BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA
[Candidatus Liberibacter asiaticus str. psy62]
         (731 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040849|gb|ACT57645.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 731

 Score = 1509 bits (3907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH
Sbjct: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK
Sbjct: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
           KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN
Sbjct: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240
           IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV
Sbjct: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID
Sbjct: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP
Sbjct: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE
Sbjct: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA
Sbjct: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD
Sbjct: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR
Sbjct: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK
Sbjct: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ
Sbjct: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720

Query: 721 YNTTLRIHDDD 731
           YNTTLRIHDDD
Sbjct: 721 YNTTLRIHDDD 731


>gi|315122567|ref|YP_004063056.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495969|gb|ADR52568.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 739

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/725 (67%), Positives = 582/725 (80%), Gaps = 5/725 (0%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M  R+ IPIE LS EQA+KELS L+ EISYHDD YYQ+S+P ILD EYD LK RCDAIA 
Sbjct: 1   MANRKFIPIEELSPEQAKKELSFLQHEISYHDDLYYQHSQPKILDFEYDQLKERCDAIAR 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP+ A   D NGPLNKIGGE N SLFK+THS P  SLEK   IED+  F+T+IYR  +K
Sbjct: 61  AFPEFASLADSNGPLNKIGGEKNFSLFKITHSPPMRSLEKSHQIEDINYFMTKIYRDLKK 120

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
              NSI FTLEPKIDG  ++IRYE+GKFV+A LRGDG+ GEDVSA I  +  IP+VLS  
Sbjct: 121 DCYNSIVFTLEPKIDGASLSIRYEQGKFVHAGLRGDGYIGEDVSANISMMSIIPQVLSFK 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTD---ITRYLN 237
           +PEI EVRGE+YISK DF  LN+EM    +K Y+NPRN  +G+LR  N T    I+RYL 
Sbjct: 181 VPEIFEVRGEIYISKKDFFVLNEEMRTTKKKLYSNPRNTVAGLLRSRNQTSKSRISRYLK 240

Query: 238 FFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
           FFVHG+G  SE FA GQYEMLQKMR LGFPVN  ++QA+T  GIVSYY+E   IRS+LPY
Sbjct: 241 FFVHGIGTISEKFADGQYEMLQKMRALGFPVNERIQQAHTLEGIVSYYDETALIRSSLPY 300

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKVD F+LQ+QLGER+RSP W ISHKF++++ ST LL IDIQIGRTG+LTP+AR
Sbjct: 301 DIDGIVYKVDSFTLQQQLGERSRSPIWAISHKFSDEEFSTPLLGIDIQIGRTGMLTPIAR 360

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
            E +N+GG  ++NATLHNE+YIKGLD+SGK++RGGRDIR+GD +LVKRAG+VIPKV D+I
Sbjct: 361 FESINMGGVFVSNATLHNENYIKGLDSSGKIIRGGRDIRIGDMILVKRAGDVIPKVTDVI 420

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           + ER  D+Q FSFPS CP+CQS+VVR +NPKTGKL ++H CTGGL C AQQLE LK+FVS
Sbjct: 421 MEERPIDSQMFSFPSSCPVCQSKVVRAVNPKTGKLGSSHYCTGGLMCPAQQLEYLKYFVS 480

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           RDAFNIEGLG++QLDFFFKSEDP+FSIRIPADIFTLQ RQQTS  K+ENI GF  VSVTN
Sbjct: 481 RDAFNIEGLGEKQLDFFFKSEDPSFSIRIPADIFTLQHRQQTSFKKLENIPGFAHVSVTN 540

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           LYDSINKRRNISL+RFIFSLGI HVG EIARSLA++Y SYQNF  EI NI+   ND  +S
Sbjct: 541 LYDSINKRRNISLQRFIFSLGIHHVGIEIARSLAQFYRSYQNFETEIKNILDKKNDADVS 600

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS--SEIENKKLVFT 655
           L +V LVGD++AQ+I+ FYQNP N  A+ ALL E+S S+   +++ S  S + NK+LVFT
Sbjct: 601 LKKVALVGDMVAQSIIAFYQNPENNRAIAALLNEISLSVWDSQEDNSRNSILANKRLVFT 660

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTLQKI RH+AQE V QLGA+VS+ +S KT I++VGDN GSKL KA+QLG++I+NEEQFL
Sbjct: 661 GTLQKITRHQAQEAVKQLGAIVSSTISHKTHIVVVGDNAGSKLNKARQLGIEIVNEEQFL 720

Query: 716 FLLQQ 720
            L+ +
Sbjct: 721 SLISE 725


>gi|227822641|ref|YP_002826613.1| NAD-dependent DNA ligase LigA [Sinorhizobium fredii NGR234]
 gi|254781400|sp|C3MEL9|DNLJ_RHISN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|227341642|gb|ACP25860.1| DNA ligase [Sinorhizobium fredii NGR234]
          Length = 717

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/712 (49%), Positives = 493/712 (69%), Gaps = 4/712 (0%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E L+  +A +EL+ L  E++ HD  Y+    P I D++YDALKRR D I   FP L R
Sbjct: 7   PVEQLTETEAAEELAFLVTELARHDALYHGQDAPEISDADYDALKRRNDLIEELFPALIR 66

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
            + P+    KIG   +L+   V H+ P LSL+  ++ ED R F+  IYRF  K  D+SI 
Sbjct: 67  EDSPS---RKIGAAPSLTFQPVLHARPMLSLDNTFSDEDARDFVAGIYRFLGKLPDHSIA 123

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYE  K V AA RGDG +GE+V+A IR I  IP+ L  + P+++EV
Sbjct: 124 FTAEPKIDGLSMSLRYENRKLVTAATRGDGTTGENVTANIRTIRMIPQTLPADAPDVVEV 183

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGE+Y++K+DF ALN EM A GR  Y NPRN ASG LR+L+     +R L FF +  G+ 
Sbjct: 184 RGEIYMAKSDFAALNAEMAAQGRPLYVNPRNTASGSLRQLDAKVTASRKLRFFAYAWGEI 243

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S + +  Q+ M++  +  GFPVN  +++ ++   ++ +Y+ ++  R  L YDIDG+VYKV
Sbjct: 244 SAMPSDTQFGMVETFKAWGFPVNPLMQRLSSADELLQHYHHIERERPDLDYDIDGVVYKV 303

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D   LQ +LG R+RSPRW  +HKF  +QA TRL  IDIQ+GRTG LTPVARLEP+ +GG 
Sbjct: 304 DRLDLQARLGFRSRSPRWATAHKFPAEQAFTRLKGIDIQVGRTGALTPVARLEPITVGGV 363

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHNEDYI+G+  SG+ +R GRDIR+GD V+V+RAG+VIP++VD++++ER   A+
Sbjct: 364 VVTNATLHNEDYIRGIGNSGEPIREGRDIRIGDMVIVQRAGDVIPQIVDVVMDERAEGAE 423

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP+ CP+C S  VRD+N KTGK+ A  RCTGG  C AQ +E LKHFVSR AF+IEGL
Sbjct: 424 PYRFPTTCPVCGSHAVRDINEKTGKVDAVRRCTGGFVCRAQAIEHLKHFVSRHAFDIEGL 483

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++FFF+SEDP  SIR   DIFTL+RRQ+ S TK+ENI GFG VSV  LY++IN RR
Sbjct: 484 GSKQIEFFFESEDPTLSIRTAPDIFTLERRQEASLTKLENIEGFGKVSVRKLYEAINARR 543

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I+L RFI++LGIRHVG   A+ LA+ Y +Y++F   + +  +   D W  L  +  +G+
Sbjct: 544 EIALHRFIYALGIRHVGETTAKLLARSYGTYEHFRAAMVDAGSLAGDAWNELNSIEGIGE 603

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AIVEFY+ PRN+  V  LL+EV P       +  S +  K +VFTG+L+K+ R +A
Sbjct: 604 VVARAIVEFYKEPRNLKVVSDLLEEVRPESAETRVSTDSPVAGKTVVFTGSLEKMTRDEA 663

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 664 KAKAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 715


>gi|86358438|ref|YP_470330.1| NAD-dependent DNA ligase LigA [Rhizobium etli CFN 42]
 gi|123738303|sp|Q2K6D3|DNLJ_RHIEC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86282540|gb|ABC91603.1| DNA ligase (NAD+) protein [Rhizobium etli CFN 42]
          Length = 718

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/712 (47%), Positives = 493/712 (69%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VETLTIEEAAAELERLAREIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+    ++G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RRVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVASVYRFLGRMPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+   AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLTTAATRGDGTTGENVTANIRTIAEIPNQLPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ S
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMS 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           ++ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 DMPADTQFAMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLKRPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+ +GG +
Sbjct: 305 SLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +R  + +
Sbjct: 365 VTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEKRLAEVK 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 PYEFPKICPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY +IN+RR
Sbjct: 485 GSKQIDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYAAINERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGDAWNDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K  R +A
Sbjct: 605 VVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEKFTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|209550159|ref|YP_002282076.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|254781399|sp|B5ZWH9|DNLJ_RHILW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209535915|gb|ACI55850.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 718

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/712 (47%), Positives = 492/712 (69%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDALYHGKDRPQISDADYDALKRRNDALEVQFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+    ++G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RRVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVASVYRFLGRLPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ S
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMS 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A  Q++M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 EMPADTQFDMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ +LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+ +GG +
Sbjct: 305 SLELQARLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRG-GRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +R  DA+
Sbjct: 365 VTNATLHNEDYIKGIGNSGERIRPEDHDIREGDTVIVQRAGDVIPQILDVVMEKRTADAR 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 SYEFPKTCPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF+ ED +  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY +IN+RR
Sbjct: 485 GSKQIDFFFEHEDASLQIRTAPEIFTLEKRQQASLTKLENIDGFGKVSVGKLYTAINERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYEAFAMAMKEAAPLSGDAWNDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+A+VEFY+ PRN+  +  L++EV+P          S +  K +VFTG+L+K  R +A
Sbjct: 605 VVARAMVEFYKEPRNVEVITRLIEEVTPQQAEQPVTTGSPVAGKTVVFTGSLEKFTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|327194610|gb|EGE61460.1| DNA ligase (NAD+) protein [Rhizobium etli CNPAF512]
          Length = 718

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/712 (47%), Positives = 493/712 (69%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDSLYHGKDQPEISDADYDALKRRNDALEVRFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ +
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMA 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 EMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+ +GG +
Sbjct: 305 SLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +R  DA+
Sbjct: 365 VTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEKRAADAR 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 SYEFPKTCPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY +IN+RR
Sbjct: 485 GAKQVDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYAAINERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGDAWNDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K  R +A
Sbjct: 605 VVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEKFTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|190892570|ref|YP_001979112.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
 gi|254781398|sp|B3PTU7|DNLJ_RHIE6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190697849|gb|ACE91934.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
          Length = 718

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/712 (47%), Positives = 492/712 (69%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ +
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMA 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 EMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+ +GG +
Sbjct: 305 SLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +R  DA+
Sbjct: 365 VTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEKRAADAR 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP+C S  VR++N KTGK  +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 SYEFPKTCPVCGSHAVREVNEKTGKTDSVRRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY +IN+RR
Sbjct: 485 GSKQVDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYAAINERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + + W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGEAWTDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K  R +A
Sbjct: 605 VVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEKFTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|241205543|ref|YP_002976639.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859433|gb|ACS57100.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 718

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/712 (47%), Positives = 489/712 (68%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDALYHGKDRPEISDADYDALKRRNDALEVRFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ S
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMS 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A  Q+ M+Q  +  GFPVN  V++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 EMPADTQFGMVQTFKDWGFPVNPLVKRLNSVADILTHYDEIGLERPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ +LG R+RSPRW  +HKF  +QA T + +IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 305 SLELQARLGFRSRSPRWATAHKFPAEQAFTIVENIDIQVGRTGALTPVARLTPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V+D+++ +R  +A+
Sbjct: 365 VTNATLHNADYIRGIGNSGERIRADEHDIRIGDTVIVQRAGDVIPQVLDVVMEKRSAEAR 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP+C S  VR+ + KTGKL +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 PYEFPKTCPVCGSHAVRERHEKTGKLDSVTRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF++ED +  IR   DIFTL++RQQ S TK+ENI GFG VSV  LY +I +RR
Sbjct: 485 GSKQIDFFFENEDASLQIRTAPDIFTLEKRQQQSLTKLENIDGFGKVSVGKLYAAITERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y  F   +    A + D W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYAAFETAMREAEALSGDAWNDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AIVEFY+ PRN+  +  L++EV+P      K   S +  K +VFTG+L+K  R +A
Sbjct: 605 VVARAIVEFYKEPRNVEVITRLIEEVTPEEAEQPKTAGSPVAGKTVVFTGSLEKFTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++ GV+ M+E+++L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKAREFGVQTMDEDEWLALI 716


