.131  Sum_probs=10.1

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|.++.+.|-
T Consensus       227 s~~itG~~i~VDGG  240 (244)
T 1cyd_A          227 SASTSGGGILVDAG  240 (244)
T ss_dssp             GTTCCSSEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             26967834895832


No 243
>3ijr_A Oxidoreductase, short chain dehydrogenase/reductase family; structural genomics, infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*
Probab=37.67  E-value=14  Score=14.17  Aligned_cols=15  Identities=33%  Similarity=0.388  Sum_probs=8.0

Q ss_pred             EECCCCHHHHHHHHH
Q ss_conf             865986556669997
Q gi|254781172|r  152 ALRGDGHSGEDVSAC  166 (731)
Q Consensus       152 ~TRGdG~~GeDVT~n  166 (731)
                      +|=|.+-+|.-+...
T Consensus        52 ITGas~GIG~aiA~~   66 (291)
T 3ijr_A           52 ITGGDSGIGRAVSIA   66 (291)
T ss_dssp             EETTTSHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHH
T ss_conf             938887899999999


No 244
>3cxt_A Dehydrogenase with different specificities; rossman fold, oxidoreductase; HET: NAP GKR; 1.90A {Streptococcus suis} PDB: 3cxr_A*
Probab=37.57  E-value=14  Score=14.16  Aligned_cols=15  Identities=20%  Similarity=0.299  Sum_probs=9.8

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       267 s~~iTG~~i~VDGG~  281 (291)
T 3cxt_A          267 SNFVNGHILYVDGGI  281 (291)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             269768779979582


No 245
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*
Probab=37.47  E-value=14  Score=14.15  Aligned_cols=17  Identities=0%  Similarity=-0.013  Sum_probs=7.5

Q ss_pred             HCCCHHHHHHHHHHHHH
Q ss_conf             15999999999999998
Q gi|254781172|r  100 KIWNIEDLRKFITRIYR  116 (731)
Q Consensus       100 k~~~~~el~~w~~~~~~  116 (731)
                      ++.+.+++.++.+.+.+
T Consensus        61 Dv~~~~~v~~~~~~~~~   77 (260)
T 1nff_A           61 DVTQPAQWKAAVDTAVT   77 (260)
T ss_dssp             CTTCHHHHHHHHHHHHH
T ss_pred             ECCCHHHHHHHHHHHHH
T ss_conf             47999999999999999


No 246
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2
Probab=37.38  E-value=14  Score=14.14  Aligned_cols=12  Identities=8%  Similarity=0.116  Sum_probs=5.2

Q ss_pred             CCCCCEEEEECC
Q ss_conf             216866999725
Q gi|254781172|r  646 EIENKKLVFTGT  657 (731)
Q Consensus       646 ~l~gk~vV~TGt  657 (731)
                      ..+|.++.+.|-
T Consensus       236 ~itG~~i~vDGG  247 (253)
T 1hxh_A          236 VMSGSELHADNS  247 (253)
T ss_dssp             TCCSCEEEESSS
T ss_pred             CCCCCEEEECCC
T ss_conf             966837899915


No 247
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix K1}
Probab=37.35  E-value=15  Score=14.13  Aligned_cols=14  Identities=21%  Similarity=0.197  Sum_probs=8.3

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|.++.+.|-
T Consensus       244 s~~itG~~i~vDGG  257 (260)
T 2z1n_A          244 ASFITGAVIPVDGG  257 (260)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             25965872888949


No 248
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A*
Probab=37.18  E-value=15  Score=14.11  Aligned_cols=16  Identities=13%  Similarity=0.133  Sum_probs=9.2

Q ss_pred             EEECCCCHHHHHHHHH
Q ss_conf             8865986556669997
Q gi|254781172|r  151 AALRGDGHSGEDVSAC  166 (731)
Q Consensus       151 a~TRGdG~~GeDVT~n  166 (731)
                      .+|=|-+-+|.-+...
T Consensus        13 lITGas~GIG~aiA~~   28 (319)
T 1gz6_A           13 LVTGAGGGLGRAYALA   28 (319)
T ss_dssp             EETTTTSHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHH
T ss_conf             9958587899999999


No 249
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A
Probab=36.99  E-value=15  Score=14.09  Aligned_cols=15  Identities=33%  Similarity=0.302  Sum_probs=11.1

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       232 a~~itGq~i~vDGG~  246 (264)
T 2dtx_A          232 ASFITGTCLYVDGGL  246 (264)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             259168637989628


No 250
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2
Probab=36.90  E-value=15  Score=14.08  Aligned_cols=15  Identities=13%  Similarity=0.138  Sum_probs=7.1

Q ss_pred             EEECCCCHHHHHHHH
Q ss_conf             886598655666999
Q gi|254781172|r  151 AALRGDGHSGEDVSA  165 (731)
Q Consensus       151 a~TRGdG~~GeDVT~  165 (731)
                      .+|=|.+-+|.-+..
T Consensus        18 lVTGas~GIG~aia~   32 (265)
T 1h5q_A           18 IVTGGNRGIGLAFTR   32 (265)
T ss_dssp             EEETTTSHHHHHHHH
T ss_pred             EEECCCCHHHHHHHH
T ss_conf             992888789999999


No 251
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1
Probab=36.69  E-value=10  Score=15.25  Aligned_cols=15  Identities=13%  Similarity=0.093  Sum_probs=12.0

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             326577501033786
Q gi|254781172|r  433 FCPICQSRVVRDLNP  447 (731)
Q Consensus       433 ~CP~Cgs~l~~~~~~  447 (731)
                      .||.|+++|.++...
T Consensus        12 ~CP~~k~~L~~~~~~   26 (67)
T 2jny_A           12 ACPKDKGPLRYLESE   26 (67)
T ss_dssp             BCTTTCCBCEEETTT
T ss_pred             CCCCCCCCCEEECCC
T ss_conf             587989840696889


No 252
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3itd_A
Probab=36.38  E-value=15  Score=14.02  Aligned_cols=14  Identities=21%  Similarity=0.328  Sum_probs=8.6

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|.++.+.|-
T Consensus       255 s~~itG~~i~VDGG  268 (270)
T 3is3_A          255 GEWVNGKVLTLDGG  268 (270)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             35946864875688


No 253
>1e7l_A GP49, recombination endonuclease VII; resolvase, holliday junction, DNAse; HET: SO4; 1.32A {Bacteriophage T4} SCOP: a.140.4.1 d.4.1.5 PDB: 2qnc_A* 1en7_A 1e7d_A 2qnf_A*
Probab=36.32  E-value=13  Score=14.51  Aligned_cols=10  Identities=40%  Similarity=0.883  Sum_probs=7.8

Q ss_pred             CCCCCCCCCC
Q ss_conf             4326577501
Q gi|254781172|r  432 SFCPICQSRV  441 (731)
Q Consensus       432 ~~CP~Cgs~l  441 (731)
                      -.||.|+.++
T Consensus        21 g~C~IC~~~~   30 (157)
T 1e7l_A           21 GKCLICQREL   30 (157)
T ss_dssp             TBCTTTCCBC
T ss_pred             CCCCCCCCCC
T ss_conf             9277779977


No 254
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}
Probab=36.14  E-value=13  Score=14.45  Aligned_cols=14  Identities=21%  Similarity=0.116  Sum_probs=5.3

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99999999999999
Q gi|254781172|r  102 WNIEDLRKFITRIY  115 (731)
Q Consensus       102 ~~~~el~~w~~~~~  115 (731)
                      .+++++.++.+.+.
T Consensus        73 ~~~~~v~~~~~~~~   86 (262)
T 3ksu_A           73 SNEEEVAKLFDFAE   86 (262)
T ss_dssp             CSHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             99999999999999


No 255
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2
Probab=36.11  E-value=15  Score=13.99  Aligned_cols=13  Identities=31%  Similarity=0.312  Sum_probs=7.0

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++++.|-
T Consensus       225 ~~iTG~~i~vDGG  237 (245)
T 1uls_A          225 SFITGQVLFVDGG  237 (245)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             6976875998999


No 256
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 1mo7_A 1mo8_A* 1q3i_A
Probab=35.66  E-value=13  Score=14.41  Aligned_cols=11  Identities=9%  Similarity=0.057  Sum_probs=5.8

Q ss_pred             EEEECCEEEEE
Q ss_conf             99859989988
Q gi|254781172|r  141 IRYEKGKFVYA  151 (731)
Q Consensus       141 l~Y~~G~L~~a  151 (731)
                      .+++||+.+..
T Consensus       175 ~ViRdG~~~~I  185 (1028)
T 2zxe_A          175 LVIRDGEKSTI  185 (1028)
T ss_dssp             EEEETTEEEEE
T ss_pred             EEEECCEEEEE
T ss_conf             99999999998


No 257
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2
Probab=35.63  E-value=15  Score=13.94  Aligned_cols=20  Identities=10%  Similarity=-0.041  Sum_probs=8.6

Q ss_pred             HHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             3213012310354103555565
Q gi|254781172|r  473 KHFVSRDAFNIEGLGKQQLDFF  494 (731)
Q Consensus       473 ~hF~SK~aldI~GLG~k~Ie~L  494 (731)
                      .|-+||-+  +.+|.+..-..|
T Consensus       186 ~Y~asKaa--l~~lt~~la~El  205 (279)
T 1xg5_A          186 FYSATKYA--VTALTEGLRQEL  205 (279)
T ss_dssp             HHHHHHHH--HHHHHHHHHHHH
T ss_pred             HHHHHHHH--HHHHHHHHHHHH
T ss_conf             89999999--999999999999


No 258
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50}
Probab=35.63  E-value=11  Score=15.08  Aligned_cols=16  Identities=25%  Similarity=0.692  Sum_probs=12.2

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             4326577501033786
Q gi|254781172|r  432 SFCPICQSRVVRDLNP  447 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~  447 (731)
                      -.||.|+++|.++...
T Consensus         9 L~CP~ck~~L~~~~~~   24 (70)
T 2js4_A            9 LVCPVCKGRLEFQRAQ   24 (70)
T ss_dssp             CBCTTTCCBEEEETTT
T ss_pred             HCCCCCCCEEEEECCC
T ss_conf             0687999872693889


No 259
>3afn_B A1-R, 4-deoxy-L-erythro-5-hexoseulose-uronic acid reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*
Probab=35.46  E-value=15  Score=13.92  Aligned_cols=12  Identities=25%  Similarity=0.266  Sum_probs=6.9

Q ss_pred             CCCCCEEEEECC
Q ss_conf             216866999725
Q gi|254781172|r  646 EIENKKLVFTGT  657 (731)
Q Consensus       646 ~l~gk~vV~TGt  657 (731)
                      ..+|.++.+.|-
T Consensus       243 ~itG~~i~vDGG  254 (258)
T 3afn_B          243 YITGQVLDINGG  254 (258)
T ss_dssp             TCCSEEEEESTT
T ss_pred             CCCCCEEEECCC
T ss_conf             840855888896


No 260
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}
Probab=35.40  E-value=7.7  Score=16.26  Aligned_cols=16  Identities=25%  Similarity=0.719  Sum_probs=11.5

Q ss_pred             EECC----CCCCCCCCCCCC
Q ss_conf             7704----326577501033
Q gi|254781172|r  429 SFPS----FCPICQSRVVRD  444 (731)
Q Consensus       429 ~~P~----~CP~Cgs~l~~~  444 (731)
                      .+|+    .||+|+..+-..
T Consensus        24 ~~p~~lW~kCp~C~~~i~~~   43 (285)
T 2f9i_B           24 DVPAGIMTKCPKCKKIMYTK   43 (285)
T ss_dssp             --CCSSEEECTTTCCEEEHH
T ss_pred             CCCCCCEECCCCCCCHHHHH
T ss_conf             89998630288887313299


No 261
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV}
Probab=35.36  E-value=15  Score=13.91  Aligned_cols=22  Identities=14%  Similarity=0.075  Sum_probs=11.6

Q ss_pred             CCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             99899888659865566699977
Q gi|254781172|r  145 KGKFVYAALRGDGHSGEDVSACI  167 (731)
Q Consensus       145 ~G~L~~a~TRGdG~~GeDVT~n~  167 (731)
                      .|+ +-.+|=|.+-+|.-+....
T Consensus         5 ~GK-valVTGas~GIG~aia~~l   26 (274)
T 3e03_A            5 SGK-TLFITGASRGIGLAIALRA   26 (274)
T ss_dssp             TTC-EEEEETTTSHHHHHHHHHH
T ss_pred             CCC-EEEEECCCCHHHHHHHHHH
T ss_conf             998-7999586878999999999


No 262
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2
Probab=35.29  E-value=16  Score=13.90  Aligned_cols=19  Identities=26%  Similarity=0.445  Sum_probs=13.9

Q ss_pred             CCCCCCCEEEEECCCCCCC
Q ss_conf             8821686699972588998
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQ  662 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~  662 (731)
                      ++.++|.++.+.|-++.|.
T Consensus       230 s~~itG~~i~VDGG~s~~P  248 (249)
T 1o5i_A          230 ASYLTGQTIVVDGGLSKFP  248 (249)
T ss_dssp             GTTCCSCEEEESTTCCCCC
T ss_pred             HCCCCCCEEEECCCHHCCC
T ss_conf             2697585688894741078