>gi|222086432|ref|YP_002544966.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
 gi|254781247|sp|B9JH39|DNLJ_AGRRK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221723880|gb|ACM27036.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
          Length = 717

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/689 (49%), Positives = 472/689 (68%), Gaps = 4/689 (0%)

Query: 31  HDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVT 90
           +D  Y+    P I D+EYDALKRR DAI   FP L R++ P+    ++G   + +   V 
Sbjct: 30  NDALYHGNDAPEISDAEYDALKRRNDAIEARFPALVRADSPS---RRVGAAPSETFMPVV 86

Query: 91  HSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVY 150
           H+ P LSL+  ++ ED++ F+  +YRF  +  D SI FT EPKIDG  ++IRYE G+ V 
Sbjct: 87  HARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAFTAEPKIDGLSMSIRYENGRMVS 146

Query: 151 AALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGR 210
           AA RGDG +GE+V+A IR I  IP+ L    P ++E+RGEVY++K+DFLALN +M A G+
Sbjct: 147 AATRGDGTTGENVTANIRTIKEIPQTLPAGAPAVVEIRGEVYMAKSDFLALNAQMEAEGK 206

Query: 211 KPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVN 269
           + Y NPRN A+G LR+L+     +R L FF +  G+ S++ A  Q+ M+Q     GFPVN
Sbjct: 207 QSYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMSDMPADTQFGMVQAFGEWGFPVN 266

Query: 270 NGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHK 329
             +++ N+   I+++Y+E+   R  L YDIDG+VYKVD   LQ +LG R+RSPRW  +HK
Sbjct: 267 PLMKRLNSVADILAHYDEIGLQRPDLDYDIDGVVYKVDSLELQARLGFRSRSPRWATAHK 326

Query: 330 FAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVM 389
           F  +QA TRLLDIDIQ+GRTG LTPVARLEP+ +GG ++TNATLHN DYIKG+   G+ +
Sbjct: 327 FPAEQALTRLLDIDIQVGRTGALTPVARLEPITVGGVVVTNATLHNADYIKGIGNKGEPI 386

Query: 390 RGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKT 449
           R GRDIR+GD V+V+RAG+VIP++VD+++ +R   +  + FP  CP+C S  VRD+N KT
Sbjct: 387 RDGRDIRIGDMVIVQRAGDVIPQIVDVVLEKREASSVAYEFPKTCPVCGSHAVRDINEKT 446

Query: 450 GKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPAD 509
           GK+ A  RCTGG  C AQ  E LKHFVSR+A++IEGLG +Q+DFFF+S+DPA  +R   D
Sbjct: 447 GKVDAVTRCTGGFICRAQATEHLKHFVSRNAYDIEGLGSKQIDFFFESDDPALQVRTAPD 506

Query: 510 IFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARS 569
           IFTL+RRQQ+S +K+ENI GFG VSV+ LY +IN+RR+I+L RFIF+LGIRHVG   A+ 
Sbjct: 507 IFTLERRQQSSLSKLENIDGFGKVSVSKLYAAINERRDIALHRFIFALGIRHVGETTAKL 566

Query: 570 LAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALL 629
           LA+ Y +Y+ F   +        D W  L  +  VG+++A+A+VEFY+ PRN+  +  LL
Sbjct: 567 LARSYGTYEAFEAGMKEAAPLAGDAWNDLNNIEGVGEVVARAVVEFYKEPRNVEVISKLL 626

Query: 630 KEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIII 689
            EV P          S +  K +VFTG+L+K  R +A+     LGA VS  +S+KTDI++
Sbjct: 627 DEVRPQEAEQPTTSGSPVVGKTVVFTGSLEKFTRDEAKAKAESLGAKVSGSVSKKTDIVV 686

Query: 690 VGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            G   GSKL+KA++  V++M E+++L L+
Sbjct: 687 AGPGAGSKLDKAREFNVQVMTEDEWLELI 715


>gi|116253034|ref|YP_768872.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. viciae
           3841]
 gi|123261370|sp|Q1ME47|DNLJ_RHIL3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115257682|emb|CAK08780.1| putative DNA ligase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 718

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/712 (48%), Positives = 494/712 (69%), Gaps = 5/712 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+IE+A  EL+ L +EI++HD  Y+   +P I D++YDALKRR DA+   FP+L R 
Sbjct: 8   VDTLTIEEAAAELARLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEVRFPELIRE 67

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  D SI F
Sbjct: 68  DSPS---RHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAF 124

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P ++E+R
Sbjct: 125 TAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVPAVVEIR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ S
Sbjct: 185 GEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMS 244

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD
Sbjct: 245 EMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDGVVYKVD 304

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ +LG R+RSPRW  +HKF  +QA T + +IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 305 SLELQARLGFRSRSPRWATAHKFPAEQAFTIVENIDIQVGRTGALTPVARLTPITVGGVV 364

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V+D+++ +R  +A+
Sbjct: 365 VTNATLHNADYIQGIGNSGERIRDDEHDIRIGDTVIVQRAGDVIPQVLDVVMEKRPAEAR 424

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP+C S  VR+ + KTGKL +  RCTGG  C AQ  E LKHFVSR+AF+IEGL
Sbjct: 425 PYEFPKTCPVCGSHAVRERHEKTGKLDSVTRCTGGFICRAQATEHLKHFVSRNAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+DFFF++ED +  IR   DIFTL++RQQ S TK+ENI GFG VSV  LY +I++RR
Sbjct: 485 GSKQIDFFFENEDASLQIRTAPDIFTLEKRQQQSLTKLENIDGFGKVSVGKLYGAIDERR 544

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I+L RFI++LGIRHVG   A+ LA+ Y +Y+ F   +    A + D W  L  +  +G+
Sbjct: 545 SIALHRFIYALGIRHVGETTAKLLARSYGTYEAFETAMREAEALSGDAWNDLNAIEGIGE 604

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AIVEFY+ PRN+  +  LL+EV+P      K   S +  K +VFTG+L+K+ R +A
Sbjct: 605 VVARAIVEFYKEPRNVEVITRLLEEVTPEEAEQPKTAGSPVAGKTVVFTGSLEKLTRDEA 664

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+Q+L L+
Sbjct: 665 KARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDQWLALI 716


>gi|150397271|ref|YP_001327738.1| NAD-dependent DNA ligase LigA [Sinorhizobium medicae WSM419]
 gi|166216245|sp|A6UB73|DNLJ_SINMW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150028786|gb|ABR60903.1| DNA ligase, NAD-dependent [Sinorhizobium medicae WSM419]
          Length = 717

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/715 (48%), Positives = 490/715 (68%), Gaps = 4/715 (0%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
           Q  P+E ++  +A +EL+ L  E+S HD  Y+    P I D++YDALKRR D I   FP 
Sbjct: 4   QRKPVEQMTEAEAAEELAFLAAELSRHDMLYHGKDDPEISDADYDALKRRNDLIEERFPA 63

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           L R + P+    K+G   +L+   V H+ P LSL+  ++ ED R F+  IYRF  +  D 
Sbjct: 64  LIREDSPS---QKVGAAPSLTFAPVVHARPMLSLDNSFSDEDARAFVAGIYRFLGRLPDG 120

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
           SI FT+EPKIDG  +++RYE  + V AA RGDG +GE+V+A +R I  IP+ L    P++
Sbjct: 121 SIAFTVEPKIDGLSMSLRYENRRLVTAATRGDGTTGENVTANVRTIGMIPQRLPAEAPDV 180

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGL 243
           +E+RGE+Y++K+DF ALN EM A GR  Y NPRN ASG LR+L+     +R L FF +  
Sbjct: 181 VEIRGEIYMAKSDFAALNAEMAAQGRPLYVNPRNTASGSLRQLDAKVTASRRLRFFAYAW 240

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G+ S + A  Q  M++  +  GFPVN  +++  +   ++ +Y+ ++  R  L YDIDG+V
Sbjct: 241 GEMSAMPADTQLGMVETFKAWGFPVNPLMQRFFSADELLEHYHHIERERPELDYDIDGVV 300

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKVD+  LQ +LG R+RSPRW  +HKF  ++A TRL  IDIQ+GRTG LTPVARLEP+ +
Sbjct: 301 YKVDQLDLQARLGFRSRSPRWATAHKFPAERAFTRLKGIDIQVGRTGALTPVARLEPITV 360

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG ++TNATLHNEDYI+G+  +G+ +R GRDIR+GD V+V+RAG+VIP++VD++++ER  
Sbjct: 361 GGVVVTNATLHNEDYIRGIGNTGEPIREGRDIRIGDMVIVQRAGDVIPQIVDVVMDERPE 420

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
             +P+ FP+ CPIC S  VRD+N KTGK+ A  RCTGG  C AQ +E LKHFVSR+AF+I
Sbjct: 421 GTEPYRFPTSCPICGSHAVRDINEKTGKVDAVRRCTGGFVCRAQAVEHLKHFVSRNAFDI 480

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           EGLG +Q++FFF+SED    IR   DIFTL+RRQ++S TK+ENI GFG VSV  LY++IN
Sbjct: 481 EGLGSKQIEFFFESEDETLRIRTAPDIFTLERRQESSLTKLENIDGFGKVSVRKLYEAIN 540

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
            RR+I L RFI++LGIRHVG   A+ LA+ Y +Y++F   +      + D W  L  +  
Sbjct: 541 ARRSIGLHRFIYALGIRHVGETTAKLLARSYGTYEHFGAAMTEAGGFSGDAWNELNSIDG 600

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G+++A+AIVEFY+ PRN+  +  LL+EV+P          S +  K +VFTG+L+K+ R
Sbjct: 601 IGEVVARAIVEFYKEPRNLKVLSDLLEEVTPERAEMPVATDSPVAGKTVVFTGSLEKMTR 660

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LG++ M+E+++L L+
Sbjct: 661 DEAKAKAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGLQTMDEDEWLALI 715


>gi|15965917|ref|NP_386270.1| NAD-dependent DNA ligase LigA [Sinorhizobium meliloti 1021]
 gi|307308227|ref|ZP_07587936.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
 gi|307319694|ref|ZP_07599119.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|81634276|sp|Q92NM8|DNLJ_RHIME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15075186|emb|CAC46743.1| Probable DNA ligase [Sinorhizobium meliloti 1021]
 gi|306894625|gb|EFN25386.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|306901225|gb|EFN31831.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
          Length = 717

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/689 (48%), Positives = 470/689 (68%), Gaps = 4/689 (0%)

Query: 31  HDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVT 90
           HD  Y+    P I D++YDALKRR D I   FP L R + P+    K+G   +L+   V 
Sbjct: 30  HDMLYHGKDAPEISDADYDALKRRNDLIEERFPVLVREDSPS---RKVGAAPSLTFAPVV 86

Query: 91  HSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVY 150
           H+ P LSL+  ++ ED R F+  +YRF  K  D SI FT EPKIDG  +++RYE  + V 
Sbjct: 87  HARPMLSLDNTFSDEDARAFVAGVYRFLGKLPDGSIAFTAEPKIDGLSMSLRYENRRLVT 146

Query: 151 AALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGR 210
           AA RGDG +GE+V+A +R I  IP+ L  + P+++E+RGE+Y++K+DF ALN EM A GR
Sbjct: 147 AATRGDGTTGENVTANVRTIGMIPQTLPADAPDVVEIRGEIYMAKSDFAALNAEMAAQGR 206

Query: 211 KPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVN 269
             Y NPRN ASG LR+L+      R L FF +  G+ S + A  Q  M++  +  GFPVN
Sbjct: 207 PLYVNPRNTASGSLRQLDAKVTANRKLRFFAYAWGEMSAMPADTQLGMVETFKAWGFPVN 266

Query: 270 NGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHK 329
             +++  +   ++ +Y+ ++  R  L YDIDG+VYKVD   LQ +LG R+RSPRW  +HK
Sbjct: 267 PLMQRFFSADELLEHYHHIERERPDLDYDIDGVVYKVDRLDLQARLGFRSRSPRWATAHK 326

Query: 330 FAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVM 389
           F  +QA TRL  IDIQ+GRTG LTPVARLEP+ +GG ++TNATLHNEDYI+G+  +G+ +
Sbjct: 327 FPAEQAFTRLKGIDIQVGRTGALTPVARLEPITVGGVVVTNATLHNEDYIRGVGNTGEPI 386

Query: 390 RGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKT 449
           R GRD+R+GD V+V+RAG+VIP++VD++++ER   A+P+ FP+ CPIC S  VRD+N KT
Sbjct: 387 RDGRDVRIGDMVIVQRAGDVIPQIVDVVMDERPEGAEPYRFPTTCPICGSHAVRDINEKT 446

Query: 450 GKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPAD 509
           GK+ A  RCTGG  C AQ +E LKHFVSR+AF+IEGLG +Q++FFF+SED    IR   +
Sbjct: 447 GKVDAVRRCTGGFVCRAQAVEHLKHFVSRNAFDIEGLGSKQIEFFFESEDENLRIRTAPE 506

Query: 510 IFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARS 569
           IFTL+RRQ+ S  K+EN  GFG VSV  LY++IN RR+I+L R I++LGIRHVG   A+ 
Sbjct: 507 IFTLERRQEASLNKLENTDGFGKVSVRKLYEAINARRSIALHRLIYALGIRHVGETTAKL 566

Query: 570 LAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALL 629
           LA+ Y SY++F   +      + D W  L  +  +G+++A+AIVEFY+ PRN+  V  LL
Sbjct: 567 LARSYGSYEHFGAAMTEAAGFSGDAWNELNSIDGIGEVVARAIVEFYKEPRNLKVVSELL 626

Query: 630 KEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIII 689
           +EV+P          S +  K +VFTG+L+K+ R +A+     LGA V+  +S+KTDI++
Sbjct: 627 QEVTPESAELPVATDSPVAGKTVVFTGSLEKMTREEAKAKAESLGAKVAGSVSKKTDIVV 686

Query: 690 VGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 687 AGPGAGSKLDKARELGVQTMDEDEWLALI 715


>gi|222149123|ref|YP_002550080.1| NAD-dependent DNA ligase LigA [Agrobacterium vitis S4]
 gi|254781248|sp|B9JY41|DNLJ_AGRVS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221736108|gb|ACM37071.1| DNA ligase [Agrobacterium vitis S4]
          Length = 719

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/716 (48%), Positives = 480/716 (67%), Gaps = 6/716 (0%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           LIP+E LS EQA +EL  L   I++HD  Y+   +P I D++YDALKRR DAI   FP L
Sbjct: 5   LIPVEDLSEEQAGQELIRLAAAIAHHDALYHGKDQPEISDADYDALKRRNDAIEARFPTL 64

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            RS+ P+    ++G        ++TH+ P LSL+  ++ ED+  F+  +YRF     DNS
Sbjct: 65  VRSDSPS---QRVGAAPAGIFSQITHARPMLSLDNTFSDEDVADFVASVYRFLGVMPDNS 121

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE  K   AA RGDG +GE+V+A I  I  IP  L  + P+++
Sbjct: 122 IAFTAEPKIDGLSMSIRYEHRKLKTAATRGDGTTGENVTANILTIKEIPTELPADAPDVV 181

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A GR+ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 182 EVRGEVYMAKSDFLALNAQMEAEGRQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWG 241

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S + A+ Q  M++  +  GFPVN   R+  +   I+++Y E+   R+ L YDIDG+VY
Sbjct: 242 EMSTMPAETQSGMVEAFKRWGFPVNPLTRRLTSVEEIIAHYREIGLQRADLDYDIDGVVY 301

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW  +HKF  +QA T +  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 302 KVDRLDLQARLGFRSRSPRWATAHKFPAEQAFTTVEAIDIQVGRTGALTPVARLEPITVG 361

Query: 365 GALITNATLHNEDYIKGLDASGKVMRG-GRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           G ++TNATLHN DYI+G+   G+ +R  G DIR+GD V+V+RAG+VIP+V+D+++ +R  
Sbjct: 362 GVVVTNATLHNADYIEGIGNGGERIRPEGHDIRIGDTVIVQRAGDVIPQVLDVVLEKRPE 421

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
            +  + FP  CP+C S  VR+ N KTGKL +  RCTGG  CSAQ  E +KHFVSR+AF+I
Sbjct: 422 TSVKYEFPKTCPVCGSHAVREKNEKTGKLDSVTRCTGGFVCSAQAKEHIKHFVSRNAFDI 481

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSI 542
           EGLG +Q+DFFF+SEDPA  IR   DIFTL++RQ+ S+ T++ENI GFG VSV  L+D+I
Sbjct: 482 EGLGTKQVDFFFESEDPALMIRTAPDIFTLKQRQEASSLTRLENIDGFGRVSVRKLFDAI 541

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           + RR I+L RFIF+LGIRHVG   A+ LA+ Y SY  FA  +        + W  L  + 
Sbjct: 542 DARREIALNRFIFALGIRHVGETTAKLLARSYGSYAAFADAMQEAAPKFGEAWNELNSID 601

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+++A ++VEF++ PRN+  V  LLKEV+P          S +  K +VFTG+L++  
Sbjct: 602 GIGEVVAASMVEFFKEPRNLEVVSRLLKEVTPLDAEAVTASDSPVAGKTVVFTGSLERFT 661

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA V+  +S+KTD ++ G   GSKL+KA+++GV +M E+++L L+
Sbjct: 662 RDEAKARAESLGAKVAGSVSKKTDYLVAGPGAGSKLDKAREVGVTVMTEDEWLALI 717


>gi|254719452|ref|ZP_05181263.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|265984457|ref|ZP_06097192.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306839229|ref|ZP_07472046.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
 gi|264663049|gb|EEZ33310.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306405776|gb|EFM62038.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
          Length = 719

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/724 (47%), Positives = 479/724 (66%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYEDGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPSVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLALNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ +R  D
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDVVLEKRSAD 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 AVPFQFPHECPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA SIR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALSIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|325293451|ref|YP_004279315.1| DNA ligase [Agrobacterium sp. H13-3]
 gi|325061304|gb|ADY64995.1| DNA ligase [Agrobacterium sp. H13-3]
          Length = 724

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/727 (47%), Positives = 490/727 (67%), Gaps = 14/727 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K Q IP+E L+  +A  EL+ L  E++ HD  Y+    P I D++YDALKRR DAI  
Sbjct: 1   MSKDQ-IPVENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEA 59

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP L R++ P+    K+G     +   + H+ P LSL+  ++  DLR F++ +YRF   
Sbjct: 60  AFPALVRADSPS---KKVGFTPLPTFAPIVHARPMLSLDNTFSEGDLRDFVSSVYRFLGH 116

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             D+SI FT EPKIDG  ++IRYE GK   AA RGDG +GE+V+A I+ I  IP  L  +
Sbjct: 117 LPDDSIAFTAEPKIDGLSMSIRYENGKLKTAATRGDGTTGENVTANIKTIKEIPNQLPAD 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNF 238
           +P+++EVRGEVY++K+DF+ALN +M A G++ Y NPRN ASG LR+ +  ++T  R L F
Sbjct: 177 VPDVVEVRGEVYMAKSDFMALNAQMEADGKQTYVNPRNTASGSLRQFD-ANVTAKRKLRF 235

Query: 239 FVHGLGKTSE-----IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRS 293
           F + LG+ S        A  QY +++K R  GFPVN  +++  +   ++ +YNE+   R 
Sbjct: 236 FAYALGEVSNGGQPTRIADTQYGIVEKFREWGFPVNPLMKRFTSAEQLLEHYNEIGVARP 295

Query: 294 TLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILT 353
            L YDIDG+VYKVD   LQ++LG R+RSPRW  +HKF  +QA T + +I+IQ+GRTG LT
Sbjct: 296 DLDYDIDGVVYKVDRLDLQERLGFRSRSPRWATAHKFPAEQAFTTVENIEIQVGRTGALT 355

Query: 354 PVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRG-GRDIRVGDRVLVKRAGEVIPK 412
           PVARL P+ +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+
Sbjct: 356 PVARLTPITVGGVVVTNATLHNADYIEGIGNSGERIRPEDHDIRIGDTVIVQRAGDVIPQ 415

Query: 413 VVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERL 472
           V+D+++ +R  +A  ++FP  CP+C S  VR+ N KTGKL +  RCTGG  C AQ +E L
Sbjct: 416 VLDVLLEKRPAEAVKYAFPEKCPVCGSHAVRERNEKTGKLDSVTRCTGGFVCRAQAVEHL 475

Query: 473 KHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTS-TTKIENILGFG 531
           KHFVSR+AF+IEGLG +Q+DFFF+SEDPA SI+   DIFTL+ RQ+ S  TK+ENI GFG
Sbjct: 476 KHFVSRNAFDIEGLGSKQIDFFFESEDPALSIKTAPDIFTLKARQEASHLTKLENIDGFG 535

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
            VSV  L+D+I+ RR I L R IF+LGIRHVG   A+ LA+ Y +Y++F + +       
Sbjct: 536 KVSVKKLFDAIDARREIDLHRLIFALGIRHVGETTAKLLARSYGTYEHFEEAMKAAADPA 595

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
           +D W  L  +  +G+++A+AI+EFY+ PRN+  ++ L++E+ P          S +  K 
Sbjct: 596 SDAWAELNSIDGIGEVVARAIIEFYKEPRNLDVIDRLIRELRPKEAEKPSTEGSPVAGKT 655

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG+L+K  R +A+     LGA V+  +S+KTDI++ G   GSKL KA +LGV+ M+E
Sbjct: 656 VVFTGSLEKFTRDEAKARAESLGAKVAGSVSKKTDILVAGPGAGSKLAKAAELGVQTMDE 715

Query: 712 EQFLFLL 718
           +++L L+
Sbjct: 716 DEWLALI 722


>gi|306844319|ref|ZP_07476911.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
 gi|306275391|gb|EFM57132.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
          Length = 719

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/724 (46%), Positives = 477/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEARFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLALNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L DIDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRDIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYEFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDVVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|15889366|ref|NP_355047.1| NAD-dependent DNA ligase LigA [Agrobacterium tumefaciens str. C58]
 gi|166215388|sp|A9CIB3|DNLJ_AGRT5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15157212|gb|AAK87832.1| DNA ligase [Agrobacterium tumefaciens str. C58]
          Length = 724

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/727 (47%), Positives = 488/727 (67%), Gaps = 14/727 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K Q IP+E L+  +A  EL+ L  E++ HD  Y+    P I D++YDALKRR DAI  
Sbjct: 1   MSKDQ-IPVENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEA 59

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP L R++ P+    K+G     +   + H+ P LSL+  ++ EDLR F++ +YRF   
Sbjct: 60  AFPALVRADSPS---KKVGFTPLPTFAPIVHARPMLSLDNTFSEEDLRDFVSSVYRFLGH 116

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             D+SI FT EPKIDG  ++IRYE  K   AA RGDG +GE+V+A IR I  IP  L  +
Sbjct: 117 LPDDSIAFTAEPKIDGLSMSIRYENRKLKTAATRGDGTTGENVTANIRTIKEIPNELPAD 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNF 238
            P+++EVRGEVY++K+DFLALN +M A G++ Y NPRN ASG LR+L+  ++T  R L F
Sbjct: 177 APDVVEVRGEVYMAKSDFLALNAQMEADGKQTYVNPRNTASGSLRQLD-ANVTAKRKLRF 235

Query: 239 FVHGLGKTSE-----IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRS 293
           F + LG+ S        A  QY +++K R  GFPVN  +++  +   ++ +YNE+   R 
Sbjct: 236 FAYALGEVSNGGQPARIADTQYGIVEKFREWGFPVNPLMKRFTSAQQLLEHYNEIGVARP 295

Query: 294 TLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILT 353
            L YDIDG+VYKVD   LQ++LG R+RSPRW  +HKF  +QA T + +I+IQ+GRTG LT
Sbjct: 296 DLDYDIDGVVYKVDRLDLQERLGFRSRSPRWATAHKFPAEQAFTTVENIEIQVGRTGALT 355

Query: 354 PVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRG-GRDIRVGDRVLVKRAGEVIPK 412
           PVARL P+ +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+
Sbjct: 356 PVARLTPITVGGVVVTNATLHNADYIEGIGNSGERIRPEDHDIRIGDTVIVQRAGDVIPQ 415

Query: 413 VVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERL 472
           V+D+++ +R   A  + FP  CP+C S  VR+ N KTGKL +  RCTGG  C AQ +E L
Sbjct: 416 VLDVLLEKRAAGAAKYVFPEKCPVCGSHAVRERNEKTGKLDSVTRCTGGFVCRAQAVEHL 475

Query: 473 KHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTS-TTKIENILGFG 531
           KHFVSR+AF+IEGLG +Q+DFFF+S+DPA SI+   DIFTL+ RQ+ S  TK+ENI GFG
Sbjct: 476 KHFVSRNAFDIEGLGTKQIDFFFESDDPALSIKTAPDIFTLKARQEASHLTKLENIDGFG 535