No 263
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold; HET: 1PE MES; 1.80A {Aquifex aeolicus VF5} PDB: 2p68_A*
Probab=34.98  E-value=16  Score=13.87  Aligned_cols=13  Identities=23%  Similarity=0.263  Sum_probs=6.7

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++.+.|-
T Consensus       234 ~~itG~~i~vDGG  246 (248)
T 2pnf_A          234 SYITGEVIHVNGG  246 (248)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             5976876986887


No 264
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}
Probab=34.93  E-value=16  Score=13.86  Aligned_cols=16  Identities=25%  Similarity=0.173  Sum_probs=11.2

Q ss_pred             CCCCCCCEEEEECCCC
Q ss_conf             8821686699972588
Q gi|254781172|r  644 SSEIENKKLVFTGTLQ  659 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~  659 (731)
                      .+.++|.++.+.|-+.
T Consensus       240 s~~itG~~i~VDGG~s  255 (261)
T 3n74_A          240 ASMITGVALDVDGGRS  255 (261)
T ss_dssp             GTTCCSCEEEESTTTT
T ss_pred             HCCCCCCEEEECCCEE
T ss_conf             2697686599799913


No 265
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}
Probab=34.74  E-value=16  Score=13.84  Aligned_cols=14  Identities=7%  Similarity=0.197  Sum_probs=8.2

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++.++|.++.+.|-
T Consensus       260 s~~iTG~~i~VDGG  273 (276)
T 2b4q_A          260 GAYMTGNVIPIDGG  273 (276)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             26976874867979


No 266
>1dm9_A Hypothetical 15.5 KD protein in MRCA-PCKA intergenic region; heat shock proteins, protein-RNA interactions, ribosome, structural genomics; 2.00A {Escherichia coli} SCOP: d.66.1.3 PDB: 3bbu_A
Probab=34.60  E-value=13  Score=14.52  Aligned_cols=20  Identities=0%  Similarity=0.140  Sum_probs=15.2

Q ss_pred             CCCCCCCEEEEEECCCCHHH
Q ss_conf             68440768999835870256
Q gi|254781172|r  393 RDIRVGDRVLVKRAGEVIPK  412 (731)
Q Consensus       393 ~~I~iGd~V~I~RaGdVIP~  412 (731)
                      ..+.+||.|.|...+.+.--
T Consensus        47 ~~v~~gD~i~i~~~~~~~~i   66 (133)
T 1dm9_A           47 KIVELNATLTLRQGNDERTV   66 (133)
T ss_dssp             CBCCTTCEEEEEETTEEEEE
T ss_pred             CCCCCCCEEEEEECCCEEEE
T ss_conf             66889998999868926799


No 267
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}
Probab=34.12  E-value=16  Score=13.77  Aligned_cols=12  Identities=8%  Similarity=0.335  Sum_probs=4.2

Q ss_pred             ECCCCHHHHHHH
Q ss_conf             659865566699
Q gi|254781172|r  153 LRGDGHSGEDVS  164 (731)
Q Consensus       153 TRGdG~~GeDVT  164 (731)
                      |=|.+-+|.-+.
T Consensus        13 TGas~GIG~aiA   24 (252)
T 3h7a_A           13 IGAGDYIGAEIA   24 (252)
T ss_dssp             ECCSSHHHHHHH
T ss_pred             ECCCHHHHHHHH
T ss_conf             758558999999


No 268
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*
Probab=33.55  E-value=16  Score=13.85  Aligned_cols=14  Identities=21%  Similarity=0.316  Sum_probs=9.3

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|.++.+.|-
T Consensus       236 s~~iTG~~i~VDGG  249 (255)
T 1fmc_A          236 ASWVSGQILTVSGG  249 (255)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             25976877997959


No 269
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*
Probab=33.12  E-value=17  Score=13.65  Aligned_cols=15  Identities=20%  Similarity=0.328  Sum_probs=10.8

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       240 s~~iTG~~i~VDGG~  254 (260)
T 2ae2_A          240 ASYVTGQIIYVDGGL  254 (260)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             269668479968782


No 270
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta-hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A*
Probab=33.02  E-value=17  Score=13.64  Aligned_cols=15  Identities=13%  Similarity=0.315  Sum_probs=8.4

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      .+.++|.++.+.|-+
T Consensus       243 a~~itG~~i~vDGG~  257 (260)
T 1x1t_A          243 AAQITGTTVSVDGGW  257 (260)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             269668878879245


No 271
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129}
Probab=32.98  E-value=17  Score=13.64  Aligned_cols=54  Identities=20%  Similarity=0.295  Sum_probs=36.0

Q ss_pred             CCCCCEEEE------ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEEC
Q ss_conf             216866999------72588998789999999829849981116321799778888637989974991737
Q gi|254781172|r  646 EIENKKLVF------TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN  710 (731)
Q Consensus       646 ~l~gk~vV~------TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~  710 (731)
                      ...|++|++      ||    -|=.++.+.|++.|+.|.+-+.      |+.-..| ..++.++.|||+.+
T Consensus       111 ~~~g~rVlIVDDviTTG----~S~~~~i~~l~~~G~~V~~v~v------ivdr~~~-~~e~~~~~gi~~~s  170 (180)
T 2p1z_A          111 DVVGKKVLVVEDTTTTG----NSPLTAVKALREAGAEVVGVAT------VVDRATG-AADVIAAEGLEYRY  170 (180)
T ss_dssp             CCTTCEEEEEEEECSSS----HHHHHHHHHHHHHTCEEEEEEE------EEC-CCC-HHHHHHTTTCCEEE
T ss_pred             ECCCCEEEEEEEEECCC----HHHHHHHHHHHHCCCEEEEEEE------EEECCCC-HHHHHHHCCCCEEE
T ss_conf             05897689997523037----5199999999988997999999------9988867-57899866996999


No 272
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, hydrolase; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*
Probab=32.98  E-value=11  Score=15.18  Aligned_cols=13  Identities=23%  Similarity=0.373  Sum_probs=7.0

Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             3689999759966
Q gi|254781172|r  256 EMLQKMRCLGFPV  268 (731)
Q Consensus       256 e~l~~L~~~GF~v  268 (731)
                      ..++.++..|..|
T Consensus       223 ~i~~~~~~~~~~v  235 (574)
T 3e1s_A          223 AVADLAESLGLEV  235 (574)
T ss_dssp             HHHHHHHHTTCCE
T ss_pred             HHHHHHHHCCCEE
T ss_conf             9999998679849


No 273
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2
Probab=32.85  E-value=15  Score=14.06  Aligned_cols=14  Identities=29%  Similarity=0.475  Sum_probs=8.3

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       270 ~~iTG~~i~VDGG~  283 (285)
T 2c07_A          270 GYINGRVFVIDGGL  283 (285)
T ss_dssp             TTCCSCEEEESTTS
T ss_pred             CCCCCCEEEECCCC
T ss_conf             69778779779880


No 274
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1G07440, reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A
Probab=32.74  E-value=17  Score=13.61  Aligned_cols=13  Identities=23%  Similarity=0.355  Sum_probs=6.8

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++++.|-
T Consensus       242 ~~iTG~~i~VDGG  254 (266)
T 1xq1_A          242 SYITGQTICVDGG  254 (266)
T ss_dssp             TTCCSCEEECCCC
T ss_pred             CCCCCCEEEECCC
T ss_conf             5976876996979


No 275
>3gr6_A Enoyl-[acyl-carrier-protein] reductase [NADH]; enoyl reductase, NADP, triclosan, oxidoreductase; HET: NAP TCL; 2.28A {Staphylococcus aureus} PDB: 3gns_A* 3gnt_A
Probab=32.52  E-value=17  Score=13.58  Aligned_cols=15  Identities=13%  Similarity=0.251  Sum_probs=9.5

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       242 s~~itG~~i~vDGG~  256 (260)
T 3gr6_A          242 SSGVTGENIHVDSGF  256 (260)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             279478657859577


No 276
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*
Probab=32.13  E-value=17  Score=13.54  Aligned_cols=13  Identities=15%  Similarity=0.182  Sum_probs=7.1

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +..+|.++.+.|-
T Consensus       268 ~~itG~~i~VDGG  280 (283)
T 1g0o_A          268 GWVTGKVIGIDGG  280 (283)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             4826872868978


No 277
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii RH} PDB: 2o50_A 3nj8_A*
Probab=32.04  E-value=17  Score=13.53  Aligned_cols=16  Identities=13%  Similarity=0.221  Sum_probs=10.8

Q ss_pred             CCCCCCCEEEEECCCC
Q ss_conf             8821686699972588
Q gi|254781172|r  644 SSEIENKKLVFTGTLQ  659 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~  659 (731)
                      ++..+|.++.+-|-+.
T Consensus       278 s~~iTG~~i~VDGG~~  293 (315)
T 2o2s_A          278 ARAVSGVTLYVDNGLH  293 (315)
T ss_dssp             GTTCCSCEEEESTTGG
T ss_pred             HCCCCCCEEEECCCCC
T ss_conf             3795685788896821


No 278
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*
Probab=32.04  E-value=17  Score=13.53  Aligned_cols=15  Identities=20%  Similarity=0.251  Sum_probs=11.0

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       237 a~~itG~~i~vDGG~  251 (254)
T 2wsb_A          237 ASYVTGAILAVDGGY  251 (254)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             359668658879785


No 279
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}
Probab=31.98  E-value=17  Score=13.52  Aligned_cols=14  Identities=21%  Similarity=0.273  Sum_probs=8.0

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      .+.++|..+.+.|-
T Consensus       253 a~~itG~~i~vDGG  266 (270)
T 3ftp_A          253 AGYITGTTLHVNGG  266 (270)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             16976875994978


No 280
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A
Probab=31.92  E-value=17  Score=13.51  Aligned_cols=15  Identities=7%  Similarity=0.107  Sum_probs=7.1

Q ss_pred             EEECCCCHHHHHHHH
Q ss_conf             886598655666999
Q gi|254781172|r  151 AALRGDGHSGEDVSA  165 (731)
Q Consensus       151 a~TRGdG~~GeDVT~  165 (731)
                      .+|=|.+-+|.-+..
T Consensus        16 lITGas~GIG~aia~   30 (252)
T 3f1l_A           16 LVTGASDGIGREAAM   30 (252)
T ss_dssp             EEESTTSHHHHHHHH
T ss_pred             EEECCCCHHHHHHHH
T ss_conf             993888789999999


No 281
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.11A {Methanothermobacterthermautotrophicus str} SCOP: d.58.61.1
Probab=31.74  E-value=18  Score=13.49  Aligned_cols=41  Identities=20%  Similarity=0.406  Sum_probs=32.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCC
Q ss_conf             216866999725889987899999998298499811163217997788
Q gi|254781172|r  646 EIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDN  693 (731)
Q Consensus       646 ~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~  693 (731)
                      .-.|.++++-|.  +..=+++++.||.+||.+.|     .|-+++|+.
T Consensus        47 eT~~~kItIEG~--~id~d~i~~~IE~~Gg~IHS-----IDeV~aG~~   87 (97)
T 2raq_A           47 ETENIKVTIQGN--DLDFDEITRAIESYGGSIHS-----VDEVVAGRT   87 (97)
T ss_dssp             SCEEEEEEEECS--SCCHHHHHHHHHHTTCEEEE-----EEEEEEESS
T ss_pred             CCEEEEEEEEEC--CCCHHHHHHHHHHCCCEEEE-----EEEEEECCE
T ss_conf             650789999946--77979999999984981775-----623632560


No 282
>1ekr_A Molybdenum cofactor biosynthesis protein C; MOAC, molybdenum cofactor (MOCO), MOCO biosynthesis, MOCO deficiency, translation; 2.00A {Escherichia coli} SCOP: d.58.21.1 PDB: 1eks_A*
Probab=31.69  E-value=18  Score=13.48  Aligned_cols=47  Identities=26%  Similarity=0.420  Sum_probs=29.3

Q ss_pred             EEECCCCEEEEEEEEEEEEECCCEEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             94035622589999743330264000101489899975023454322246844076899983587
Q gi|254781172|r  344 IQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGE  408 (731)
Q Consensus       344 wqvgRtG~itPva~~ePV~l~G~~V~ratlhN~~~I~~l~~~~~~~~~~~~I~iGd~V~I~RaGd  408 (731)
                      -..||||+       |-=-|-|++|.--|+  +|.+|-+         ++++.|++.-++.++|.
T Consensus       104 ~~~~kTGV-------EMEALtavsva~LTi--YDM~Kav---------dk~~~I~~i~Ll~K~GG  150 (161)
T 1ekr_A          104 RLTGKTGV-------EMEALTAASVAALTI--YDMCKAV---------QKDMVIGPVRLLAKSGG  150 (161)
T ss_dssp             EEEESSCC-------HHHHHHHHHHHHHHH--HHHHGGG---------CSCCEEEEEEEEEEC--
T ss_pred             EEECCCCH-------HHHHHHHHHHHHHHH--HHHHHHC---------CCCCEEEEEEEEEECCC
T ss_conf             99768338-------881999999999999--9887631---------89978941699993388


No 283
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase, nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans R1}
Probab=31.50  E-value=18  Score=13.46  Aligned_cols=24  Identities=25%  Similarity=0.245  Sum_probs=19.1