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
            VSV  L+D+I+ RR I L R IF+LGIRHVG   A+ LA+ Y +Y++F + +       
Sbjct: 536 KVSVKKLFDAIDARRAIDLHRLIFALGIRHVGETTAKLLARSYGTYEHFEKAMKAAADPA 595

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
           +D W  L  +  +G+++A+AI+EFY+ PRN+  ++ L++E+ P          S +  K 
Sbjct: 596 SDAWAELNSIDGIGEVVARAIIEFYKEPRNLDVIDRLIRELQPKEAEKPSTEGSPVAGKT 655

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG+L+K  R +A+     LGA V+  +S+KTDI++ G   GSKL KA +LGV+ M+E
Sbjct: 656 VVFTGSLEKFTRDEAKARAESLGAKVAGSVSKKTDILVAGPGAGSKLAKATELGVQTMDE 715

Query: 712 EQFLFLL 718
           +++L L+
Sbjct: 716 DEWLALI 722


>gi|225852902|ref|YP_002733135.1| NAD-dependent DNA ligase LigA [Brucella melitensis ATCC 23457]
 gi|256263616|ref|ZP_05466148.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|254781270|sp|C0RE59|DNLJ_BRUMB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225641267|gb|ACO01181.1| DNA ligase, NAD-dependent [Brucella melitensis ATCC 23457]
 gi|263093668|gb|EEZ17673.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409444|gb|ADZ66509.1| NAD-dependent DNA ligase LigA [Brucella melitensis M28]
 gi|326539150|gb|ADZ87365.1| DNA ligase, NAD-dependent [Brucella melitensis M5-90]
          Length = 719

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|17986872|ref|NP_539506.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str. 16M]
 gi|256045051|ref|ZP_05447952.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565350|ref|ZP_05835834.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265991477|ref|ZP_06104034.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|81852173|sp|Q8YI56|DNLJ_BRUME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|17982511|gb|AAL51770.1| nad-dependent DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|260151418|gb|EEW86512.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|263002261|gb|EEZ14836.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 719

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 477/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L++F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALAIFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFKKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|23502291|ref|NP_698418.1| NAD-dependent DNA ligase LigA [Brucella suis 1330]
 gi|62290313|ref|YP_222106.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 1 str. 9-941]
 gi|82700237|ref|YP_414811.1| NAD-dependent DNA ligase LigA [Brucella melitensis biovar Abortus
           2308]
 gi|161619368|ref|YP_001593255.1| NAD-dependent DNA ligase LigA [Brucella canis ATCC 23365]
 gi|163843675|ref|YP_001628079.1| NAD-dependent DNA ligase LigA [Brucella suis ATCC 23445]
 gi|189024547|ref|YP_001935315.1| NAD-dependent DNA ligase LigA [Brucella abortus S19]
 gi|225627871|ref|ZP_03785908.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|254689615|ref|ZP_05152869.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|254694105|ref|ZP_05155933.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|254697757|ref|ZP_05159585.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704678|ref|ZP_05166506.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|254708093|ref|ZP_05169921.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|254710462|ref|ZP_05172273.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|254730646|ref|ZP_05189224.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|256031956|ref|ZP_05445570.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|256113974|ref|ZP_05454757.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160155|ref|ZP_05457849.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|256257864|ref|ZP_05463400.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|256369836|ref|YP_003107347.1| DNA ligase [Brucella microti CCM 4915]
 gi|260169093|ref|ZP_05755904.1| NAD-dependent DNA ligase LigA [Brucella sp. F5/99]
 gi|260546856|ref|ZP_05822595.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260566074|ref|ZP_05836544.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260755142|ref|ZP_05867490.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260758361|ref|ZP_05870709.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260762187|ref|ZP_05874530.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884154|ref|ZP_05895768.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|261214403|ref|ZP_05928684.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261315595|ref|ZP_05954792.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261318033|ref|ZP_05957230.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261755371|ref|ZP_05999080.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|261758598|ref|ZP_06002307.1| DNA ligase [Brucella sp. F5/99]
 gi|265989064|ref|ZP_06101621.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|265995315|ref|ZP_06107872.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998527|ref|ZP_06111084.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|297248700|ref|ZP_06932418.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
 gi|75496544|sp|Q57C89|DNLJ_BRUAB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81752355|sp|Q8FZQ3|DNLJ_BRUSU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123768412|sp|Q2YLZ6|DNLJ_BRUA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359236|sp|A9M679|DNLJ_BRUC2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359237|sp|B0CHK8|DNLJ_BRUSI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781269|sp|B2S6P4|DNLJ_BRUA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|23348266|gb|AAN30333.1| DNA ligase, NAD-dependent [Brucella suis 1330]
 gi|62196445|gb|AAX74745.1| LigA, DNA ligase, NAD-dependent [Brucella abortus bv. 1 str. 9-941]
 gi|82616338|emb|CAJ11395.1| BRCT domain:NAD-dependent DNA ligase:ATP/GTP-binding site motif A
           (P-loop):Zn-finger in NAD-dependent DNA ligase, C4
           type:NAD [Brucella melitensis biovar Abortus 2308]
 gi|161336179|gb|ABX62484.1| DNA ligase, NAD-dependent [Brucella canis ATCC 23365]
 gi|163674398|gb|ABY38509.1| DNA ligase, NAD-dependent [Brucella suis ATCC 23445]
 gi|189020119|gb|ACD72841.1| DNA ligase [Brucella abortus S19]
 gi|225617876|gb|EEH14921.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|255999999|gb|ACU48398.1| DNA ligase [Brucella microti CCM 4915]
 gi|260095906|gb|EEW79783.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260155592|gb|EEW90672.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260668679|gb|EEX55619.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260672619|gb|EEX59440.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675250|gb|EEX62071.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260873682|gb|EEX80751.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|260916010|gb|EEX82871.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261297256|gb|EEY00753.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261304621|gb|EEY08118.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261738582|gb|EEY26578.1| DNA ligase [Brucella sp. F5/99]
 gi|261745124|gb|EEY33050.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|262553151|gb|EEZ08985.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|262766428|gb|EEZ12217.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|264661261|gb|EEZ31522.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|297175869|gb|EFH35216.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
          Length = 719

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|237815820|ref|ZP_04594817.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
 gi|237789118|gb|EEP63329.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
          Length = 725

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 10  ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 69

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 70  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 126

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 127 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 186

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 187 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 246

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 247 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 306

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 307 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 366

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 367 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 426

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 427 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 480

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 481 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 540

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 541 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 600

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 601 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 660

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 661 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 720

Query: 717 LLQQ 720
           L+ +
Sbjct: 721 LVGE 724


>gi|239832299|ref|ZP_04680628.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
 gi|239824566|gb|EEQ96134.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
          Length = 734

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/724 (47%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP+E L+  +A  EL  L +EI++HD+ Y+   +P I D+EYDALKRR DAI   FP L 
Sbjct: 19  IPVEKLTEPEAVSELGRLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLV 78

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P+    ++G         V H+ P LSL   ++ ED+R F+  +YRF  +  DNSI
Sbjct: 79  RTDSPS---LRVGTAPVSKFAPVVHARPMLSLGNAFSDEDVRDFVGSVYRFLGQLPDNSI 135

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++E
Sbjct: 136 AFTAEPKIDGLSMSIRYENGVLVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPSVVE 195

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK 245
           VRGEVY++K+DFLALN++M A G++ Y NPRN A+G LR+L+     +R L FF +  G+
Sbjct: 196 VRGEVYMAKSDFLALNEQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGE 255

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++ A  Q  M++  R  GFPVN   ++ +    ++++Y  +   R TL YDIDG+VYK
Sbjct: 256 MSDMPADTQMGMVEMFREWGFPVNPLTKRLHGADELLAHYRAIGLERPTLDYDIDGVVYK 315

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ +LG R+RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARLEP+ +GG
Sbjct: 316 VDRLDLQTRLGFRSRSPRWAIAHKFPAEQATTILRGIDIQVGRTGALTPVARLEPITVGG 375

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
            ++TNATLHNEDYIKG+   G+ +R    DIR+GD V+V+RAG+VIP++VD+I+ +R  D
Sbjct: 376 VVVTNATLHNEDYIKGIGLKGERIRADEHDIRLGDTVIVQRAGDVIPQIVDVILEKRPVD 435

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP  CP+C S  VR+         A +RCTGGL C+AQ +ER++HFVSR+AF+IE
Sbjct: 436 AVPFHFPHECPVCGSHAVREEGE------AVYRCTGGLTCAAQAVERIRHFVSRNAFDIE 489

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +ED +  I+ PADIFTLQ+RQ  S  K+ENI GFG  SV  LYD+IN 
Sbjct: 490 GLGEKQVEFFFHAEDDSLKIKSPADIFTLQKRQAGSLKKLENIEGFGATSVKKLYDAIND 549

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA--------HNNDDWL 596
           RR I+L RF+F LGIRHVG   A+  A+ YLSY  F +     +           N+ W 
Sbjct: 550 RREIALNRFLFGLGIRHVGEVNAKRFARSYLSYAAFEKAALEAVPPKEGDRTDKGNEAWQ 609

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            LI V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 610 DLIAVEGIGSIVAEAVVDFYAEPHNREVLAALLAEVTPLDEAARVATGSPVEGKTVVFTG 669

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +SRKTD+++ G   GSKL KA +LG+++++E+ +  
Sbjct: 670 SLERMSRDEAKAMAERYGAKTAGSVSRKTDLVVAGPGAGSKLAKASELGIEVIDEDAWFK 729

Query: 717 LLQQ 720
           L+ +
Sbjct: 730 LVGE 733


>gi|254702142|ref|ZP_05163970.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261752711|ref|ZP_05996420.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261742464|gb|EEY30390.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
          Length = 719

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 475/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA     +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTVGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|148560656|ref|YP_001259312.1| NAD-dependent DNA ligase LigA [Brucella ovis ATCC 25840]
 gi|166215401|sp|A5VRG5|DNLJ_BRUO2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148371913|gb|ABQ61892.1| DNA ligase, NAD-dependent [Brucella ovis ATCC 25840]
          Length = 719

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/724 (46%), Positives = 475/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++    Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPVDTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|306843233|ref|ZP_07475843.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
 gi|306286556|gb|EFM58135.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
          Length = 719

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/724 (46%), Positives = 475/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLVLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LY++I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYEAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|256255361|ref|ZP_05460897.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|261222562|ref|ZP_05936843.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|260921146|gb|EEX87799.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
          Length = 719

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/724 (46%), Positives = 475/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  + RF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVCRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|254714455|ref|ZP_05176266.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|254717353|ref|ZP_05179164.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261219183|ref|ZP_05933464.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261322244|ref|ZP_05961441.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|260924272|gb|EEX90840.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261294934|gb|EEX98430.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
          Length = 719

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/724 (46%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  S+  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSMKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIR+VG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRYVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|256061478|ref|ZP_05451622.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261325484|ref|ZP_05964681.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261301464|gb|EEY04961.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
          Length = 719

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/724 (46%), Positives = 474/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY+ K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMVKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +ED A  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDSALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|294852747|ref|ZP_06793420.1| DNA ligase [Brucella sp. NVSL 07-0026]
 gi|294821336|gb|EFG38335.1| DNA ligase [Brucella sp. NVSL 07-0026]
          Length = 719

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/724 (46%), Positives = 474/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFK-VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R + P+    ++G    L+ F  V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RDDSPS---RRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GF VN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFLVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF   QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAGQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD--------WL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +     +     D        W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|163868703|ref|YP_001609915.1| NAD-dependent DNA ligase LigA [Bartonella tribocorum CIP 105476]
 gi|190359235|sp|A9IW95|DNLJ_BART1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161018362|emb|CAK01920.1| DNA ligase [Bartonella tribocorum CIP 105476]
          Length = 719