Q ss_pred             CCCCHHHHHCCCCCCHHHHHHHHH
Q ss_conf             511778761388867899999999
Q gi|254781172|r  591 NNDDWLSLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       591 ~~~~~e~L~~I~GiG~~~A~si~~  614 (731)
                      .-.+.++|..|+|||+..++.+-+
T Consensus        42 ~P~t~~eL~~I~Gig~~k~~~yG~   65 (77)
T 2rhf_A           42 QPRTLAELAEVPGLGEKRIEAYGE   65 (77)
T ss_dssp             CCCSHHHHTTSTTTCHHHHHHHHH
T ss_pred             CCCCHHHHHCCCCCCHHHHHHHHH
T ss_conf             978999980799979999999999


No 284
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A*
Probab=31.48  E-value=18  Score=13.46  Aligned_cols=16  Identities=19%  Similarity=0.287  Sum_probs=8.2

Q ss_pred             EEECCCCHHHHHHHHH
Q ss_conf             8865986556669997
Q gi|254781172|r  151 AALRGDGHSGEDVSAC  166 (731)
Q Consensus       151 a~TRGdG~~GeDVT~n  166 (731)
                      .+|=|.+-+|.-+...
T Consensus        11 lITGas~GIG~a~a~~   26 (241)
T 1dhr_A           11 LVYGGRGALGSRCVQA   26 (241)
T ss_dssp             EEETTTSHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHH
T ss_conf             9958987899999999


No 285
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus}
Probab=31.37  E-value=18  Score=13.45  Aligned_cols=43  Identities=14%  Similarity=0.317  Sum_probs=33.9

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCC
Q ss_conf             82168669997258899878999999982984998111632179977888
Q gi|254781172|r  645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP  694 (731)
Q Consensus       645 ~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~  694 (731)
                      ..-.|.++++-|.  +..=+++++.||.+||.+.|     .|=+++|+..
T Consensus        45 ~eTe~lkItIEG~--~id~d~i~~~IE~~Gg~IHS-----IDeV~aG~~i   87 (96)
T 2x3d_A           45 VETMGLMIIIEGT--SLNFDDIRKMLEEEGCAIHS-----IDEVVSGNRI   87 (96)
T ss_dssp             SSEEEEEEEEEES--SCCHHHHHHHHHHTTCEEEE-----EEEEEEESSC
T ss_pred             CCCEEEEEEEEEC--CCCHHHHHHHHHHCCCEEEE-----EEEEEECCEE
T ss_conf             3650789999946--77979999999974981773-----6125464547


No 286
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix}
Probab=30.90  E-value=18  Score=13.39  Aligned_cols=67  Identities=21%  Similarity=0.351  Sum_probs=40.5

Q ss_pred             CCCCCCEEEE------ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHH
Q ss_conf             8216866999------7258899878999999982984998111632179977888863798997499173799999999
Q gi|254781172|r  645 SEIENKKLVF------TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL  718 (731)
Q Consensus       645 ~~l~gk~vV~------TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll  718 (731)
                      +...|+++++      ||.    |=.++.+.+++.|++|...      +.++.-..+ ..+.-++.|||+.+.-.+.+++
T Consensus       102 g~~~g~~VlIVDDvitTG~----S~~~~i~~l~~~G~~v~~v------~vlvdr~~~-~~e~~~~~gi~~~Sl~~~~~l~  170 (178)
T 2yzk_A          102 GDPPKGRVVVVDDVATTGT----SIAKSIEVLRSNGYTVGTA------LVLVDRGEG-AGELLARMGVRLVSVATLKTIL  170 (178)
T ss_dssp             TCCCSSEEEEEEEEESSSH----HHHHHHHHHHHTTCEEEEE------EEEEECCSS-HHHHHHTTTCEEEEEEEHHHHH
T ss_pred             EECCCCEEEEEEEEECCCC----CHHHHHHHHHHCCCEEEEE------EEEEECCCC-HHHHHHHCCCCEEEEEEHHHHH
T ss_conf             5248957999974473574----6899999999889979999------999978767-6899997699899973899999


Q ss_pred             HHHC
Q ss_conf             8828
Q gi|254781172|r  719 QQYN  722 (731)
Q Consensus       719 ~~~~  722 (731)
                      +.-.
T Consensus       171 ~~l~  174 (178)
T 2yzk_A          171 EKLG  174 (178)
T ss_dssp             HHTT
T ss_pred             HHHH
T ss_conf             9998


No 287
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A*
Probab=30.78  E-value=17  Score=13.70  Aligned_cols=14  Identities=7%  Similarity=0.055  Sum_probs=6.1

Q ss_pred             EECCCCHHHHHHHH
Q ss_conf             86598655666999
Q gi|254781172|r  152 ALRGDGHSGEDVSA  165 (731)
Q Consensus       152 ~TRGdG~~GeDVT~  165 (731)
                      +|=|.+-+|.-+..
T Consensus        11 ITGas~GIG~aiA~   24 (259)
T 1oaa_A           11 LTGASRGFGRALAP   24 (259)
T ss_dssp             ESSCSSHHHHHHHH
T ss_pred             ECCCCCHHHHHHHH
T ss_conf             90778789999999


No 288
>1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A*
Probab=30.64  E-value=18  Score=13.36  Aligned_cols=21  Identities=19%  Similarity=0.107  Sum_probs=16.9

Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             787613888678999999999
Q gi|254781172|r  595 WLSLIRVPLVGDIIAQAIVEF  615 (731)
Q Consensus       595 ~e~L~~I~GiG~~~A~si~~f  615 (731)
                      .+.|+.|+|||+.+|+.+.=|
T Consensus       206 ~~~L~~l~GIGpWTA~~vll~  226 (282)
T 1mpg_A          206 MKTLQTFPGIGRWTANYFALR  226 (282)
T ss_dssp             HHHHTTSTTCCHHHHHHHHHH
T ss_pred             HHHHHHCCCCCHHHHHHHHHH
T ss_conf             999997679886999999999


No 289
>3osn_A DNA polymerase IOTA; hoogsteen base PAIR, protein-DNA complex, Y-family DNA polym translesion synthesis, nucleoside triphosphate; HET: DNA DOC 6OG TTP; 1.90A {Homo sapiens} PDB: 2dpj_A* 2fll_A* 2fln_A* 2flp_A* 3epg_A* 3epi_A* 2dpi_A* 3g6v_A* 3g6y_A* 3g6x_A* 3gv7_B* 3gv8_B* 3ngd_A* 3gv5_B* 3h4d_A* 3h4b_A* 2alz_A* 3h40_A* 1t3n_A* 1zet_A*
Probab=30.53  E-value=12  Score=14.84  Aligned_cols=47  Identities=17%  Similarity=0.227  Sum_probs=28.9

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             035410355556530576540454101101067775310001000134210014568999
Q gi|254781172|r  482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS  541 (731)
Q Consensus       482 dI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~s  541 (731)
                      ++-|+|+++.++|-..|     |.++.||..+....      |.+  .||.+.+..|++.
T Consensus       238 ~l~GiG~~~~~~L~~~G-----i~ti~dl~~~~~~~------L~~--~fG~~~g~~l~~~  284 (420)
T 3osn_A          238 EIPGIGYKTAKCLEALG-----INSVRDLQTFSPKI------LEK--ELGISVAQRIQKL  284 (420)
T ss_dssp             GSTTCCHHHHHHHHHTT-----CCSHHHHHHSCHHH------HHH--HHHHHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHHHHC-----CCCHHHHHCCCHHH------HHH--HHCCHHHHHHHHH
T ss_conf             85688878999986425-----66099875275536------998--8593999999999


No 290
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1
Probab=30.33  E-value=18  Score=13.32  Aligned_cols=42  Identities=19%  Similarity=0.437  Sum_probs=32.6

Q ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCC
Q ss_conf             8216866999725889987899999998298499811163217997788
Q gi|254781172|r  645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDN  693 (731)
Q Consensus       645 ~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~  693 (731)
                      ..-.|.++++-|.  +..=+++++.||.+||.+.|     .|=+++|+.
T Consensus        46 ~eTe~lkItIEG~--did~d~I~~~IE~~GgvIHS-----IDEV~aG~~   87 (100)
T 3bpd_A           46 QATENIKITILGN--NLDYEQIKGVIEDMGGVIHS-----VDEVVAGKI   87 (100)
T ss_dssp             SSEEEEEEEEEEE--EECHHHHHHHHHTTTCEEEE-----EEEEEEESS
T ss_pred             CCCEEEEEEEEEC--CCCHHHHHHHHHHCCCEEEE-----EEEEEECCE
T ss_conf             4651789999946--87979999999984982785-----623632573


No 291
>1wwu_A Hypothetical protein FLJ21935; structural genomics, protein regulation, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens}
Probab=29.99  E-value=16  Score=13.85  Aligned_cols=50  Identities=8%  Similarity=0.292  Sum_probs=33.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             1035410355556530576540454101101067775310001000134210014568999987522
Q gi|254781172|r  481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN  547 (731)
Q Consensus       481 ldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~  547 (731)
                      |...|+++.+|+.|=.        -+-+|||.|+++++      ..+=|  + =...++++|.--|.
T Consensus        33 L~~kgFS~~tv~~Lg~--------ltGaqLf~LtKeeL------~~vCg--~-EG~RlysqL~vqk~   82 (99)
T 1wwu_A           33 LEAKAFSPRIVENLGI--------LTGPQLFSLNKEEL------KKVCG--E-EGVRVYSQLTMQKA   82 (99)
T ss_dssp             HHHHTCCTTHHHHTTS--------SCHHHHHTCCHHHH------HHHHT--T-THHHHHHHHHHHHH
T ss_pred             HHHCCCCHHHHHHHCC--------CCHHHHHCCCHHHH------HHHCC--H-HHHHHHHHHHHHHH
T ss_conf             9882898899998716--------88899864799999------98774--0-78999999999999


No 292
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=29.87  E-value=11  Score=15.00  Aligned_cols=12  Identities=42%  Similarity=1.082  Sum_probs=9.7

Q ss_pred             ECCCCCCCCCCC
Q ss_conf             704326577501
Q gi|254781172|r  430 FPSFCPICQSRV  441 (731)
Q Consensus       430 ~P~~CP~Cgs~l  441 (731)
                      -|..||.|+.-+
T Consensus        23 qpatcpic~avi   34 (54)
T 1yui_A           23 QPATCPICYAVI   34 (54)
T ss_dssp             CCEECTTTCCEE
T ss_pred             CCCCCCHHHHHH
T ss_conf             997770489999


No 293
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}
Probab=29.85  E-value=19  Score=13.26  Aligned_cols=13  Identities=23%  Similarity=0.276  Sum_probs=6.1

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++++.|-
T Consensus       231 ~~iTG~~i~vDGG  243 (246)
T 2uvd_A          231 KYITGQTLNVDGG  243 (246)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             6976887996977


No 294
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis}
Probab=29.00  E-value=19  Score=13.16  Aligned_cols=15  Identities=7%  Similarity=-0.037  Sum_probs=8.8

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      .+..+|.++.+.|-+
T Consensus       261 a~~iTG~~i~VDGG~  275 (293)
T 3grk_A          261 SRSVTGEVHHADSGY  275 (293)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             359067658879686


No 295
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}
Probab=28.79  E-value=20  Score=13.14  Aligned_cols=74  Identities=12%  Similarity=0.152  Sum_probs=43.9

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCC
Q ss_conf             99777999468899999999999999999999843317798208789999999999998977203115899996200364
Q gi|254781172|r    1 MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG   80 (731)
Q Consensus         1 ~~~~~~~~~~~~s~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~~~~~~~p~spt~~Vg~   80 (731)
                      |+++...++|        +.|.+|.++|......+ ..+...++ .|-+.|.+++..+..+...   .   =||.|+|  
T Consensus         9 ~~~~~~LdFE--------kpI~eLe~kI~eL~~~~-~~~~~d~~-~ei~~Le~k~~~l~~~iy~---~---Ls~wq~V--   70 (327)
T 2f9i_A            9 VPRGSMLDFE--------KPLFEIRNKIESLKESQ-DKNDVDLQ-EEIDMLEASLERETKKIYT---N---LKPWDRV--   70 (327)
T ss_dssp             BCSSCCCGGG--------HHHHHHHHHHHCC------------C-TTHHHHHHHHHHHHHHHHH---S---CCHHHHH--
T ss_pred             CCCCCCCCCC--------HHHHHHHHHHHHHHHHH-CCCCCCHH-HHHHHHHHHHHHHHHHHHC---C---CCHHHHH--
T ss_conf             3666656742--------57999999999987455-05678779-9999999999999999870---8---9999999--


Q ss_pred             CCCCCCCEEECCCCCCCH
Q ss_conf             323577504516642570
Q gi|254781172|r   81 EMNLSLFKVTHSIPTLSL   98 (731)
Q Consensus        81 ~~~~~~~kv~H~~pMlSL   98 (731)
                            +-.+|+.+-..+
T Consensus        71 ------q~ARhp~RP~~~   82 (327)
T 2f9i_A           71 ------QIARLQERPTTL   82 (327)
T ss_dssp             ------HHHTBTTSCCHH
T ss_pred             ------HHHHCCCCCCHH
T ss_conf             ------997478999779


No 296
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) precursor; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A*
Probab=28.77  E-value=20  Score=13.13  Aligned_cols=16  Identities=19%  Similarity=0.275  Sum_probs=10.6