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/722 (46%), Positives = 473/722 (65%), Gaps = 17/722 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L++ +A +EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L R 
Sbjct: 6   IKNLTVVEAERELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRV 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +KIG  ++    K  H+ P LSL+  ++ ED+ +F+ RI RF +  +   +  
Sbjct: 66  DSPS---HKIGAAISEKFEKSVHAQPMLSLDNAFSAEDVYEFVERIRRFLRLPETQVLEI 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYEKG+ V AA RGDG  GE+V+A  R I  IP+VL  + P++IEVR
Sbjct: 123 TAEPKIDGLSLSLRYEKGRLVRAATRGDGTVGENVTANARTIADIPQVLQGDFPDVIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGREDFQALNISQQEKGKLTFANPRNAAAGSLRQLDSRITASRKLQFFAYACGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           EIFA+ Q EM+ K++  GF +N   +   T   I+SYY +++  R +L YDIDG+VYKV+
Sbjct: 243 EIFAESQMEMMTKLKEYGFVINPLTKVFKTVEDIISYYRDIEERRYSLNYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQK+LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ IGG +
Sbjct: 303 DLMLQKRLGFVSRSPRWAIAHKFPAEKAMALLEDIDIQVGRTGALTPVARLTPITIGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+ +R GRDIR+GD V+++RAG+VIP+VVDI++ +R  D+  
Sbjct: 363 VTNASLHNEDYIKGIGHKGEPIREGRDIRIGDTVIIQRAGDVIPQVVDIVLEKRQKDSSA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  VR++        A  RCTGGL C AQ +ER++HFV+R+AF+IEGLG
Sbjct: 423 FVFPDLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVARNAFDIEGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           K+Q++FFF ++D A  I  PADIFTL+RRQ+ S  ++ENI GFG VSV  LYD+IN RR 
Sbjct: 477 KKQVEFFFHAQDEALCIHTPADIFTLERRQEKSLIRLENIEGFGTVSVRKLYDAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA-------HNNDDWLSLIR 600
           I L RF+F+LGIRHVG   AR LA+ Y +Y  F       +          N+ W+ L  
Sbjct: 537 IPLSRFLFALGIRHVGEVNARRLARAYQTYTAFETAAMEALMPCKQDNKEGNEAWMELTN 596

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  +  AIV+FYQ   N   +  LL+E++P         SS I  K +VFTGTL  
Sbjct: 597 IEGIGPQVGSAIVDFYQEAHNREVLAVLLEEITPLDEVPIMTASSPIAEKIIVFTGTLAH 656

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R +A+    +LGA  S  LS+KTD+++ G   GSKL KAQ+ GV++++EE ++ L++ 
Sbjct: 657 MSRDEAKALAERLGAKTSGSLSKKTDLLVAGPGAGSKLTKAQEFGVQVIDEEAWMRLIKG 716

Query: 721 YN 722
           +N
Sbjct: 717 HN 718


>gi|240850882|ref|YP_002972282.1| DNA ligase [Bartonella grahamii as4aup]
 gi|240268005|gb|ACS51593.1| DNA ligase [Bartonella grahamii as4aup]
          Length = 719

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/719 (47%), Positives = 472/719 (65%), Gaps = 17/719 (2%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L R + P
Sbjct: 9   LTAVEAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRVDSP 68

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +   +KIG  ++    K  H+ P LSL+  ++ ED+ +F+ RI RF +  +   +  T E
Sbjct: 69  S---HKIGAPISEKFEKSVHAQPMLSLDNAFSSEDVTEFVERIRRFLRLPETQVLEITAE 125

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYEKG+ V AA RGDG  GE+V+A  R I  IP+VL  + P+IIEVRGEV
Sbjct: 126 PKIDGLSLSLRYEKGRLVGAATRGDGTVGENVTANARTIADIPQVLQGDFPDIIEVRGEV 185

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIF 250
           Y+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ SEI 
Sbjct: 186 YMGREDFQALNISQQEKGKLTFANPRNAAAGSLRQLDSRITASRKLQFFAYACGEVSEIL 245

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
           A+ Q EM++K++  GF +N   +   T   I+SYY++++  R +L YDIDG+VYKV++  
Sbjct: 246 AESQMEMMKKLKEYGFVINPLTKAFKTLEEIISYYHDIEECRHSLSYDIDGIVYKVNDLM 305

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQK+LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG ++TN
Sbjct: 306 LQKRLGFVSRSPRWAIAHKFPAEKAIALLKDIDIQVGRTGALTPVARLTPITVGGVVVTN 365

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           A+LHNEDYIKG+   G+ +R GRDIRVGD V+V+RAG+VIP+V+D+I+ +R  DA  F F
Sbjct: 366 ASLHNEDYIKGIGHKGEPIREGRDIRVGDSVIVQRAGDVIPQVIDVIIEKRPKDAAVFIF 425

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP C S  VR++        A  RCTGGL C AQ +ER++HFV+R+AF+IEGLGK+Q
Sbjct: 426 PHLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVARNAFDIEGLGKKQ 479

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++FFF ++D A  I  PADIFTL+RRQ+ S  ++ENI GFG VSV  LYD+IN RR I L
Sbjct: 480 VEFFFYAQDEALCIHTPADIFTLERRQEKSLIRLENIEGFGTVSVRKLYDAINARREIPL 539

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA-------HNNDDWLSLIRVPL 603
            RF+F+LGIRHVG   AR LA+ Y +Y  F       +          N+ W+ L  +  
Sbjct: 540 SRFLFALGIRHVGEVNARRLARTYKNYTAFETTAMGALMPCDKANEKGNEAWMELTNIEG 599

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G  +  AIV+FYQ   N   +  LL+EV+P         SS I  K +VFTGTL  + R
Sbjct: 600 IGPQVGSAIVDFYQEAHNREVLSVLLEEVTPLDEEPITTASSPIAEKTIVFTGTLAHMSR 659

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
            +A+    +LGA  S  LS+KTD+++ G   GSKL KA++LGV++++EE +L L+++++
Sbjct: 660 DEAKALAERLGAKTSGSLSKKTDLLVAGPGAGSKLAKAEELGVEVIDEETWLQLIEEHD 718


>gi|153009084|ref|YP_001370299.1| NAD-dependent DNA ligase LigA [Ochrobactrum anthropi ATCC 49188]
 gi|166216221|sp|A6WZR6|DNLJ_OCHA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151560972|gb|ABS14470.1| DNA ligase, NAD-dependent [Ochrobactrum anthropi ATCC 49188]
          Length = 721

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/725 (46%), Positives = 473/725 (65%), Gaps = 21/725 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E L+  +A  EL  L +EI++HD+ Y+   +P I D+EYDALKRR DAI   FP L R
Sbjct: 5   PVEKLTEPEAVSELERLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P+    ++G        +V H+ P LSL   ++ +D+R F+  +YRF     DNSI 
Sbjct: 65  TDSPS---LRVGTAPVSKFAQVVHARPMLSLGNAFSDDDVRDFVGSVYRFLGPLPDNSIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  ++IRYE G  +  A RGDG +GE+V+  IR I  IP  L    P ++EV
Sbjct: 122 FTAEPKIDGLSMSIRYENGILISGATRGDGTTGENVTTNIRTIAEIPNRLPAGAPSVVEV 181

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEVY++K+DFLALN++M A G++ Y NPRN A+G LR+L+     +R L FF +  G+ 
Sbjct: 182 RGEVYMAKSDFLALNEQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEM 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S++ A  Q  M++  R  GFPVN   ++ +    ++++Y  +   R+ L YDIDG+VYKV
Sbjct: 242 SDMPADTQMGMVEIFREWGFPVNPLTKRLHGADELLAHYRAIGLERAQLDYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D   LQ +LG R+RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARLEP+ +GG 
Sbjct: 302 DRLDLQTRLGFRSRSPRWAIAHKFPAEQATTILRGIDIQVGRTGALTPVARLEPITVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
           ++TNATLHNEDYIKG+   G+ +R    DIRVGD V+V+RAG+VIP++VD+++ +R  DA
Sbjct: 362 VVTNATLHNEDYIKGIGLKGERIRADEHDIRVGDTVIVQRAGDVIPQIVDVVLEKRKADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF FP  CP+C S  VR+         A +RCTGGL C+AQ +ER++HFVSR+AF+IEG
Sbjct: 422 TPFVFPHECPVCHSHAVREEGE------AVYRCTGGLTCAAQAVERIRHFVSRNAFDIEG 475

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSINK 544
           LG++Q++FFF +ED    I+ PADIFTLQ+RQ  S   K+ENI GFG  SV  LYD+IN 
Sbjct: 476 LGEKQVEFFFHAEDDKLKIKSPADIFTLQQRQAESPLKKLENIEGFGATSVKKLYDAIND 535

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA--------HNNDDWL 596
           RR I+L RF+F LGIRHVG   A+  A+ YLSY  F +     +           N+ W 
Sbjct: 536 RREIALHRFLFGLGIRHVGEVNAKRFARAYLSYAAFEEAALEAVPPKEGDRTDKGNEAWQ 595

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFT 655
            LI V  +G I+A+A+V+FY  P N   ++ L K  V+P       +  S +E K +VFT
Sbjct: 596 ELIAVEGIGSIVAEAVVDFYAEPHNREVLDNLFKAGVTPVDEVALVSTGSPVEGKTVVFT 655

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           G+L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG+++++E+ + 
Sbjct: 656 GSLERMSRDEAKAMAERYGAKTAGSVSKKTDLVVAGPGAGSKLAKASELGIEVIDEDAWF 715

Query: 716 FLLQQ 720
            L+ +
Sbjct: 716 TLVGE 720


>gi|49474446|ref|YP_032488.1| NAD-dependent DNA ligase LigA [Bartonella quintana str. Toulouse]
 gi|81646941|sp|Q6FZ81|DNLJ_BARQU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49239950|emb|CAF26355.1| DNA ligase [Bartonella quintana str. Toulouse]
          Length = 719

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/719 (46%), Positives = 469/719 (65%), Gaps = 17/719 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L RS
Sbjct: 6   IKNLTALEAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRS 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +KIG  ++    K  H+   LSL+  ++ ED+ +FI RI RF +      +  
Sbjct: 66  DSPS---HKIGAPVSEKFEKSVHAQAMLSLDNAFSSEDICEFIVRIRRFLRLPATQILEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYEKG+ V AA RGDG+ GE+V+A  R I  IP+VL    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEKGRLVCAATRGDGYIGENVTANARTISDIPKVLRGEFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + +F ALN      G+  +ANPRNAA+G LR+L+P    +R L+FF +  G+ S
Sbjct: 183 GEVYMRRENFQALNMSQQEKGKFVFANPRNAAAGSLRQLDPRITASRKLHFFAYACGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E FA  Q EM++K++  GF +N   +   T   I+SYY++++  R +L YDIDG+VYKV+
Sbjct: 243 ETFAASQMEMMKKLKEYGFFINPLTKSFKTLEEIISYYHDIEECRHSLSYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW ++HKF  ++A   L  IDIQ+GRTG LTPVARL P+ IGG +
Sbjct: 303 DLKLQMRLGFVSRSPRWAVAHKFPAEKAMALLEGIDIQVGRTGALTPVARLAPITIGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+ +R GRDIRVGD V+V+RAG+VIP++VDII  +R   A  
Sbjct: 363 VTNASLHNEDYIKGIGHKGESIREGRDIRVGDTVIVQRAGDVIPQIVDIIAEKRPKGASA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  VR++        +  RCTGGL C AQ +ER++HFVSR+AF+IEGLG
Sbjct: 423 FVFPHLCPACGSHAVREVGE------SVRRCTGGLICPAQAIERIRHFVSRNAFDIEGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           K+Q++FFF  +D A  I  PADIFTLQRRQ+ +  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 KKQVEFFFHIQDEALCIHTPADIFTLQRRQEKALVRLENMEGFGTVSVRKLYNAINMRRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-------AQEINNIIAHNNDDWLSLIR 600
           + L RF+F+LGIRH+G   AR LA  Y +Y  F           + +    N+ WL L  
Sbjct: 537 VPLSRFLFALGIRHIGEVNARRLAHAYQNYTAFETVAMAATMPYDKVGEEGNEAWLELTN 596

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  + +AI++FYQ   N   + ALL+EV+P    +    SS I  K +VFTGTL +
Sbjct: 597 IEGIGPQVGEAIIDFYQEAHNREVLAALLREVTPLDEENVMTASSPIAGKTIVFTGTLAR 656

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           + R +A+    +LGA  S  LS+KTD+++ G   GSKL KAQ LGV++++EE +L L++
Sbjct: 657 MSRDEAKALAERLGAKTSGSLSKKTDLLVAGSAVGSKLAKAQGLGVEVIDEEAWLQLIE 715


>gi|49475845|ref|YP_033886.1| NAD-dependent DNA ligase LigA [Bartonella henselae str. Houston-1]
 gi|81647763|sp|Q6G2R5|DNLJ_BARHE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49238653|emb|CAF27899.1| DNA ligase [Bartonella henselae str. Houston-1]
          Length = 716

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/719 (46%), Positives = 470/719 (65%), Gaps = 17/719 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L R 
Sbjct: 6   IQNLTALEAASELEWLAKEITRHDVLYNRNDQPEISDAEYDALRRRNAEIEALFPELIR- 64