Q ss_pred             CCCCCCCEEEEECCCC
Q ss_conf             8821686699972588
Q gi|254781172|r  644 SSEIENKKLVFTGTLQ  659 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~  659 (731)
                      ++..+|.++.+.|-++
T Consensus       271 s~~iTG~~i~vDGG~s  286 (297)
T 1d7o_A          271 ASAITGATIYVDNGLN  286 (297)
T ss_dssp             GTTCCSCEEEESTTGG
T ss_pred             HCCCCCCEEEECCCHH
T ss_conf             1696786477795843


No 297
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A
Probab=28.73  E-value=19  Score=13.19  Aligned_cols=34  Identities=18%  Similarity=0.441  Sum_probs=16.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHH
Q ss_conf             432657750103378654452101003543441144665533
Q gi|254781172|r  432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLK  473 (731)
Q Consensus       432 ~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~  473 (731)
                      ..||.||+.-... +...++    +.|.   +|-..+..+++
T Consensus        12 ~~Cp~Cgs~~iv~-D~~~Ge----~vC~---~CG~Vlee~~I   45 (58)
T 1dl6_A           12 VTCPNHPDAILVE-DYRAGD----MICP---ECGLVVGDRVI   45 (58)
T ss_dssp             CSBTTBSSSCCEE-CSSSCC----EECT---TTCCEECCSCC
T ss_pred             CCCCCCCCCCEEE-ECCCCE----EECC---CCCCEECCCCC
T ss_conf             5896987987778-888991----8727---89989243313


No 298
>2dok_A Telomerase-binding protein EST1A; telomerase-associated protein, unknown function; 1.80A {Homo sapiens} PDB: 2hww_A 2hwx_A
Probab=28.57  E-value=20  Score=13.11  Aligned_cols=30  Identities=20%  Similarity=0.211  Sum_probs=22.5

Q ss_pred             EEEECCCCCCHHHHHHHCCCEEECHHHHHHHH
Q ss_conf             79977888863798997499173799999999
Q gi|254781172|r  687 IIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL  718 (731)
Q Consensus       687 ~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll  718 (731)
                      .||.+|..  =-.||+..||++.+-.||+++-
T Consensus       154 vLvT~D~n--lriKA~a~Gi~~~~l~ef~~~~  183 (186)
T 2dok_A          154 VLLTDDRN--LRVKALTRNVPVRDIPAFLTWA  183 (186)
T ss_dssp             EEECCCHH--HHHHHHHTTCCEECHHHHHHHH
T ss_pred             EEECCCHH--HHHHHHHCCCEECCHHHHHHHH
T ss_conf             99828598--9999987798057899999886


No 299
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}
Probab=28.53  E-value=20  Score=13.10  Aligned_cols=14  Identities=14%  Similarity=0.211  Sum_probs=9.4

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      .+..+|.++.+.|-
T Consensus       299 a~~iTG~~i~VDGG  312 (317)
T 3oec_A          299 ARYIHGAAIPVDGG  312 (317)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCH
T ss_conf             36966876888950


No 300
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E
Probab=28.49  E-value=20  Score=13.10  Aligned_cols=14  Identities=21%  Similarity=0.316  Sum_probs=8.6

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++.++|.++.+.|-
T Consensus       231 s~~itG~~i~vdGG  244 (248)
T 3op4_A          231 AAYITGETLHVNGG  244 (248)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             25976886997988


No 301
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1
Probab=28.37  E-value=20  Score=13.08  Aligned_cols=88  Identities=16%  Similarity=0.260  Sum_probs=42.9

Q ss_pred             CCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEECCCEEEEECCCCHH
Q ss_conf             43763777311000111587656866312311456215899878899403562258999974333026400010148989
Q gi|254781172|r  298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED  377 (731)
Q Consensus       298 ~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T~v~~I~wqvgRtG~itPva~~ePV~l~G~~V~ratlhN~~  377 (731)
                      .++|-.+++-+......-  ....|-..+           ....+.+.+| .|.|    .+.-|+..|-.+-.|.    +
T Consensus       234 ~~~~~~~~i~~~~~~~~~--~~~~pg~~~-----------~~~~~~v~c~-dg~l----~i~~~q~~gkk~m~~~----~  291 (660)
T 1z7e_A          234 YVGNQKFTVWSSRVHPHA--SKAQPGSVI-----------SVAPLLIACG-DGAL----EIVTGQAGDGITMQGS----Q  291 (660)
T ss_dssp             EETTEEEEEEECCEECCC--CSSCTTSEE-----------EETTEEEECS-BSEE----EECEEEETTSCCEEHH----H
T ss_pred             EECCEEEEEEEEEECCCC--CCCCCEEEE-----------ECCCEEEEEC-CCEE----EEEEEECCCCCCCCHH----H
T ss_conf             989999999998974677--788981899-----------8797999978-9689----9989988999445799----9


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCC--------------EEEEEECCCCHH-HHHHHCC
Q ss_conf             9975023454322246844076--------------899983587025-6654101
Q gi|254781172|r  378 YIKGLDASGKVMRGGRDIRVGD--------------RVLVKRAGEVIP-KVVDIIV  418 (731)
Q Consensus       378 ~I~~l~~~~~~~~~~~~I~iGd--------------~V~I~RaGdVIP-~I~~Vi~  418 (731)
                      |++.+           ++.+|+              +|+|.=+..-|= +++.-+.
T Consensus       292 f~~g~-----------~~~~g~~~~~~~~~~~~~kkkILVTGatGfIGs~Lv~~Ll  336 (660)
T 1z7e_A          292 LAQTL-----------GLVQGSRLNSQPACTARRRTRVLILGVNGFIGNHLTERLL  336 (660)
T ss_dssp             HHHTT-----------TCSSSCCC---------CCEEEEEETTTSHHHHHHHHHHH
T ss_pred             HHCCC-----------CCCCCCCCCCCHHHHHHCCCEEEEECCCCEEHHHHHHHHH
T ss_conf             96166-----------5789976243201254158889990787383999999999


No 302
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4
Probab=28.31  E-value=17  Score=13.66  Aligned_cols=31  Identities=26%  Similarity=0.286  Sum_probs=17.0

Q ss_pred             CCCCHHHHHHHHHHHHH--HHHHHHHHHHCCHH
Q ss_conf             21001456899998752--23466677630101
Q gi|254781172|r  530 FGDVSVTNLYDSINKRR--NISLERFIFSLGIR  560 (731)
Q Consensus       530 fgeKsa~nL~~sIe~sK--~~~L~r~L~ALGI~  560 (731)
                      +|...++++..+++.+.  ..|+-.|.-+=|-|
T Consensus       134 ~g~~~geKi~ra~e~A~~~~lPlI~l~~SgGaR  166 (304)
T 2f9y_B          134 MGSVVGARFVRAVEQALEDNCPLICFSASGGAR  166 (304)
T ss_dssp             BCTHHHHHHHHHHHHHHHHTCCEEEEEEESSBC
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             324444563359999997299769984588803


No 303
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4
Probab=28.20  E-value=7.2  Score=16.48  Aligned_cols=29  Identities=17%  Similarity=0.532  Sum_probs=14.4

Q ss_pred             EECC--CCCCCCCCCC--CCCCCCCCCCCEEECCC
Q ss_conf             7704--3265775010--33786544521010035
Q gi|254781172|r  429 SFPS--FCPICQSRVV--RDLNPKTGKLVAAHRCT  459 (731)
Q Consensus       429 ~~P~--~CP~Cgs~l~--~~~~~~~~~~~~~~rC~  459 (731)
                      .+|+  .||.||.+-.  ...+.+  .....+.|.
T Consensus        19 kL~t~F~CPfCnh~~sV~v~idkk--~~ig~l~C~   51 (85)
T 1wii_A           19 TLETQFTCPFCNHEKSCDVKMDRA--RNTGVISCT   51 (85)
T ss_dssp             CCSSCCCCTTTCCSSCEEEEEETT--TTEEEEEES
T ss_pred             CCCCEECCCCCCCCCEEEEEEEEC--CCEEEEEEE
T ss_conf             999637199789987599999933--798999985


No 304
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}
Probab=28.15  E-value=15  Score=14.02  Aligned_cols=17  Identities=29%  Similarity=0.770  Sum_probs=9.6

Q ss_pred             EEEECCCCCCCCCCCCC
Q ss_conf             47770432657750103
Q gi|254781172|r  427 PFSFPSFCPICQSRVVR  443 (731)
Q Consensus       427 ~~~~P~~CP~Cgs~l~~  443 (731)
                      .|..--.||-|+.+|++
T Consensus        27 ~~~~~a~CPdC~~~Lq~   43 (81)
T 2jrp_A           27 DFSLQALCPDCRQPLQV   43 (81)
T ss_dssp             EEEEEEECSSSCSCCCE
T ss_pred             HHHHEEECCCCCCHHHH
T ss_conf             46646648764367999


No 305
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: NAP; 2.07A {Thermotoga maritima MSB8} SCOP: c.2.1.2
Probab=27.81  E-value=20  Score=13.01  Aligned_cols=14  Identities=7%  Similarity=0.235  Sum_probs=8.4

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++..+|.++.+.|-
T Consensus       250 a~~itG~~i~vDGG  263 (267)
T 1vl8_A          250 AKYVTGQIIFVDGG  263 (267)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             26966876987858


No 306
>3jyw_0 60S ribosomal protein L32; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus}
Probab=27.77  E-value=9.4  Score=15.60  Aligned_cols=56  Identities=20%  Similarity=0.261  Sum_probs=35.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHHH-HHHHHHHHCCCCCCEEEEEHHHHCCHH
Q ss_conf             0100354344114466553321301231035410-355556530576540454101101067
Q gi|254781172|r  454 AAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG-KQQLDFFFKSEDPAFSIRIPADIFTLQ  514 (731)
Q Consensus       454 ~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GLG-~k~Ie~L~e~~~~~g~I~~~~DLy~L~  514 (731)
                      ..||.+.+.+..-+     .+|-++..|---|.| ++.+.-|.-.|+...+|.++.||-.|.
T Consensus        17 ~~WRkPrGidnk~R-----r~~kg~~~~p~iGYgs~k~~Rgl~PsG~~~vlV~nv~eLe~l~   73 (109)
T 3jyw_0           17 ENWRKQKGIDSVVR-----RRFRGNISQPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLT   73 (109)
T ss_dssp             CSCCCCCSSCCTTT-----SCCSSSCCCCCTTSSCCTTCCCCSTTCCCCCCCCSSSSCTTCC
T ss_pred             CCCCCCCCCCCCEE-----CCCCCCCCCCCCCCCCCHHHCCCCCCCCEEEEECCHHHHHHHH
T ss_conf             24317888756410-----2226766787555677687646487878899854757778885


No 307
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3ch6_A* 2irw_A* 2ilt_A* 2bel_A* 1y5m_A* 1y5r_A* 1xse_A* ...
Probab=27.58  E-value=20  Score=12.99  Aligned_cols=13  Identities=8%  Similarity=-0.031  Sum_probs=5.4

Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             0145689999875
Q gi|254781172|r  533 VSVTNLYDSINKR  545 (731)
Q Consensus       533 Ksa~nL~~sIe~s  545 (731)
                      +-|..++.++...
T Consensus       234 ~va~~i~~~~~~~  246 (286)
T 1xu9_A          234 ECALEIIKGGALR  246 (286)
T ss_dssp             HHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999887429


No 308
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*
Probab=27.27  E-value=21  Score=12.95  Aligned_cols=17  Identities=35%  Similarity=0.558  Sum_probs=7.7

Q ss_pred             CCHHHHHHHH-HHHHHHH
Q ss_conf             0101111689-9999988
Q gi|254781172|r  557 LGIRHVGAEI-ARSLAKY  573 (731)
Q Consensus       557 LGI~~vG~~~-Ak~La~~  573 (731)
                      .|.||.|++| |+.||+.
T Consensus         8 ~G~~GsGKSTv~~~LA~~   25 (173)
T 1e6c_A            8 VGARGCGMTTVGRELARA   25 (173)
T ss_dssp             ESCTTSSHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHH
T ss_conf             889999889999999999


No 309
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A*
Probab=27.21  E-value=21  Score=12.94  Aligned_cols=14  Identities=21%  Similarity=0.287  Sum_probs=7.9

Q ss_pred             CCCCCCCEEEEECC
Q ss_conf             88216866999725
Q gi|254781172|r  644 SSEIENKKLVFTGT  657 (731)
Q Consensus       644 ~~~l~gk~vV~TGt  657 (731)
                      ++.++|.++.+.|-
T Consensus       240 s~~itG~~i~VDGG  253 (265)
T 1qsg_A          240 SAGISGEVVHVDGG  253 (265)
T ss_dssp             GTTCCSCEEEESTT
T ss_pred             HCCCCCCEEEECCC
T ss_conf             25946855888968


No 310
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B*
Probab=27.19  E-value=9.8  Score=15.45  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=9.4

Q ss_pred             HHHCCHHHHHHHHCCCCCCCCCCCC
Q ss_conf             1101067775310001000134210
Q gi|254781172|r  508 ADIFTLQRRQQTSTTKIENILGFGD  532 (731)
Q Consensus       508 ~DLy~L~~~~~~~~~~l~~l~Gfge  532 (731)
                      ..|-.+....-++-.+++.+-|++.
T Consensus        74 e~ir~~R~~~glsQ~elA~~lg~~~   98 (133)
T 3o9x_A           74 EFIVKVRKKLSLTQKEASEIFGGGV   98 (133)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHCSCT
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCH
T ss_conf             9999999984999999999959999


No 311
>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidoreductase; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1
Probab=27.03  E-value=21  Score=12.92  Aligned_cols=19  Identities=16%  Similarity=0.006  Sum_probs=9.2

Q ss_pred             CCHHHHHHHHHHHHHCCCC
Q ss_conf             6979999999999733877
Q gi|254781172|r  617 QNPRNICAVEALLKEVSPS  635 (731)
Q Consensus       617 ~~~~n~~~i~~L~~~~~~~  635 (731)
                      .++-++..+..|.+.+...
T Consensus       130 ~~p~~~~ni~~L~~~G~~v  148 (194)
T 1p3y_1          130 NKTVVSRNIEQLRKDGHIV  148 (194)
T ss_dssp             TCHHHHHHHHHHHHHTCEE
T ss_pred             HHHHHHHHHHHHHHCCCEE
T ss_conf             5378999999999679999


No 312
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}
Probab=26.90  E-value=21  Score=12.90  Aligned_cols=13  Identities=15%  Similarity=0.176  Sum_probs=8.7

Q ss_pred             CCCCCCCEEEEEC
Q ss_conf             8821686699972
Q gi|254781172|r  644 SSEIENKKLVFTG  656 (731)
Q Consensus       644 ~~~l~gk~vV~TG  656 (731)
                      ++..+|.++.+.|
T Consensus       251 s~~itG~~i~VdG  263 (266)
T 3o38_A          251 SSYMTGEVVSVSS  263 (266)
T ss_dssp             GTTCCSCEEEESS
T ss_pred             HCCCCCCEEEECC
T ss_conf             3797685688649


No 313
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5
Probab=26.44  E-value=20  Score=13.02  Aligned_cols=12  Identities=33%  Similarity=0.778  Sum_probs=8.1

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             326577501033
Q gi|254781172|r  433 FCPICQSRVVRD  444 (731)
Q Consensus       433 ~CP~Cgs~l~~~  444 (731)
                      .||.|+++..++
T Consensus        29 ~CP~C~seytY~   40 (138)
T 2akl_A           29 PCPQCNSEYTYE   40 (138)
T ss_dssp             CCTTTCCCCCEE
T ss_pred             CCCCCCCCCEEC
T ss_conf             898889902373


No 314
>3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O
Probab=26.39  E-value=14  Score=14.27  Aligned_cols=31  Identities=26%  Similarity=0.337  Sum_probs=15.8

Q ss_pred             CCCEEEEECCCCCCCH---------------HHHHHHHHHCCCEEE
Q ss_conf             6866999725889987---------------899999998298499
Q gi|254781172|r  648 ENKKLVFTGTLQKIQR---------------HKAQEYVTQLGAVVS  678 (731)
Q Consensus       648 ~gk~vV~TGtl~~~~R---------------~e~~~~ie~~Ggkv~  678 (731)
                      .|+++|+-|+.-+--|               +.+.+.|++.||++.
T Consensus        57 e~~~vVV~GkVl~dg~l~~vpkl~V~Al~fS~~Ar~kI~~aGG~~l  102 (121)
T 3jyw_O           57 ANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECI  102 (121)
T ss_dssp             SSSEEEESSCBCCCSCCCSSSCCCEECSSBCTTTTTHHHHHTCCBC
T ss_pred             CCCEEEEEEEECCCCEEECCCCEEEEEEECCHHHHHHHHHCCCEEE
T ss_conf             7987999723738821411676279998625799999997499797


No 315
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3- hydroxybutyryl-COA dehydrogenase, MHBD; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*
Probab=26.37  E-value=21  Score=12.83  Aligned_cols=14  Identities=7%  Similarity=0.309  Sum_probs=7.8

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       246 ~~iTG~~i~vDGG~  259 (265)
T 2o23_A          246 PFLNGEVIRLDGAI  259 (265)
T ss_dssp             TTCCSCEEEESTTC
T ss_pred             CCCCCCEEEECCCE
T ss_conf             99989979869881


No 316
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ protein, ATP-binding, DNA-binding; 4.35A {Sulfolobus solfataricus}
Probab=26.32  E-value=21  Score=12.82  Aligned_cols=20  Identities=10%  Similarity=0.225  Sum_probs=10.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHH
Q ss_conf             00134210014568999987
Q gi|254781172|r  525 ENILGFGDVSVTNLYDSINK  544 (731)
Q Consensus       525 ~~l~GfgeKsa~nL~~sIe~  544 (731)
                      -+++-+.+.--..|++++|.
T Consensus       398 DE~~~~~~~~~~~L~eamE~  417 (595)
T 3f9v_A          398 DEIDKMRDEDRVAIHEAMEQ  417 (595)
T ss_dssp             TTTTCCCSHHHHHHHHHHHS
T ss_pred             HHHHHCCHHHHHHHHHHHHH
T ss_conf             03755277789999987651


No 317
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, fatty acid biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii}
Probab=26.32  E-value=21  Score=12.82  Aligned_cols=15  Identities=27%  Similarity=0.388  Sum_probs=9.4

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       232 s~~itG~~i~vdGG~  246 (249)
T 3f9i_A          232 ASYITGQTLHVNGGM  246 (249)
T ss_dssp             GTTCCSCEEEESTTS
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             269768669978987


No 318
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, lipid metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}
Probab=26.26  E-value=21  Score=12.82  Aligned_cols=15  Identities=33%  Similarity=0.366  Sum_probs=9.8

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       241 s~~itG~~i~vDGG~  255 (264)
T 2pd6_A          241 SGYITGTSVEVTGGL  255 (264)
T ss_dssp             GTTCCSCEEEESTTC
T ss_pred             HCCCCCCEEEECCHH
T ss_conf             259758679989816


No 319
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1
Probab=26.19  E-value=22  Score=12.81  Aligned_cols=24  Identities=13%  Similarity=-0.103  Sum_probs=19.0

Q ss_pred             CCCCHHHHHCCCCCCHHHHHHHHH
Q ss_conf             511778761388867899999999
Q gi|254781172|r  591 NNDDWLSLIRVPLVGDIIAQAIVE  614 (731)
Q Consensus       591 ~~~~~e~L~~I~GiG~~~A~si~~  614 (731)
                      .-.+.++|..|+|||+..++.+-+
T Consensus        50 ~P~t~~eL~~I~Gvg~~k~~~yG~   73 (89)
T 1wud_A           50 MPITASEMLSVNGVGMRKLERFGK   73 (89)
T ss_dssp             CCCSHHHHHTSTTCCHHHHHHHHH
T ss_pred             CCCCHHHHCCCCCCCHHHHHHHHH
T ss_conf             889999980799989999999999


No 320
>2fhd_A RAD9 homolog, DNA repair protein RHP9/CRB2; tamdem tudor domains, cell cycle; HET: DNA MSE PO4; 2.40A {Schizosaccharomyces pombe}
Probab=26.13  E-value=5  Score=17.71  Aligned_cols=23  Identities=22%  Similarity=0.222  Sum_probs=16.9

Q ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHCC
Q ss_conf             468440768999835870256654101
Q gi|254781172|r  392 GRDIRVGDRVLVKRAGEVIPKVVDIIV  418 (731)
Q Consensus       392 ~~~I~iGd~V~I~RaGdVIP~I~~Vi~  418 (731)
                      +-++||||.|.|    |=+|++.-.|.
T Consensus        61 rLeLRiGD~VKV----d~vpK~~hiVv   83 (153)
T 2fhd_A           61 RFFLKKGDVVQS----TRLGKIKHTVV   83 (153)
T ss_dssp             ESCCCTTCEEEE----TTSTTCCEEEE
T ss_pred             HCCCCCCCEEEE----CCCCCCCEEEE
T ss_conf             102236987885----89887768998


No 321
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2
Probab=26.09  E-value=22  Score=12.80  Aligned_cols=15  Identities=20%  Similarity=0.217  Sum_probs=10.2

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       253 s~~iTG~~i~VDGG~  267 (273)
T 1ae1_A          253 ASYITGQIIWADGGF  267 (273)
T ss_dssp             GTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             269768379848895


No 322
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens}
Probab=25.94  E-value=22  Score=12.78  Aligned_cols=63  Identities=17%  Similarity=0.316  Sum_probs=39.3

Q ss_pred             CCCCEEEE------ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEE---ECHHHHHHH
Q ss_conf             16866999------725889987899999998298499811163217997788886379899749917---379999999
Q gi|254781172|r  647 IENKKLVF------TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI---MNEEQFLFL  717 (731)
Q Consensus       647 l~gk~vV~------TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~I---i~e~ef~~l  717 (731)
                      ..|+++++      ||    -|=.++.+.+++.|++|...+     .+ +.-..+ ..++-+++|||+   ++-+++++.
T Consensus       109 ~~g~~VlIVDDvitTG----~T~~~ai~~l~~~G~~v~~v~-----vi-vdr~~~-~~~~l~~~gi~~~sL~~l~dl~~~  177 (205)
T 2wns_A          109 NPGETCLIIEDVVTSG----SSVLETVEVLQKEGLKVTDAI-----VL-LDREQG-GKDKLQAHGIRLHSVCTLSKMLEI  177 (205)
T ss_dssp             CTTCBEEEEEEEESSS----HHHHHHHHHHHHTTCBCCEEE-----EE-EECCSS-HHHHHHTTTCEEEEEEEHHHHHHH
T ss_pred             CCCCEEEEEEEEHHCC----CCHHHHHHHHHHCCCEEEEEE-----EE-EECCCC-HHHHHHHCCCCEEEECCHHHHHHH
T ss_conf             6664599996102127----067989999986898899999-----99-977616-599999779949997509999999


Q ss_pred             HHH
Q ss_conf             988
Q gi|254781172|r  718 LQQ  720 (731)
Q Consensus       718 l~~  720 (731)
                      +.+
T Consensus       178 ~~~  180 (205)
T 2wns_A          178 LEQ  180 (205)
T ss_dssp             HHH
T ss_pred             HHH
T ss_conf             998


No 323
>3fac_A Putative uncharacterized protein; complete proteome, structural genomics, PSI-2, protein structure initiative; 2.50A {Rhodobacter sphaeroides 2}
Probab=25.88  E-value=22  Score=12.77  Aligned_cols=16  Identities=19%  Similarity=0.357  Sum_probs=11.5

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             0432657750103378
Q gi|254781172|r  431 PSFCPICQSRVVRDLN  446 (731)
Q Consensus       431 P~~CP~Cgs~l~~~~~  446 (731)
                      --+||.||+.+-....
T Consensus        67 ~~FC~~CGt~l~~~~~   82 (118)
T 3fac_A           67 HWFCRTCGIYTHHQRR   82 (118)
T ss_dssp             EEEETTTCCEEEEECS
T ss_pred             EEECCCCCCEECCCCC
T ss_conf             0716779983223058


No 324
>3d55_A Antitoxin, uncharacterized protein RV3357/MT3465; tetramer, toxin neutraliSer, toxin inhibitor; 2.13A {Mycobacterium tuberculosis} PDB: 3cto_A
Probab=25.84  E-value=22  Score=12.76  Aligned_cols=26  Identities=27%  Similarity=0.438  Sum_probs=19.8

Q ss_pred             EEEECHHHHHHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             9985202123455643148543342345677
Q gi|254781172|r  191 VYISKNDFLALNDEMIAVGRKPYANPRNAAS  221 (731)
Q Consensus       191 v~m~~~~F~~lN~~~~~~g~~~f~NpRN~aa  221 (731)
                      |+|+.++|+.+.+...-     ++||.|++.
T Consensus        36 Vlis~~dyesl~ETl~L-----ls~p~na~~   61 (91)
T 3d55_A           36 VLMSADDYDAWQETVYL-----LRSPENARR   61 (91)
T ss_dssp             EEEEHHHHHHHHHHHHH-----TTSHHHHHH
T ss_pred             EEEEHHHHHHHHHHHHH-----HCCHHHHHH
T ss_conf             99669999889999999-----769999999


No 325
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 2jjy_A*
Probab=25.61  E-value=22  Score=12.73  Aligned_cols=16  Identities=6%  Similarity=0.129  Sum_probs=10.9

Q ss_pred             CCCCCCCEEEEECCCC
Q ss_conf             8821686699972588
Q gi|254781172|r  644 SSEIENKKLVFTGTLQ  659 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~  659 (731)
                      .+.++|.++.+.|-+.
T Consensus       257 s~~itG~~i~VDGG~~  272 (280)
T 3nrc_A          257 ATGITGEVVHVDAGYH  272 (280)
T ss_dssp             GTTCCSCEEEESTTGG
T ss_pred             HCCCCCCEEEECCCHH
T ss_conf             2694684578798851


No 326
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}
Probab=25.49  E-value=22  Score=12.72  Aligned_cols=44  Identities=20%  Similarity=0.327  Sum_probs=25.0