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
             P+ P +KIG  ++    K  HS P LSL+  ++ ED+ +F+ R+ RF +  +   +  
Sbjct: 65  --PDSPSHKIGAPISEKFEKSVHSQPMLSLDNAFSSEDVSEFMERVRRFLRLPETQMLEI 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE+G+ V AA RGDG+ GE+V+A  R I  IP+VL    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEQGRLVCAATRGDGYVGENVTANARTISDIPQVLQGKFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMRRADFQALNVNQQEKGKLAFANPRNAAAGSLRQLDSRITASRKLQFFAYACGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           EIFA+ Q  M++K++  GF +N  +++  +   ++SYY++++  R  L YDIDG+VYKV+
Sbjct: 243 EIFAESQMGMMEKLKEYGFVINPLIKKIKSLEELISYYHDIEERRHALSYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A T L  IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQMRLGFVSRSPRWAIAHKFPAEKAMTVLEGIDIQVGRTGALTPVARLAPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ITNA+LHNEDYIKG+ + G+ +R G DIRVGD V+V+RAG+VIP+++DI+  +R  DA  
Sbjct: 363 ITNASLHNEDYIKGIGSKGEPIREGNDIRVGDTVIVQRAGDVIPQIIDIVAEKRSKDASA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  VR++        A  RCTGGL C AQ +ER++HFVSR+AF+IEGLG
Sbjct: 423 FVFPYLCPACGSYAVREIGE------AVRRCTGGLICPAQAIERIRHFVSRNAFDIEGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           K+Q++FFF+ +D    I  PADIFTLQRRQ+ S   +EN+ GFG VSV  LYD+IN RR 
Sbjct: 477 KKQVEFFFQIQDETLCIHTPADIFTLQRRQEKSLVHLENMEGFGTVSVRKLYDAINARRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI-------NNIIAHNNDDWLSLIR 600
           I L RF+F+LGIR+VG   AR LA+ Y +Y  F           + +    N+ W+ L  
Sbjct: 537 IPLSRFLFALGIRYVGEVNARRLARAYQNYTAFETAAMAATMPDDKVGKEGNEAWMELTN 596

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  + +AI++FY+   N   +  LL EV+P         SS I  K +VFTGTL +
Sbjct: 597 IEGIGPQVGEAIIDFYKEVHNREVLSGLLCEVTPLDEESVMTASSPIAGKIIVFTGTLTR 656

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           + R +A+    +LGA  S  LS+KT++++ G   GSKL KAQ+LGV++++EE +L L++
Sbjct: 657 MSRDEAKALAERLGAKTSGSLSKKTNLLVAGVGGGSKLTKAQELGVEVIDEEAWLQLIE 715


>gi|319408814|emb|CBI82471.1| DNA ligase [Bartonella schoenbuchensis R1]
          Length = 718

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/720 (46%), Positives = 474/720 (65%), Gaps = 16/720 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+  +A  EL  L +EI+ HD  Y    +P I D++YDAL+RR   I   FP+L R+
Sbjct: 6   VKNLTALEAASELEWLAKEIARHDVLYNNNDQPEISDAQYDALRRRNTEIEALFPELIRT 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+    KIG  ++    K  H+   LSL+  ++ ED+ +F+ R+ RF +     ++  
Sbjct: 66  DSPS---YKIGAPVSEKFEKSVHAQAMLSLDNAFSAEDVSEFVERVRRFLRLPSTQTLEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE+GK V AA RGDG++GE+V+   R I  IP+VL    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEQGKLVRAATRGDGYTGENVTTNARTISDIPKVLQGEFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVYI + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYIRQEDFQVLNINQQKEGKIAFANPRNAAAGSLRQLDSRITASRKLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ AK Q EM+ K++  GF VN   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAKSQMEMVNKLKEYGFIVNPFTKVFEKVEDLISYYHFIEEQRQSLSYDIDGVVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A+  L  IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLGLQMRLGFVSRSPRWAIAHKFPAEKATALLEGIDIQVGRTGALTPVARLAPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VDII ++R  DA P
Sbjct: 363 VTNATLHNEDYIKGVGRKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDIISSKRPKDAVP 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  VR++        A +RCTGGL CSAQ +ER++HFVSR+AF+IEGLG
Sbjct: 423 FVFPHHCPACGSHAVREVGE------AVYRCTGGLICSAQAIERIRHFVSRNAFDIEGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           K+Q++FFF  +D    IR P DIFTL++RQ+ + T++ENI GFG +SV  L+D+IN RR 
Sbjct: 477 KKQVEFFFNIQDETLCIRSPVDIFTLEKRQKKALTRLENIEGFGSLSVRKLFDAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-AQEINNIIAHN-----NDDWLSLIRV 601
           I L RF+F+LGIRHVG   A+ LA+ Y +Y  F A  +  I+ H+     N++W  LI +
Sbjct: 537 IPLSRFLFALGIRHVGEVNAQRLARVYRNYTAFEAAVMAAIVPHDKTDEGNEEWTDLISI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  + +AI++FYQ   N   + ALL+EV+P          S I  K +VFTGTL  +
Sbjct: 597 EGIGVRVGRAIIDFYQEAHNRDVLSALLQEVTPLPEEAIATDYSPIAGKIIVFTGTLMSM 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  +S+KTD++I G   GSKL KA++LGV+I++E+ +  L+++Y
Sbjct: 657 SRDEAKALAERLGAKTSGSISKKTDLLIAGLGAGSKLTKAKELGVEIIDEDSWSQLIKEY 716


>gi|307944884|ref|ZP_07660221.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
 gi|307771808|gb|EFO31032.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
          Length = 721

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/716 (45%), Positives = 468/716 (65%), Gaps = 13/716 (1%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           + +EAL+ EQA  EL  L   I+ HD  Y+Q   P I D++YDAL+RR  AI   FPDL 
Sbjct: 13  LDVEALTSEQAETELERLANAIAKHDKLYHQDDAPAISDADYDALRRRNTAIEARFPDLV 72

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--N 124
           R + P+     +G   + +  K+ H +P LSL+  +N ED++ F+ R+ RF  K D    
Sbjct: 73  RDDSPS---RNVGAAPSEAFSKIEHKVPMLSLDNAFNDEDVQDFVGRVRRFL-KFDPLMG 128

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
           ++  T EPKIDG  +++RYE G  VYAA RGDG +GE+V+A  + I  IP+ LS + P++
Sbjct: 129 ALAVTAEPKIDGLSLSLRYEAGALVYAATRGDGTTGENVTANAKTISDIPQKLSGDAPDV 188

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHG 242
           +E+RGEVY++  DF  LN  M A G K +ANPRNAA+G LR+L  ++IT  R L FF + 
Sbjct: 189 VEIRGEVYMAHADFQVLNQRMEANGGKVFANPRNAAAGSLRQLK-SEITASRPLKFFAYA 247

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G  S + A  Q  M+++M+  GF +N  +++  T   +++ Y+ ++  R+TL YDIDG+
Sbjct: 248 WGDMSALPADTQMGMVEQMKVWGFQINPLMKRCETVEELLAVYHGIEEDRATLGYDIDGV 307

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD   LQ++LG  +RSPRW I+HKF  ++A T L +IDIQ+GRTG LTPVA+LEPV 
Sbjct: 308 VYKVDRLDLQQRLGFVSRSPRWAIAHKFPAEKAYTILNEIDIQVGRTGALTPVAKLEPVT 367

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG +++NATLHNEDYIKG+   G+ +RGG+D+R GD V V+RAG+VIP++VD+ +++R 
Sbjct: 368 VGGVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRPGDTVQVQRAGDVIPQIVDVDLSKRK 427

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
             A+PF FPS CP C S  VR+ NPKTG+L A  RCTG L C AQ  ERLKHFVSR+AF+
Sbjct: 428 EGAEPFEFPSVCPRCGSHAVREENPKTGRLDAVRRCTGALICPAQATERLKHFVSRNAFD 487

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           IEG G +Q+D FF        ++  ADIFTL+ R + S TK+ N  G+G VS  NL+++I
Sbjct: 488 IEGFGDKQVDAFFADG----LVKTAADIFTLEERDKQSLTKLRNREGWGTVSAKNLFEAI 543

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           N +RNI L R IF LGIRHVG   A+ LA+ Y S+Q F   +      N + W  L  + 
Sbjct: 544 NAKRNIDLHRLIFGLGIRHVGEGNAKLLARAYGSWQAFYDAMVKAHDKNGEAWEDLNAID 603

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G I+A+A+ EF+    N   ++ALL ++SP       +  S +  K +VFTG L+++ 
Sbjct: 604 GIGHIVAEALTEFFAEEHNREQLDALLAQISPKQVEQIDSSGSPVAGKTVVFTGALERMT 663

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+    +LGA VS  +S+KTD+++ G   GSKL+KAQ L ++++ E+ +  L+
Sbjct: 664 RDEAKAMAERLGAKVSGSVSKKTDLLVAGPGAGSKLKKAQGLQIEVITEDVWFDLV 719


>gi|254470147|ref|ZP_05083551.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
 gi|211960458|gb|EEA95654.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
          Length = 722

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/713 (44%), Positives = 468/713 (65%), Gaps = 7/713 (0%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           IEAL+ E+A  EL  L + I+ +D+ Y+    PI+ D+ YD L+RR  A+   FP+L R+
Sbjct: 11  IEALNAEEAALELERLARLIAEYDEAYHTQDAPIVDDATYDGLRRRNAALEAKFPELVRA 70

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--NSI 126
           + P+   N++GG +     K+TH++P LSL+  ++ ED++ FI ++ RF  K D    ++
Sbjct: 71  DSPS---NRVGGAVAEGFGKITHAVPMLSLDNAFSDEDVQDFIGKVRRFL-KYDPLMGAL 126

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T EPKIDG  +++RYE GK VYAA RGDG +GE+V+A    I  IP+ L   +P+++E
Sbjct: 127 AVTAEPKIDGLSLSLRYESGKLVYAATRGDGATGENVTANALTIQDIPQELPAGVPDVVE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF ALN  M A G K +ANPRNAA+G LR+LNP    TR L FF +  G 
Sbjct: 187 VRGEVYMSHADFAALNARMEANGGKVFANPRNAAAGSLRQLNPEITKTRPLKFFAYAWGD 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+ A  Q  M++     GF +N  +++  T   ++  Y+ ++  RS L YDIDG+VYK
Sbjct: 247 MSEVPADTQMGMVELFGAWGFQINPLMKRCETVEALLKVYHGIEEDRSGLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ +LG  +RSPRW I+HKF  ++A T L  I+IQ+GRTG LTPVA+LEPV +GG
Sbjct: 307 VDRLDLQGRLGFVSRSPRWAIAHKFPAERAFTTLNAIEIQVGRTGALTPVAKLEPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKG+   G+ +R  +D+RVGD V+++RAG+VIP++VD+ +++R  D 
Sbjct: 367 VVVSNATLHNEDYIKGIGQDGESIRDSKDLRVGDTVIIQRAGDVIPQIVDVDLSKRAEDV 426

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           QP+ FP+ CP+C S  +R+ NP +GK+ A  RCTGGL C AQ +E+LKHFVSR+AF+IEG
Sbjct: 427 QPYEFPTECPVCNSHAIRETNPNSGKVDAVRRCTGGLICPAQAVEKLKHFVSRNAFDIEG 486

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q++ F++ +     IR PADIFTL  R + S  K+ +  GFG VS   L+++I+ +
Sbjct: 487 LGEKQMEAFYEYDMDKGGIRTPADIFTLAERDKVSLNKLRSREGFGAVSARKLFEAIDSK 546

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L R IF LGIRHVG   A+ LA+ Y S+Q F   +       ++ +  L  +  +G
Sbjct: 547 RQIELNRVIFGLGIRHVGEGNAKLLARAYSSWQGFYDAMIAATDTTSEAYRELNDIDGIG 606

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             +A A+VEF+    N+ A+ AL+++++P          S +  K LVFTG+L+++ R +
Sbjct: 607 GTVANALVEFFAEEHNLTALAALMEQITPLDVVVADTSGSPVAGKTLVFTGSLERMSRDE 666

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+     LGA VS  +S+KTD++I G   GSKL KAQ LG+ +++E+ +  L+
Sbjct: 667 AKARAESLGAKVSGSVSKKTDLVIAGPKAGSKLTKAQSLGIDVISEDDWFELV 719


>gi|121602535|ref|YP_989218.1| NAD-dependent DNA ligase LigA [Bartonella bacilliformis KC583]
 gi|166215397|sp|A1UTB5|DNLJ_BARBK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120614712|gb|ABM45313.1| DNA ligase, NAD-dependent [Bartonella bacilliformis KC583]
          Length = 717

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/719 (45%), Positives = 475/719 (66%), Gaps = 18/719 (2%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+  +A +EL  L +EI+ HD  Y  + +P I D+ YDAL+RR   I   FP+L R++ P
Sbjct: 8   LTALEAERELEWLAKEIARHDVLYNNHDQPEISDARYDALRRRNIEIETLFPELVRADSP 67

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    K+G  ++    K  H+   LSL+  ++ ED+ +F+ R+ RF +     ++  T E
Sbjct: 68  S---YKVGAPISERFEKSVHAQAMLSLDNAFSSEDVHEFVERVRRFLRLPVTKTLEMTAE 124

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYEKGK V AA RGDG+ GE+V+   R +  IP+VL  + P+I+EVRGEV
Sbjct: 125 PKIDGLSLSLRYEKGKLVCAATRGDGYVGENVTVNARTLSDIPQVLQGDFPDILEVRGEV 184

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI 249
           Y+  +DF  LN +    G+  +ANPRNAA+G LR+L+ T +T  R L FF +G G+ SE+
Sbjct: 185 YMRHSDFQDLNVDQQEKGKLVFANPRNAAAGSLRQLD-TRMTARRKLKFFAYGWGEVSEM 243

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            AK Q EM++K++  GF +N   +       ++SYY+ ++  R  L YDIDG+VYKV++ 
Sbjct: 244 PAKSQMEMVKKLKEYGFVINPLTKVFKAVEDLISYYHFIEEGRQHLDYDIDGVVYKVNDL 303

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ +LG  +RSPRW I+HKF  ++A   L +IDIQIGRTG LTPVARL P+ +GG ++T
Sbjct: 304 LLQTRLGNVSRSPRWAIAHKFPAEKAMALLENIDIQIGRTGALTPVARLAPITVGGVVVT 363

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NA+LHNEDYIKGL +  + +R GRDIR+GD V+V+RAG+VIP+++D+I+ +R   A PF 
Sbjct: 364 NASLHNEDYIKGLGSKSESIREGRDIRIGDTVIVQRAGDVIPQIIDVIIEKRPKGASPFV 423

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FPS CP C S  VR++        A  RCTGGL C AQ +ER++HFVSR+AF+IEGLG++
Sbjct: 424 FPSLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVSRNAFDIEGLGEK 477

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++FFF ++D    I  PADIFTLQ+RQ+ S T++EN+ GFG +SV  LYD+IN RR I 
Sbjct: 478 QVEFFFHAQDETLRIHSPADIFTLQKRQEKSLTRLENMEGFGTLSVRKLYDAINARRKIP 537

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQ-EINNIIAHN-----NDDWLSLIRVPL 603
           L RF+F+LGIRHVG   AR LA+ Y +Y  F    +  ++  N     N++WL L  +  
Sbjct: 538 LSRFLFALGIRHVGEVNARRLARAYQNYNAFETVAMTALMPCNKEDKGNEEWLELTSIEG 597

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G  + +AI++FYQ   N   + +LL+EV+P          S +  K +VFTGTL  + R
Sbjct: 598 IGVRVGKAIIDFYQETHNRDVLSSLLQEVTPLPEEAAVADYSPVAGKTIVFTGTLVHMSR 657

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
            + +    +LGA  S+ +S+KTD+++ G   GSKL KA++LG++IM+EE +L L+ +++
Sbjct: 658 DEVKALAERLGAKASSSISKKTDLLVAGIGAGSKLTKAKELGIEIMDEESWLQLINEHH 716


>gi|319404500|emb|CBI78105.1| DNA ligase [Bartonella rochalimae ATCC BAA-1498]
          Length = 725

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/723 (46%), Positives = 473/723 (65%), Gaps = 22/723 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL RR + I   FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +KIG  ++    K  H+ P LSL+  +N ED+ +FI RI RF +  +  +I  
Sbjct: 66  DSPS---SKIGAPISEKFEKSIHAQPMLSLDNAFNFEDVSEFIERIRRFLRLPETQTIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G  GE+V+   R I  IP +L  N P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVRAITRGNGSIGENVTTNARTIADIPEILQGNFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNINQQKEGKLVFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q  M++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIGMMKKLKEYGFIINPLTKVFEKVEDLISYYHSIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  ARSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVARSPRWAIAHKFPAEKAIAFLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ITNA+LHNEDYIKG+   G+++R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 ITNASLHNEDYIKGIGHKGELIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRSKDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+     G+ V   RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPHVCPVCGSHAVRE----EGETV--RRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    IR P DIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDKTLCIRSPVDIFTLQRRQENSLRRLENMEGFGVVSVRKLYNAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F       I      +  N+ W  L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVKAQRLARAYQNYIAFETAAMTAIMPPDKNSEGNEIWKELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS---SEIENKKLVFTGTL 658
             +G  + +AI++FYQ   N   + ALLKEV+P    HE  ++   S I  K +VFTGTL
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRDVLSALLKEVTP---LHEAPIAIDYSPIVEKIIVFTGTL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + + R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+
Sbjct: 654 EHMSRDEAKSLAERLGAKTSNSISKKTDLLVAGFGAGSKLVKAQQLGIEVLDEKNWLKLI 713

Query: 719 QQY 721
            ++
Sbjct: 714 DEH 716


>gi|319405996|emb|CBI79627.1| DNA ligase [Bartonella sp. AR 15-3]
          Length = 718

 Score =  635 bits (1638), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 329/720 (45%), Positives = 469/720 (65%), Gaps = 22/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL+RR + I   FP+L R 
Sbjct: 6   IKNLTALEAEGELEWLAKEIARHDVLYHRDDQPEISDAEYDALRRRNEEIEALFPELVRV 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +KIG  ++    K  H+ P LSL+  +N +D+ +FI RI RF +  +   I  
Sbjct: 66  DSPS---SKIGAPISEKFEKSIHAQPMLSLDNAFNFKDVSEFIERIRRFLRFPETQIIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G+ GE+V+   R I  IP++L    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVCAITRGNGYIGENVTTNARTIADIPQILQGKFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNISQQKEGKLAFANPRNAAAGSLRQLDSQITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q EM++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIEMMEKLKEYGFIINPLTKVFEKVEDLISYYHSIEKCRQSLNYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVSRSPRWAIAHKFPAEKAIALLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+++R GRDIRVGD V+++RAG+VIP++VD++V +R      
Sbjct: 363 VTNASLHNEDYIKGIGHKGELIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPKGTPT 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+         A  RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPRVCPVCGSHAVREEGE------AIRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF  +D    I  PADIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHIQDKTLCIHSPADIFTLQRRQENSLRRLENMEGFGVVSVRKLYNAINARRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F     + I         N+ W+ L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVNAQRLARAYQNYAAFETAAMSAIMPSGKNIEGNEIWMELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS---SEIENKKLVFTGTL 658
             +G  + +AI++FYQ   N   + ALLKEV+P    HE  V+   S +  K +VFTGTL
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRNVLLALLKEVTP---LHEMPVAIDYSPVVGKTIVFTGTL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           Q + R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+
Sbjct: 654 QHMSRDEAKSLAERLGAKTSNSISKKTDLLVAGSGAGSKLIKAQQLGIEVLDEKSWLKLI 713


>gi|319407493|emb|CBI81141.1| DNA ligase [Bartonella sp. 1-1C]
          Length = 725

 Score =  633 bits (1633), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 332/720 (46%), Positives = 470/720 (65%), Gaps = 22/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL RR + I   FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +KIG  ++    K  H+ P LSL+  +N ED+ +FI RI RF +  +   I  
Sbjct: 66  DSPS---SKIGAPISEKFEKSIHAQPMLSLDNAFNFEDVSEFIERIRRFLRLPETQIIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G  GE+V+   R I  IP++L  N P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVRAITRGNGSIGENVTTNARTIADIPQILQANFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNINQQKEGKLVFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q  M++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIGMMKKLKEYGFIINPLTKVFEKVEDLISYYHSIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  ARSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVARSPRWAIAHKFPAEKAIAFLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 VTNASLHNEDYIKGIGHKGEPIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPKDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+     G+ V   RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPHVCPVCGSHAVRE----EGETV--RRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    IR P DIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDKMLCIRSPVDIFTLQRRQENSLKRLENMEGFGVVSVRKLYNAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F     + I         N+ W+ L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVKAQRLARAYQNYTAFETAAMSAIMPPDKNNEGNEIWVELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS---SEIENKKLVFTGTL 658
             +G  + +AI++FYQ   N   + ALLKEV+P    HE  V+   S I  K + FTGTL
Sbjct: 597 EGIGFRVGKAIIDFYQEVHNRDILSALLKEVTP---LHEAPVTIDYSPIVGKIITFTGTL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + + R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+
Sbjct: 654 EHMSRDEAKSLAERLGAKTSNSISKKTDLLVAGFGAGSKLTKAQQLGIEVLDEKNWLKLI 713


>gi|319899147|ref|YP_004159240.1| DNA ligase [Bartonella clarridgeiae 73]
 gi|319403111|emb|CBI76669.1| DNA ligase [Bartonella clarridgeiae 73]
          Length = 718

 Score =  629 bits (1621), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 328/720 (45%), Positives = 466/720 (64%), Gaps = 22/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  YY+  +P I D+EYDAL+RR  AI + FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYYRDDQPEISDAEYDALRRRNGAIENLFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P     KIG  ++    K  H+ P LSL+  +N +D+ +F+ RI RF +  +   I  
Sbjct: 66  DSPT---FKIGAPISEKFEKSVHAQPMLSLDNAFNFKDVSEFVERIRRFLRFPETQIIKM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G+ GE+V+   R I  IP+VL    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYETGKLVRAVTRGNGYIGENVTTNARTIADIPQVLQGKFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNISQQKEGKLAFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEMS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+  + Q EM+++++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPVESQMEMMERLKEYGFIINPLTKVFEKLEDLISYYHFIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A   L  IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLVLQTRLGFVSRSPRWAIAHKFPAEKAIALLESIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+    + +R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 VTNASLHNEDYIKGIGYKNEPIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPRDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+      K  A  RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FVFPHLCPVCGSHAVRE------KGEAVRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    I  PADIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDETLCIHSPADIFTLQRRQENSLKRLENMEGFGVVSVRKLYNAINARRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           +SL RF+F+LGIRHVG   A+ LA+ Y +Y  F     + I      +  N+ W+ L  +
Sbjct: 537 VSLSRFLFALGIRHVGEVNAQRLARAYQNYTAFETAAMSAIMPSDKFSKGNEIWVELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS---SEIENKKLVFTGTL 658
             +G  + +AI++FYQ   N   + ALLKEV+P    HE  V    S +  K +VFTGTL
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRDVLLALLKEVTPF---HEVPVEIDYSPLAGKIIVFTGTL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + + R +A+    +LGA  S  +S+K D ++ G   GSKL KAQQLGV++++E+ +L L+
Sbjct: 654 EHMSRDEAKALAERLGAKTSNSISKKVDFLVSGFGAGSKLAKAQQLGVEVLDEKSWLKLI 713


>gi|118590881|ref|ZP_01548281.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
 gi|118436403|gb|EAV43044.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
          Length = 750

 Score =  627 bits (1618), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 319/714 (44%), Positives = 467/714 (65%), Gaps = 13/714 (1%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+AL+ E+A+ EL  L  EI+ HD  Y+Q   P+I D++YDAL+RR  +I   FP+L   
Sbjct: 44  IDALTQEEAQVELKRLAAEIAEHDRRYHQEDAPVISDADYDALRRRNASIEARFPNLILD 103

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--NSI 126
              +GP  ++G        K+TH +P LSL+  +N +D+R F+ R+ RF  K D    ++
Sbjct: 104 ---DGPSAQVGAAPASGFGKITHRVPMLSLDNAFNDDDVRDFVGRVRRFL-KYDPLMGAL 159

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T EPKIDG  +++RYE G  VYAA RGDG +GE+V+   + I  IP  LS  +P+++E
Sbjct: 160 AVTAEPKIDGLSLSLRYENGTLVYAATRGDGTTGENVTENAKTIKDIPEKLSGTVPDVVE 219

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG 244
           VRGEVY++  DF ALN+ M A G K +ANPRNAA+G LR+L  ++IT  R L FF +  G
Sbjct: 220 VRGEVYMAHKDFQALNERMAANGGKVFANPRNAAAGSLRQLK-SEITASRPLRFFAYAWG 278

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S +    Q+ M++++   GF +N  +R+  T   ++  Y+ ++  R+ L YDIDG+VY
Sbjct: 279 EMSALPEDTQFGMVKQLEAWGFQINPLMRRCETVEELLGVYHGIEESRAQLDYDIDGVVY 338

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ++LG  +RSPRW I+HKF  +QA T L DI+IQ+GRTG LTPVA+LEP+ +G
Sbjct: 339 KVDRLDLQERLGFVSRSPRWAIAHKFPAEQAYTVLNDIEIQVGRTGALTPVAKLEPITVG 398