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHCCCCCCCC-CCEEEECCCCCCCCCCCC
Q ss_conf             68440768999835870256654101235787-304777043265775010
Q gi|254781172|r  393 RDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD-AQPFSFPSFCPICQSRVV  442 (731)
Q Consensus       393 ~~I~iGd~V~I~RaGdVIP~I~~Vi~~~r~~~-~~~~~~P~~CP~Cgs~l~  442 (731)
                      ++|..|+.+.|.----.-|.-      .|... ...|-|-=.||.|-.+..
T Consensus       240 ~~I~~GeEltisY~~~~~~~~------~R~~~L~~~y~F~C~C~rC~~~~~  284 (490)
T 3n71_A          240 GKISEGEELTVSYIDFLHLSE------ERRRQLKKQYYFDCSCEHCQKGLK  284 (490)
T ss_dssp             SCBCTTCBCEECSSCSCSCHH------HHHHHHHHHHSSCCCCHHHHHTTT
T ss_pred             CCCCCCCEEEEECCCCCCCHH------HHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             715999998873126436879------999999647992846988899885


No 327
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}
Probab=25.45  E-value=22  Score=12.71  Aligned_cols=13  Identities=15%  Similarity=0.279  Sum_probs=5.2

Q ss_pred             EECCCCHHHHHHH
Q ss_conf             8659865566699
Q gi|254781172|r  152 ALRGDGHSGEDVS  164 (731)
Q Consensus       152 ~TRGdG~~GeDVT  164 (731)
                      +|=|.+-+|.-+.
T Consensus        10 ITGas~GIG~a~a   22 (245)
T 3e9n_A           10 VTGATGGMGIEIV   22 (245)
T ss_dssp             EESTTSHHHHHHH
T ss_pred             EECCCCHHHHHHH
T ss_conf             9289758999999


No 328
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori}
Probab=25.42  E-value=16  Score=13.78  Aligned_cols=10  Identities=20%  Similarity=0.371  Sum_probs=6.0

Q ss_pred             CCCCCCCCCC
Q ss_conf             3265775010
Q gi|254781172|r  433 FCPICQSRVV  442 (731)
Q Consensus       433 ~CP~Cgs~l~  442 (731)
                      .|+.||.+..
T Consensus        75 ~C~~Cg~~~~   84 (119)
T 2kdx_A           75 ECKDCSHVFK   84 (119)
T ss_dssp             ECSSSSCEEC
T ss_pred             ECCCCCCEEC
T ss_conf             9878998833


No 329
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A
Probab=25.33  E-value=22  Score=12.70  Aligned_cols=15  Identities=7%  Similarity=0.016  Sum_probs=9.0

Q ss_pred             CHHHCCCHHHHHHHH
Q ss_conf             702159999999999
Q gi|254781172|r   97 SLEKIWNIEDLRKFI  111 (731)
Q Consensus        97 SL~k~~~~~el~~w~  111 (731)
                      .+.++.+.+||.+.|
T Consensus        94 ~i~~a~t~~eLEDlY  108 (785)
T 3bzc_A           94 DIKLADTKTRLEDLY  108 (785)
T ss_dssp             HHHHCCSHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHH
T ss_conf             998579788999856


No 330
>1t3o_A Carbon storage regulator; CSRA, CSRB, CSRC, mostly beta strands, RNA binding protein, beta sheet surface; NMR {Bacillus subtilis}
Probab=25.29  E-value=1.4  Score=21.98  Aligned_cols=52  Identities=21%  Similarity=0.312  Sum_probs=25.7

Q ss_pred             EECCEEEEEEECCCCH---HHHHHHHHHHHHCCCCCCCCCCCCCEE-EEEEEEEEE
Q ss_conf             8599899888659865---566699977531024322335445504-899999985
Q gi|254781172|r  143 YEKGKFVYAALRGDGH---SGEDVSACIRAIPTIPRVLSLNIPEII-EVRGEVYIS  194 (731)
Q Consensus       143 Y~~G~L~~a~TRGdG~---~GeDVT~n~~~i~~iP~~l~~~~~~~i-eiRGEv~m~  194 (731)
                      |..|.-...+||--|+   +|+||+-.+..|.+=--+|++..|..+ ..|.|+|-.
T Consensus        16 ~~~g~~MLVLtRK~GEsI~IgddI~I~Vl~i~~~~VkLGIeAP~~v~I~ReEi~~~   71 (95)
T 1t3o_A           16 HIEGRHMLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLT   71 (95)
T ss_dssp             CCCCCEEEEEECTTCCCEEETTTEEECCCEECSSCEEEEEEESSCCCCCCSSCSCC
T ss_pred             CCCCCEEEEEECCCCCEEEECCCEEEEEEEEECCEEEEEEECCCCCCEEHHHHHHH
T ss_conf             22797889995427998996999899999980998999998899980969999999


No 331
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2
Probab=25.27  E-value=22  Score=12.69  Aligned_cols=10  Identities=40%  Similarity=0.597  Sum_probs=4.3

Q ss_pred             CCCCEEEEEC
Q ss_conf             1686699972
Q gi|254781172|r  647 IENKKLVFTG  656 (731)
Q Consensus       647 l~gk~vV~TG  656 (731)
                      .+|.++.+.|
T Consensus       251 itG~~i~VDG  260 (278)
T 1spx_A          251 IIGHQLVVDG  260 (278)
T ss_dssp             CCSCEEEEST
T ss_pred             EECCEEEECC
T ss_conf             2381788696


No 332
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 1iwc_A 1iwf_A
Probab=25.26  E-value=15  Score=14.06  Aligned_cols=11  Identities=9%  Similarity=0.054  Sum_probs=5.9

Q ss_pred             CEEEEEEEEEE
Q ss_conf             50489999998
Q gi|254781172|r  183 EIIEVRGEVYI  193 (731)
Q Consensus       183 ~~ieiRGEv~m  193 (731)
                      +...++|++.+
T Consensus       256 GT~v~~G~~~~  266 (1034)
T 3ixz_A          256 STMCLEGTAQG  266 (1034)
T ss_pred             EEEEEEEEEEE
T ss_conf             67998668999


No 333
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus}
Probab=25.13  E-value=22  Score=12.67  Aligned_cols=48  Identities=15%  Similarity=0.241  Sum_probs=24.2

Q ss_pred             HHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             55565305765404541011010677753100010001342100145689999875223466677630101
Q gi|254781172|r  490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIR  560 (731)
Q Consensus       490 ~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~sK~~~L~r~L~ALGI~  560 (731)
                      .+++|.+.    |+|....+=+.|+..              |.+.|..++     .+..-+.+||.-||++
T Consensus        51 ~l~~L~~~----Glv~~~~~gi~LT~~--------------G~~~A~~i~-----rrHrl~e~fL~~lgi~   98 (139)
T 2x4h_A           51 EVSHLEEK----GLVKKKEDGVWITNN--------------GTRSINYLI-----KAHRVIEILLVNIGID   98 (139)
T ss_dssp             HHHHHHHT----TSEEEETTEEEECHH--------------HHHHHHHHH-----HHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHC----CCEEEECCCCEECHH--------------HHHHHHHHH-----HHHHHHHHHHHHCCCC
T ss_conf             99999988----995450477157888--------------999999999-----9999999999994999


No 334
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1
Probab=25.12  E-value=17  Score=13.60  Aligned_cols=12  Identities=25%  Similarity=0.897  Sum_probs=8.5

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             432657750103
Q gi|254781172|r  432 SFCPICQSRVVR  443 (731)
Q Consensus       432 ~~CP~Cgs~l~~  443 (731)
                      .+||.||..+..
T Consensus        31 ~FCpkCGn~TL~   42 (79)
T 2con_A           31 VFCGHCGNKTLK   42 (79)
T ss_dssp             CSCSSSCCSCCE
T ss_pred             CCCCCCCCCCCE
T ss_conf             327547988015


No 335
>3a46_A Formamidopyrimidine-DNA glycosylase; helix two turns helix, zinc-LESS finger, hydrolase, THF, glycosidase, lyase, multifunctional enzyme; HET: DNA 3DR; 2.20A {Acanthamoeba polyphaga mimivirus} PDB: 3a45_A* 3a42_A
Probab=24.96  E-value=22  Score=12.80  Aligned_cols=13  Identities=8%  Similarity=0.286  Sum_probs=5.3

Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             0432657750103
Q gi|254781172|r  431 PSFCPICQSRVVR  443 (731)
Q Consensus       431 P~~CP~Cgs~l~~  443 (731)
                      |..||.|++++.+
T Consensus       259 pc~~~~c~~~I~~  271 (289)
T 3a46_A          259 PNGNKVIADKIIG  271 (289)
T ss_dssp             TTSCBCEEECCSC
T ss_pred             CCCCCCCCCEEEE
T ss_conf             8888757877999


No 336
>2iih_A Molybdenum cofactor biosynthesis protein C; MOAC, molybdenum cofactor (MOCO), MOCO biosynthesis, structural genomics, NPPSFA; 1.75A {Thermus thermophilus HB8} PDB: 2ide_A 3jqj_A 3jqk_A 3jqm_A*
Probab=24.61  E-value=16  Score=13.78  Aligned_cols=40  Identities=20%  Similarity=0.277  Sum_probs=24.3

Q ss_pred             EEEEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCC
Q ss_conf             4899999985202123455643148543342345677775234
Q gi|254781172|r  185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRL  227 (731)
Q Consensus       185 ieiRGEv~m~~~~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~  227 (731)
                      -.-+|.++|+.+.|+.+-+.....|. +|.-+|  .||.+-.|
T Consensus        26 A~A~g~I~l~~~~~~~i~~~~~~KGd-vl~~Ar--iAgImaaK   65 (157)
T 2iih_A           26 ATAEAFVELTEEALSALEKGGVGKGD-PLVVAQ--LAGILAAK   65 (157)
T ss_dssp             EEEEEEEECCHHHHHHHTTTCSSSCC-HHHHHH--HHHHHHHH
T ss_pred             EEEEEEEEECHHHHHHHHHCCCCCCC-HHHHHH--HHHHHHHH
T ss_conf             99999999899999999847887787-889699--99988742


No 337
>3lqk_A Dipicolinate synthase subunit B; flavoprotein, PSI2, MCSG, structural genomics, protein structure initiative; 2.10A {Bacillus halodurans}
Probab=24.59  E-value=23  Score=12.60  Aligned_cols=12  Identities=25%  Similarity=0.420  Sum_probs=5.1

Q ss_pred             HHHHHHHCCCCC
Q ss_conf             689999759966
Q gi|254781172|r  257 MLQKMRCLGFPV  268 (731)
Q Consensus       257 ~l~~L~~~GF~v  268 (731)
                      .++.|.+.|..|
T Consensus        27 li~~L~~~g~~V   38 (201)
T 3lqk_A           27 QMERLVELGAKV   38 (201)
T ss_dssp             HHHHHHHTTCEE
T ss_pred             HHHHHHHCCCEE
T ss_conf             999999889969


No 338
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, Zn-binding protein, DNA-binding, transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A
Probab=24.51  E-value=18  Score=13.43  Aligned_cols=10  Identities=20%  Similarity=0.893  Sum_probs=4.7

Q ss_pred             CCCCCCCCCC
Q ss_conf             4326577501
Q gi|254781172|r  432 SFCPICQSRV  441 (731)
Q Consensus       432 ~~CP~Cgs~l  441 (731)
                      ..||.||+.+
T Consensus        37 ~~C~~CGE~i   46 (78)
T 3ga8_A           37 LYCVHCEESI   46 (78)
T ss_dssp             EEETTTCCEE
T ss_pred             CCCCCCCCEE
T ss_conf             5279998777


No 339
>3ojf_A Enoyl-[acyl-carrier-protein] reductase (FABL) (Na; enoyl-ACP reductase, tetramer, rossmann fold, NAD(P) binding oxidoreductase; HET: IMJ NDP; 2.20A {Bacillus cereus} PDB: 2qio_A* 3oje_A
Probab=24.14  E-value=23  Score=12.54  Aligned_cols=13  Identities=0%  Similarity=0.120  Sum_probs=5.9

Q ss_pred             CCCCCCEEEEECC
Q ss_conf             8216866999725
Q gi|254781172|r  645 SEIENKKLVFTGT  657 (731)
Q Consensus       645 ~~l~gk~vV~TGt  657 (731)
                      +.++|.++.+.|-
T Consensus       239 ~~iTG~~i~vDGG  251 (257)
T 3ojf_A          239 RGVTGENIHVDSG  251 (257)
T ss_dssp             TTCCSCEEEESTT
T ss_pred             CCCCCCEEEECCC
T ss_conf             6936865887968


No 340
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris}
Probab=23.86  E-value=24  Score=12.50  Aligned_cols=13  Identities=8%  Similarity=-0.074  Sum_probs=7.7

Q ss_pred             EEEECCCCHHHHH
Q ss_conf             8886598655666
Q gi|254781172|r  150 YAALRGDGHSGED  162 (731)
Q Consensus       150 ~a~TRGdG~~GeD  162 (731)
                      +.+|+||-.+=+-
T Consensus        90 ~ii~~~D~~YP~~  102 (382)
T 3maj_A           90 ELVAPGETGYPTR  102 (382)
T ss_dssp             EEECTTSTTSCHH
T ss_pred             EEECCCCCCCHHH
T ss_conf             9999784312398


No 341
>1s1i_9 L37A, YL35, 60S ribosomal protein L43; 80S ribosome, 60S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1
Probab=23.76  E-value=23  Score=12.54  Aligned_cols=30  Identities=17%  Similarity=0.457  Sum_probs=17.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHH
Q ss_conf             043265775010337865445210100354344114466
Q gi|254781172|r  431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQL  469 (731)
Q Consensus       431 P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~  469 (731)
                      .-.||.||..-++...-      -.|.|.   .|-..+-
T Consensus        35 ky~Cp~Cgk~~vkR~a~------GIW~C~---kC~~~~A   64 (91)
T 1s1i_9           35 RYDCSFCGKKTVKRGAA------GIWTCS---CCKKTVA   64 (91)
T ss_dssp             CCCCTTTCSSCCCEETT------TEECCS---SSCCCEE
T ss_pred             CCCCCCCCCCEEEEEEE------EEEECC---CCCCEEE
T ss_conf             82398999973489988------886879---9998886


No 342
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A
Probab=23.75  E-value=24  Score=12.48  Aligned_cols=36  Identities=8%  Similarity=0.042  Sum_probs=24.5

Q ss_pred             CCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             251177876138886789999999996697999999999973
Q gi|254781172|r  590 HNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE  631 (731)
Q Consensus       590 ~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~  631 (731)
                      ..-.+.++|..|+|||+..++.+-+|+      ..+.+....
T Consensus        51 ~~P~t~~eL~~I~G~g~~k~~ryG~~l------~~I~~~~~~   86 (103)
T 2e1f_A           51 MRPTTVENVKRIDGVSEGKAAMLAPLL------EVIKHFCQT   86 (103)
T ss_dssp             HCCCSHHHHTTSTTCCHHHHHHTHHHH------HHHHHHHHH
T ss_pred             HCCCCHHHHHCCCCCCHHHHHHHHHHH------HHHHHHHHH
T ss_conf             789999999378998999999998999------999999998


No 343
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*
Probab=23.75  E-value=24  Score=12.48  Aligned_cols=15  Identities=27%  Similarity=0.397  Sum_probs=9.3

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++.++|.++.+.|-+
T Consensus       232 s~~itG~~i~vdGG~  246 (249)
T 2ew8_A          232 ASFITGQTLAVDGGM  246 (249)
T ss_dssp             GTTCCSCEEEESSSC
T ss_pred             HCCCCCCEEEECCCE
T ss_conf             269768778978783


No 344
>3hcg_A Peptide methionine sulfoxide reductase MSRA/MSRB; PILB, methionine sulfoxide reductase B, reduced form, disulfide bond; 1.82A {Neisseria meningitidis serogroup A} PDB: 3hch_A* 1l1d_A
Probab=23.53  E-value=17  Score=13.67  Aligned_cols=47  Identities=13%  Similarity=0.191  Sum_probs=24.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             32657750103378654452101003543441144665533213012310354103
Q gi|254781172|r  433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK  488 (731)
Q Consensus       433 ~CP~Cgs~l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF~SK~aldI~GLG~  488 (731)
                      .|-.||+.|=..-...........+|.|+.         -..|+.++-|+-+|.|+
T Consensus        94 ~C~~Cg~HLGHVF~DGp~~~~g~RyCINS~---------sL~F~p~~~~~~~gyg~  140 (146)
T 3hcg_A           94 RSHAADSHLGHVFPDGPRDKGGLRYCINGA---------SLKFIPLEQMDAAGYGA  140 (146)
T ss_dssp             EETTTCCEEEEEESCSCGGGTSCEEEECGG---------GEEEEEHHHHHHHTCGG
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCEEECCEE---------EEEEEEHHHHHHCCHHH
T ss_conf             457889724735599988999878402633---------68877667855533298


No 345
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}
Probab=23.03  E-value=18  Score=13.40  Aligned_cols=11  Identities=27%  Similarity=0.289  Sum_probs=6.1

Q ss_pred             CCCCCCCCCCC
Q ss_conf             04326577501
Q gi|254781172|r  431 PSFCPICQSRV  441 (731)
Q Consensus       431 P~~CP~Cgs~l  441 (731)
                      |..||.||+-.
T Consensus        56 ~~RC~eCG~~f   66 (80)
T 2odx_A           56 VARCWECGSVY   66 (80)
T ss_dssp             EEECSSSCCEE
T ss_pred             CCCCCCCCCEE
T ss_conf             42356688699


No 346
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1
Probab=22.92  E-value=19  Score=13.20  Aligned_cols=18  Identities=28%  Similarity=0.564  Sum_probs=12.6

Q ss_pred             EECCCCCCCCCCCCCCCC
Q ss_conf             770432657750103378
Q gi|254781172|r  429 SFPSFCPICQSRVVRDLN  446 (731)
Q Consensus       429 ~~P~~CP~Cgs~l~~~~~  446 (731)
                      .|--.||.|..+++|..+
T Consensus        30 ~Me~~CP~Cq~~L~~~~g   47 (101)
T 2jne_A           30 HMELHCPQCQHVLDQDNG   47 (101)
T ss_dssp             -CCCBCSSSCSBEEEETT
T ss_pred             CCCCCCCCCCCCCEECCC
T ss_conf             410458556881224799


No 347
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1
Probab=22.60  E-value=25  Score=12.32  Aligned_cols=18  Identities=22%  Similarity=0.338  Sum_probs=8.4

Q ss_pred             CCHHHHHHHH-HHHHHHHC
Q ss_conf             0101111689-99999882
Q gi|254781172|r  557 LGIRHVGAEI-ARSLAKYY  574 (731)
Q Consensus       557 LGI~~vG~~~-Ak~La~~f  574 (731)
                      +|-||.|++| |+.|+++|
T Consensus         9 ~G~pGsGKsT~a~~Lae~~   27 (196)
T 1tev_A            9 LGGPGAGKGTQCARIVEKY   27 (196)
T ss_dssp             ECCTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHH
T ss_conf             8999999899999999985


No 348
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae}
Probab=22.41  E-value=13  Score=14.49  Aligned_cols=39  Identities=21%  Similarity=0.496  Sum_probs=21.6

Q ss_pred             EEECCCCCCCCCC---CCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHH
Q ss_conf             7770432657750---10337865445210100354344114466553321
Q gi|254781172|r  428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHF  475 (731)
Q Consensus       428 ~~~P~~CP~Cgs~---l~~~~~~~~~~~~~~~rC~n~~~Cpaq~~~~i~hF  475 (731)
                      ......||.||+.   ++.+...  +    ...|.   +|-.-+..+++..
T Consensus        18 lNitl~CPeCGS~~t~IVeD~s~--G----EiVCs---dCGLVIEErIIDe   59 (197)
T 3k1f_M           18 LNIVLTCPECKVYPPKIVERFSE--G----DVVCA---LCGLVLSDKLVDT   59 (197)
T ss_dssp             CCCCCCCTTTCCSSCCEEEEGGG--T----EEEET---TTCBBCCCCCBCH
T ss_pred             CEEEEECCCCCCCCCEEEEECCC--C----CEECC---CCCEEECCCCCCC
T ss_conf             86546899999989989897998--9----68971---4892924533579


No 349
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* 3ag3_F* ...
Probab=22.20  E-value=19  Score=13.27  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=4.9

Q ss_pred             CCCCCCCCCC
Q ss_conf             0432657750
Q gi|254781172|r  431 PSFCPICQSR  440 (731)
Q Consensus       431 P~~CP~Cgs~  440 (731)
                      |..||.||+-
T Consensus        79 p~RC~eCG~~   88 (98)
T 1v54_F           79 AQRCPSCGTH   88 (98)
T ss_dssp             CEECTTTCCE
T ss_pred             CCCCCCCCCE
T ss_conf             6345877858


No 350
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A*
Probab=22.18  E-value=25  Score=12.27  Aligned_cols=64  Identities=23%  Similarity=0.225  Sum_probs=37.0

Q ss_pred             CCCCEEEE------ECCCCCCCHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCHHHHHHHCCCEEECHHHHHHHHHH
Q ss_conf             16866999------725889987899999998298499811163217997788886379899749917379999999988
Q gi|254781172|r  647 IENKKLVF------TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ  720 (731)
Q Consensus       647 l~gk~vV~------TGtl~~~~R~e~~~~ie~~Ggkv~sSVSkkT~~LI~ge~~gSKl~KA~~LgI~Ii~e~ef~~ll~~  720 (731)
                      ..|+++++      ||    -|=-++.+.+++.|+.|...+.     +|--+.-|.+ +.-++.||++.+--.+..+++.
T Consensus       135 ~~G~~VlIVDDViTTG----~Si~~ai~~lr~~G~~V~~v~v-----ivdr~~~gg~-e~l~~~Gv~~~sL~t~~dl~~~  204 (234)
T 3m3h_A          135 EKGQKVVVVEDLISTG----GSAITCVEALREAGCEVLGIVS-----IFTYELEAGK-EKLEAANVASYSLSDYSALTEV  204 (234)
T ss_dssp             CTTCEEEEEEEEESSS----HHHHHHHHHHHHTTCEEEEEEE-----EEECCCHHHH-HHHHHTTCCEEESSCHHHHHHH
T ss_pred             CCCCEEEEEEEEECCC----CCHHHHHHHHHHCCCEEEEEEE-----EEECCCHHHH-HHHHHCCCCEEEECCHHHHHHH
T ss_conf             5795599985300347----2279999999978997999999-----9987744069-9999679978997769999999


No 351
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxidoreductase; 2.22A {Candida tropicalis}
Probab=22.18  E-value=25  Score=12.26  Aligned_cols=12  Identities=8%  Similarity=0.271  Sum_probs=8.4

Q ss_pred             CCCCCEEEEECC
Q ss_conf             216866999725
Q gi|254781172|r  646 EIENKKLVFTGT  657 (731)
Q Consensus       646 ~l~gk~vV~TGt  657 (731)
                      ..+|.++++.|-
T Consensus       534 ~itG~~i~vdGG  545 (604)
T 2et6_A          534 PVTGETFEIGGG  545 (604)
T ss_dssp             CCCSCEEEEETT
T ss_pred             CCCCCEEEECCC
T ss_conf             767878996699


No 352
>2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2
Probab=22.04  E-value=25  Score=12.24  Aligned_cols=54  Identities=17%  Similarity=0.183  Sum_probs=30.6

Q ss_pred             CCCCCCCEEE--EEECCCCHH-HHHHHCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             6844076899--983587025-6654101235787304777043265775010337865445210100354
Q gi|254781172|r  393 RDIRVGDRVL--VKRAGEVIP-KVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTG  460 (731)
Q Consensus       393 ~~I~iGd~V~--I~RaGdVIP-~I~~Vi~~~r~~~~~~~~~P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~n  460 (731)
                      .-.++||.|.  |..-||.-| ..++.-    ..+-.  +.-..|++|+..+...+++        ++|++
T Consensus       134 d~fr~GDIVrAkVis~~d~~~~~~LSt~----~~~LG--Vv~A~c~~c~~~l~~~~~~--------m~C~~  190 (209)
T 2nn6_I          134 KSFRPGDIVLAKVISLGDAQSNYLLTTA----ENELG--VVVAHSESGIQMVPISWCE--------MQCPK  190 (209)
T ss_dssp             GTCCSSSEEEEEEEEEETTTTEEEEECC----SSSCE--ECCCBCSSSCBCEEEETTE--------EECTT
T ss_pred             HCCCCCCEEEEEEEECCCCCCCEEEEEC----CCCCE--EEEEECCCCCCCEEECCCE--------EECCC
T ss_conf             5078998899999988688666899951----89868--9999888998517766998--------89999


No 353
>2zkr_z 60S ribosomal protein L37A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1ysh_D
Probab=21.84  E-value=21  Score=12.89  Aligned_cols=23  Identities=17%  Similarity=0.460  Sum_probs=14.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             04326577501033786544521010035
Q gi|254781172|r  431 PSFCPICQSRVVRDLNPKTGKLVAAHRCT  459 (731)
Q Consensus       431 P~~CP~Cgs~l~~~~~~~~~~~~~~~rC~  459 (731)
                      .-.||.||..-++...      .-.|.|.
T Consensus        36 ky~Cp~Cgk~~vkR~a------~GIW~C~   58 (92)
T 2zkr_z           36 KYTCSFCGKTKMKRRA------VGIWHCG   58 (92)
T ss_dssp             CBCCSSSCSSCEEEEE------TTEEEET
T ss_pred             CCCCCCCCCCEEEEEE------EEEEECC
T ss_conf             8509999998778899------8886847


No 354
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens}
Probab=21.69  E-value=26  Score=12.19  Aligned_cols=38  Identities=11%  Similarity=-0.061  Sum_probs=25.4

Q ss_pred             HCCCCCHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             1251177876138886789999999996697999999999973
Q gi|254781172|r  589 AHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE  631 (731)
Q Consensus       589 ~~~~~~~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~  631 (731)
                      ...-.+.++|..|+|||+..++.+-+-|     +..+.+....
T Consensus        57 ~~~P~t~~eL~~I~Gv~~~k~~~yG~~i-----l~~I~~~~e~   94 (101)
T 2rrd_A           57 ESLSSDPEVLLQIDGVTEDKLEKYGAEV-----ISVLQKYSEW   94 (101)
T ss_dssp             HHCCCCHHHHHTSTTCCHHHHHHTHHHH-----HHHHHHHHHH
T ss_pred             HHCCCCHHHHHCCCCCCHHHHHHHHHHH-----HHHHHHHHHC
T ss_conf             8685999998267787999999999999-----9999999761


No 355
>1a6s_A GAG polyprotein; core protein, virus structure, membrane binding, viral protein; NMR {Rous sarcoma virus - prague C} SCOP: a.61.1.4
Probab=21.28  E-value=23  Score=12.63  Aligned_cols=26  Identities=15%  Similarity=0.234  Sum_probs=17.4

Q ss_pred             HHHHHHCCCCCCEEEEEHHHHCCHHHHHHH
Q ss_conf             555653057654045410110106777531
Q gi|254781172|r  490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQT  519 (731)
Q Consensus       490 ~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~  519 (731)
                      .+..|.+.    |++++|.|||+=..++..
T Consensus        29 ~ls~L~~e----G~l~sP~di~~pg~Wd~~   54 (87)
T 1a6s_A           29 MLSLLQKE----GLLMSPSDLYSPGSWDPI   54 (87)
T ss_dssp             HHHTGGGT----TCTTCGGGGGSTTTTHHH
T ss_pred             HHHHHHHC----CCCCCCHHHHCCCCHHHH
T ss_conf             99999983----685881664088863888


No 356
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19
Probab=21.17  E-value=26  Score=12.12  Aligned_cols=22  Identities=18%  Similarity=0.540  Sum_probs=12.4

Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             2130123103541035555653057
Q gi|254781172|r  474 HFVSRDAFNIEGLGKQQLDFFFKSE  498 (731)
Q Consensus       474 hF~SK~aldI~GLG~k~Ie~L~e~~  498 (731)
                      ||.|   ++|..+-+++.+.|++.+
T Consensus         3 h~~~---l~~~~~~ekI~~~L~~~~   24 (79)
T 1xmk_A            3 HMAS---LDMAEIKEKICDYLFNVS   24 (79)
T ss_dssp             CTTS---HHHHHHHHHHHHHHHHTC
T ss_pred             CCCC---CCHHHHHHHHHHHHHHCC
T ss_conf             4233---476789999999999669


No 357
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ...
Probab=21.15  E-value=26  Score=12.12  Aligned_cols=10  Identities=50%  Similarity=1.059  Sum_probs=5.6

Q ss_pred             CCCCCCCCCC
Q ss_conf             0432657750
Q gi|254781172|r  431 PSFCPICQSR  440 (731)
Q Consensus       431 P~~CP~Cgs~  440 (731)
                      ...||-||..
T Consensus        72 ~~~CpkC~~~   81 (122)
T 1twf_I           72 DRECPKCHSR   81 (122)
T ss_dssp             CCCCTTTCCC
T ss_pred             CCCCCCCCCC
T ss_conf             6668679998


No 358
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A
Probab=21.00  E-value=27  Score=12.09  Aligned_cols=14  Identities=21%  Similarity=0.176  Sum_probs=7.0

Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             03689999759966
Q gi|254781172|r  255 YEMLQKMRCLGFPV  268 (731)
Q Consensus       255 ~e~l~~L~~~GF~v  268 (731)
                      .+....|+++||.+
T Consensus        20 e~~~~lle~~G~~p   33 (261)
T 1wcw_A           20 EAFKALAEKLGFTP   33 (261)
T ss_dssp             HHHHHHHHHTTCEE
T ss_pred             HHHHHHHHHCCCEE
T ss_conf             99999999779949


No 359
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae}
Probab=20.95  E-value=27  Score=12.09  Aligned_cols=83  Identities=17%  Similarity=0.141  Sum_probs=42.9

Q ss_pred             HHHCCHHHHHHHHHHHHHCCCC----CC-------CCCCCCCCCCCCCEEEEECCCCCCCHHH-----------------
Q ss_conf             9966979999999999733877----65-------4322468821686699972588998789-----------------
Q gi|254781172|r  614 EFYQNPRNICAVEALLKEVSPS----IG-------RHEKNVSSEIENKKLVFTGTLQKIQRHK-----------------  665 (731)
Q Consensus       614 ~ff~~~~n~~~i~~L~~~~~~~----~~-------~~~~~~~~~l~gk~vV~TGtl~~~~R~e-----------------  665 (731)
                      ++..++.-..++..+...+.+.    -.       .......+.+.|++  +||    |+..|                 
T Consensus       113 dl~~~~~l~~l~~~~~~~~k~vaaiChgp~~L~~~~~~~~~~~l~~Gr~--vT~----f~~~eE~~~~~~~~~~~~~~~~  186 (244)
T 3kkl_A          113 DYPKAKNLQDIASKIYANGGVIAAICHGPLLFDGLIDIKTTRPLIEGKA--ITG----FPLEGEIALGVDDILRSRKLTT  186 (244)
T ss_dssp             HGGGCHHHHHHHHHHHHTTCEEEEETTGGGGGTTCBCTTTSSBTTTTCE--ECC----SCHHHHHHHTTHHHHHHTTCCC
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHCCCCCCEECCCCE--EEE----CCCHHHHHCCCCCCCCCCCCCC
T ss_conf             2212256899999998479839996506899875301455542338866--850----5988986213111256555436


Q ss_pred             HHHHHHHCCCEEEEEEECCEEE------EEECCCCCCHHHHHH
Q ss_conf             9999998298499811163217------997788886379899
Q gi|254781172|r  666 AQEYVTQLGAVVSAILSRKTDI------IIVGDNPGSKLEKAQ  702 (731)
Q Consensus       666 ~~~~ie~~Ggkv~sSVSkkT~~------LI~ge~~gSKl~KA~  702 (731)
                      +++.+++.||...+...--..+      ||.|.++.|=..=|+
T Consensus       187 le~~l~~~Ga~~~~~~~~~~~~vVvDg~lITgqnP~Sa~~~a~  229 (244)
T 3kkl_A          187 VERVANKNGAKYLAPIHPWDDYSITDGKLVTGVNANSSYSTTI  229 (244)
T ss_dssp             HHHHHHTTTCEECCCSSTTSCCEEEETTEEEESSGGGHHHHHH
T ss_pred             HHHHHHHCCCEEECCCCCCCCCEEEECCEEECCCHHHHHHHHH
T ss_conf             9999997799895678899988898599880888578999999


No 360
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp}
Probab=20.79  E-value=27  Score=12.06  Aligned_cols=11  Identities=27%  Similarity=0.377  Sum_probs=4.7

Q ss_pred             CCCCCEEEEEC
Q ss_conf             21686699972
Q gi|254781172|r  646 EIENKKLVFTG  656 (731)
Q Consensus       646 ~l~gk~vV~TG  656 (731)
                      ..+|..+.+.|
T Consensus       232 ~itG~~i~vdG  242 (247)
T 3lyl_A          232 YITGQTLHVNG  242 (247)
T ss_dssp             TCCSCEEEEST
T ss_pred             CCCCCEEEECC
T ss_conf             97687488794


No 361
>1xhl_A Short-chain dehydrogenase/reductase family member (5L265), putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2
Probab=20.43  E-value=27  Score=12.01  Aligned_cols=14  Identities=29%  Similarity=0.242  Sum_probs=7.6

Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             82168669997258
Q gi|254781172|r  645 SEIENKKLVFTGTL  658 (731)
Q Consensus       645 ~~l~gk~vV~TGtl  658 (731)
                      +.++|.++.+.|-+
T Consensus       267 ~~iTGq~i~VDGG~  280 (297)
T 1xhl_A          267 SYIIGQSIVADGGS  280 (297)
T ss_dssp             TTCCSCEEEESTTG
T ss_pred             CCCCCCEEEECCCH
T ss_conf             68408768869498


No 362
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A
Probab=20.23  E-value=28  Score=11.98  Aligned_cols=15  Identities=20%  Similarity=0.293  Sum_probs=9.3

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       250 s~~iTG~~i~VDGG~  264 (267)
T 3gdg_A          250 STYTTGADLLIDGGY  264 (267)
T ss_dssp             CTTCCSCEEEESTTG
T ss_pred             HCCCCCCEEEECCCH
T ss_conf             269768768779554


No 363
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductase; oxidoreductase; 1.99A {Streptomyces coelicolor A3}
Probab=20.16  E-value=28  Score=11.97  Aligned_cols=15  Identities=27%  Similarity=0.299  Sum_probs=10.6

Q ss_pred             CCCCCCCEEEEECCC
Q ss_conf             882168669997258
Q gi|254781172|r  644 SSEIENKKLVFTGTL  658 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl  658 (731)
                      ++..+|.++.+.|-+
T Consensus       235 s~~itG~~i~vDGG~  249 (253)
T 2nm0_A          235 ASYITGAVIPVDGGL  249 (253)
T ss_dssp             GTTCCSCEEEESTTT
T ss_pred             HCCCCCCEEEECCCC
T ss_conf             148768758879582


No 364
>1uf2_K Structural protein P7; virus components, icosahedral virus; 3.50A {Rice dwarf virus}
Probab=20.02  E-value=28  Score=11.95  Aligned_cols=114  Identities=13%  Similarity=0.126  Sum_probs=59.5

Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHC-CCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHC
Q ss_conf             78761388867899999999966979999999999733-87765432246882168669997258899878999999982
Q gi|254781172|r  595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV-SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL  673 (731)
Q Consensus       595 ~e~L~~I~GiG~~~A~si~~ff~~~~n~~~i~~L~~~~-~~~~~~~~~~~~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~  673 (731)
                      .+.+..+.|=|-+++..+.+- ++    ..++...... .....    .....-..-.+||---|+.  .....-.+|++
T Consensus       375 ~~~wk~~s~~~~v~~~ti~~L-Hd----kILd~it~~~~~~~~~----~s~k~~E~I~i~FkNGFP~--~kys~~~LeK~  443 (506)
T 1uf2_K          375 KEQWEALSGNGLVTDSNISML-HD----KILDTITSNKPGVVLR----DGNKKSENIVVCFKNGFPN--KKHSLLQLTKN  443 (506)
T ss_pred             HHHHHCCCCCCEEECCCHHHH-HH----HHHHHHHCCCCCEEEC----CCCCCCCEEEEEEECCCCC--CCCHHHHHHHC
T ss_conf             553320478973726988999-99----9999987148633622----6888754089997248872--21037667534


Q ss_pred             CCEEEEE-EECCEEEEEECC----------CCCCHHHHHHHCCC----EEECHHHHHHHHH
Q ss_conf             9849981-116321799778----------88863798997499----1737999999998
Q gi|254781172|r  674 GAVVSAI-LSRKTDIIIVGD----------NPGSKLEKAQQLGV----KIMNEEQFLFLLQ  719 (731)
Q Consensus       674 Ggkv~sS-VSkkT~~LI~ge----------~~gSKl~KA~~LgI----~Ii~e~ef~~ll~  719 (731)
                      |-.|+++ -..+..+||...          +.++|+++++.--|    .=++|+||+++|.
T Consensus       444 GI~Vv~~d~~~D~~i~v~ntp~~~~rr~~~~~k~~~~~~~~~~v~vDtD~~se~efI~kik  504 (506)
T 1uf2_K          444 GISVVSLDELTDAGILVESTGPDRVRRSPKVLANKLSSFKGRKVTLDVDNMSTEALIQKLS  504 (506)
T ss_pred             CCEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHCCCCEEECCCCCCCHHHHHHHHH
T ss_conf             7568703767778679946997622346332246355434870232445488899999975


No 365
>2k2w_A Recombination and DNA repair protein; BRCT domain, cell cycle checkpoint; NMR {Xenopus laevis}
Probab=20.01  E-value=28  Score=11.94  Aligned_cols=68  Identities=21%  Similarity=0.264  Sum_probs=39.2

Q ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEE---------EECCEEEEEE-C--C------CCC-----CHHHH
Q ss_conf             8821686699972588998789999999829849981---------1163217997-7--8------888-----63798
Q gi|254781172|r  644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI---------LSRKTDIIIV-G--D------NPG-----SKLEK  700 (731)
Q Consensus       644 ~~~l~gk~vV~TGtl~~~~R~e~~~~ie~~Ggkv~sS---------VSkkT~~LI~-g--e------~~g-----SKl~K  700 (731)
                      ...|.||||||--.   --.+-+...+...||.+..-         .++.+..++. +  +      .+.     +=+..
T Consensus        11 k~LF~gKtFVFln~---Kq~krl~~~V~~~GG~~~l~~~~~~~~~~~~~~~~cV~~v~~~~sq~~~s~~~~~~i~~i~~~   87 (118)
T 2k2w_A           11 KSIFKDKVFLFLNA---KQYKKLSPAVLFGGGKTDLLMGELKDASVLDNPATCVIDVAMTESQLSESQSTQPWITSTLDL   87 (118)
T ss_dssp             SCSSTTCEEEESCS---STHHHHHHHHHHTTCEEECCSSGGGSTHHHHSTTEEEEECSGGGCCGGGTTTCSCCCCHHHHH
T ss_pred             HHHCCCCEEEECCH---HHHHHHHHHHHCCCCEEEECCCCCCCHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             77617897996589---999999989861782599765787454341699559999568886425673007799999999


Q ss_pred             HHHCCCEEECHHHH
Q ss_conf             99749917379999
Q gi|254781172|r  701 AQQLGVKIMNEEQF  714 (731)
Q Consensus       701 A~~LgI~Ii~e~ef  714 (731)
                      -++.|...|-|.|.
T Consensus        88 L~~~glR~IpEsEI  101 (118)
T 2k2w_A           88 LQSKGLRTIPEAEI  101 (118)
T ss_dssp             HHHHTCCEEEHHHH
T ss_pred             HHHCCCCCCCHHHH
T ss_conf             99869875887886


Done!