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYIKG+   G+ +RGG+D+R+GD V ++RAG+VIP++VDI +++R   
Sbjct: 399 GVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRIGDTVKIQRAGDVIPQIVDIDLDKRPEG 458

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+ F FP+ CP C S  VR+   KTG+  A  RCTGGL C AQ  E+LKHFVSR+AF+IE
Sbjct: 459 AEAFEFPTICPACGSHAVREEKEKTGRRDAVRRCTGGLICPAQATEKLKHFVSRNAFDIE 518

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           G G +Q+D F+K       +  PADIFTL+ R + S TK+ N  G+G VS  NL+++IN 
Sbjct: 519 GFGDKQVDAFYKEG----LVMAPADIFTLEERDKRSLTKLRNREGWGAVSAKNLFEAINA 574

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR I L RFIF+LGIRHVG   A+ LA+ Y S+  F   +       ++ W  L  +  +
Sbjct: 575 RREIDLHRFIFALGIRHVGEGNAKLLARAYGSWAAFYAAMKAAHDTESEAWAELNDIDGI 634

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G I+A+A+ EF+    N+  ++ALL EVSP          S +  K +VFTG+L+++ R 
Sbjct: 635 GHIVAEALAEFFAEQHNLDQLDALLVEVSPKDAEKINASGSPVAGKTVVFTGSLERMTRD 694

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+    + GA  +  +S+KTD+++ G   GSKL+KAQ+L +++++E+ +  L+
Sbjct: 695 EAKAMAERFGAKTAGSVSKKTDLVVAGPGAGSKLKKAQELEIEVISEDDWFDLV 748


>gi|254502790|ref|ZP_05114941.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
 gi|222438861|gb|EEE45540.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
          Length = 725

 Score =  627 bits (1618), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 318/716 (44%), Positives = 470/716 (65%), Gaps = 13/716 (1%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +  L+ E A+ EL  L  EI+ HD  Y+Q   P I D++YDAL+RR  AI   FPDL 
Sbjct: 16  IAVLDLTPEAAKAELERLASEIAEHDRRYHQEDAPTISDADYDALRRRNSAIEARFPDLI 75

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--N 124
            +   +GP  ++G        K+TH +P LSL+  ++ +D+R F+ R+ RF  K D    
Sbjct: 76  LA---DGPSAQVGAAPASGFGKITHRVPMLSLDNAFSDDDVRDFVGRVRRFL-KFDPLMG 131

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
           ++  T EPKIDG  +++RYE GK VYAA RGDG +GE+V+A  + I  IP  L+ ++ ++
Sbjct: 132 ALAVTAEPKIDGLSLSLRYEDGKLVYAATRGDGTTGENVTANAKTITDIPHTLAGSVLDV 191

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHG 242
           +EVRGEVY++  DF ALN  M+A G K +ANPRNAA+G LR+L  ++IT  R L FF + 
Sbjct: 192 VEVRGEVYMAHKDFEALNARMVANGGKVFANPRNAAAGSLRQLK-SEITASRPLRFFAYA 250

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+ S +    Q  M+ ++   GF +N  +++  T   +++ Y+ ++  R+ L YDIDG+
Sbjct: 251 WGEMSTLPKDTQDGMVAQLAAWGFQINPLMKRCETVEELLAVYHGIEENRAQLDYDIDGV 310

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD   LQ++LG  +RSPRW I+HKF  +QA T L DI+IQ+GRTG LTPVA+LEP+ 
Sbjct: 311 VYKVDRLDLQERLGFVSRSPRWAIAHKFPAEQAWTVLNDIEIQVGRTGALTPVAKLEPIT 370

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG +++NATLHNEDYIKG+   G+ +RGG+D+R GD V ++RAG+VIP++VD+ +++R 
Sbjct: 371 VGGVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRKGDAVKIQRAGDVIPQIVDVDLDKRL 430

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
             A+P+ FP+ CP C S  VR+ N KTG+  A  RCTGGL C AQ  E+LKHFVSR+AF+
Sbjct: 431 DGAEPYEFPTRCPRCNSHAVREENEKTGRKDAVRRCTGGLICPAQATEKLKHFVSRNAFD 490

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           IEG G +Q+D F++ +     +   ADIFTL  R + S TK+ N  G+G VS  NL+++I
Sbjct: 491 IEGFGDKQVDAFYQDD----LVMTAADIFTLAERDKQSLTKLRNREGWGAVSAKNLFEAI 546

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           + RR I L RFIF+LGIRHVG   A+ LA+ Y S+ NF + +     H ++ W  L  + 
Sbjct: 547 DARREIDLHRFIFALGIRHVGEGNAKLLARAYGSWANFYKAMTEASDHGSEAWAELNDID 606

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G I+A A+VEF+    N   ++ALL+EV+P+         S +  K +VFTG+L+++ 
Sbjct: 607 GIGHIVADALVEFFAENHNREQLDALLQEVTPTDAEKIDASGSPVAGKTVVFTGSLERMT 666

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+    + GA VS  +S+KTD+++ G   GSKL+KA +L +++++E+ +  L+
Sbjct: 667 RDEAKAMAERFGAKVSGSVSKKTDLVVAGPGAGSKLKKASELEIEVISEDDWFDLV 722


>gi|328542977|ref|YP_004303086.1| DNA ligase, NAD(+)-dependent [polymorphum gilvum SL003B-26A1]
 gi|326412723|gb|ADZ69786.1| DNA ligase, NAD(+)-dependent [Polymorphum gilvum SL003B-26A1]
          Length = 721

 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 330/721 (45%), Positives = 474/721 (65%), Gaps = 8/721 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           +K     +E+LS ++A  EL+ L  EI+ HD  Y+    P + D+EYDAL+RR  AI   
Sbjct: 3   EKSAAAAVESLSRQEAEAELARLAAEIAAHDQRYFAEDAPTVSDAEYDALRRRNAAIEER 62

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FPDL R + P+    +IG   +    KVTH+IP LSL+  ++ +D+R F+ R+ RF +  
Sbjct: 63  FPDLVREDSPSA---RIGAAPSEGFGKVTHAIPMLSLDNAFSDDDVRDFVARVRRFLRLD 119

Query: 122 D-DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
               ++  T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I  IP  L   
Sbjct: 120 PLMGALGVTAEPKIDGLSLSLRYEGGRLVSAATRGDGTVGENVTANARTIADIPHRLPAG 179

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNF 238
           +PE++EVRGEVY++  DF ALN  M A G K +ANPRNAA+G LR+LNP DIT  R L F
Sbjct: 180 VPEVVEVRGEVYMAHADFAALNARMAANGGKVFANPRNAAAGSLRQLNP-DITAARPLKF 238

Query: 239 FVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
           F +  G+ SE+    Q EM+  +   GFPVN  +    +   ++  Y+ ++  R+TL YD
Sbjct: 239 FAYAWGEMSEVPRATQMEMVSLIGAWGFPVNPRMVLCRSVEELIDVYHAIEEERATLGYD 298

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD   LQ +LG  +RSPRW I+HKF  ++A T L DI+IQ+GRTG LTPVA+L
Sbjct: 299 IDGVVYKVDRLDLQARLGFVSRSPRWAIAHKFPAEKAFTILRDIEIQVGRTGALTPVAKL 358

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GG +++NATLHNEDYI+G+   G+ +RGG+D+R+GD V ++RAG+VIP+V+D+ +
Sbjct: 359 EPVTVGGVVVSNATLHNEDYIRGIGQDGEPIRGGKDLRIGDTVQIQRAGDVIPQVIDVDL 418

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
            +R  DA PF+FP+ CP+C S  VR++N KTG+  A  RCTGGL C+AQ  E+LKHFVSR
Sbjct: 419 AKRPADAVPFAFPTVCPVCGSHAVREINAKTGRPDAVRRCTGGLVCAAQAKEKLKHFVSR 478

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTT-KIENILGFGDVSVTN 537
           +AF+IEGLG +Q++FF+        IR PADIFTL+ R   S   K++N  G+G+ S  N
Sbjct: 479 NAFDIEGLGDKQVEFFYDLPPEEGGIRTPADIFTLEARDAASPIRKLKNRDGWGETSARN 538

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           L+ +I+ RR + L RFIF+LGIRHVG   A+ LA+ Y S+  FA  +     H +D W  
Sbjct: 539 LFAAIDARRRVDLNRFIFALGIRHVGEGNAKLLARAYGSWDAFAAAMRAAADHGSDAWAE 598

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGT 657
           L  +  VG+++A+A+V+F+  P N  A++ALL EV+P          S +  K +VFTG 
Sbjct: 599 LNAIDGVGEVVAEAVVQFFAEPHNREALDALLAEVTPLDAEKVAAEGSPVAGKTVVFTGA 658

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           L+++ R +A+    +LGA V+  +S+KT +++ G   GSKL+ AQ+L ++++ E+ +  L
Sbjct: 659 LERMTRDEAKAMAERLGAKVAGSVSKKTSLVVAGPGAGSKLKTAQELDIEVITEDDWFDL 718

Query: 718 L 718
           +
Sbjct: 719 V 719


>gi|304392246|ref|ZP_07374188.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
 gi|303296475|gb|EFL90833.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
          Length = 716

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 311/717 (43%), Positives = 458/717 (63%), Gaps = 12/717 (1%)

Query: 4   RQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFP 63
           R+++P   L+ EQA +EL++L  EI+ HD  Y+    P I D  YD L++R  AI   FP
Sbjct: 7   REIVP-RKLTDEQAAEELAALASEIAEHDARYHNDDAPTISDGAYDTLRKRNTAIEERFP 65

Query: 64  DLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD 123
           DL R + P+   N +G  +     K+TH +P LSL+  ++  D+  F   + RF   K+ 
Sbjct: 66  DLVREDSPS---NNVGSPVQSKFDKITHKVPMLSLDNAFDDGDVADFSASVRRFLNWKEG 122

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIP 182
           + + FT EPKIDG  + +RYE+G+ V AA RGDG  GE+V+A  R +  IPR LS  N+P
Sbjct: 123 DPLTFTAEPKIDGLSLALRYERGELVSAATRGDGQVGENVTANARTVKDIPRKLSGGNVP 182

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVH 241
           +I+E+RGEVYI K DF ALN EM A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 183 DIVEIRGEVYIGKADFAALNVEMEAAGKQLYVNPRNTAAGSLRQLDSRITASRPLKFFAY 242

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ S++ A  Q+ M+++M   GF  N    +  +   +V++Y  ++  R+ L YDIDG
Sbjct: 243 AWGEMSKLPADTQFAMIEQMAAWGFSTNPLTARLESVEALVAHYRTIEESRAGLDYDIDG 302

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD+  LQ +LG  +R PRW I+HKF  + A+T L +I+IQIGRTG L+PVARL+PV
Sbjct: 303 VVYKVDDLGLQGRLGFASRVPRWAIAHKFPAELATTILREIEIQIGRTGALSPVARLDPV 362

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG +++NATLHNEDYI G+ ++G+ +R GRD+R+GD V + RAG+VIPKV+D+ +++R
Sbjct: 363 TVGGVVVSNATLHNEDYIAGVGSNGEPIREGRDLRIGDTVTIFRAGDVIPKVMDVDLSKR 422

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
               +PF FP+ CP C S  VR ++ KTG+  +  RCTGG  C AQ +E +KHFVSR+AF
Sbjct: 423 TA-KEPFEFPTVCPACGSPAVRPIDEKTGRADSVRRCTGGFICPAQAVEGIKHFVSRNAF 481

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +I+G G +Q + F +       +  PADIFTL+ R + S  ++EN  G+G  S   L+D+
Sbjct: 482 DIDGFGDKQAELFHE----LGMVMNPADIFTLRERDKRSLKRLENRDGYGKTSANKLFDA 537

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I+ RR I L RFIF+LGIRHVG   A+ LA++Y         I+       + W+ ++ +
Sbjct: 538 IDDRRKIDLHRFIFALGIRHVGEGNAKLLARHYRDADTLLAAIDAAQDREGEAWVEMLDI 597

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
              G+  A A+++F  +P     V+ALL EV+P+      + SS I  K +VFTGTL++ 
Sbjct: 598 DGFGETAATALLDFMADPNRRGVVDALLTEVTPNPVEQVAS-SSPIAGKTIVFTGTLEQT 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A+    +LGA VS  +S KTD+++ G+  GSKL+KA +LGV  ++E+ +L L+
Sbjct: 657 TRSEAKAVAERLGAKVSGSVSAKTDLLVAGEKAGSKLKKAAELGVDTLDEQGWLDLV 713


>gi|323136604|ref|ZP_08071685.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
 gi|322397921|gb|EFY00442.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
          Length = 705

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/714 (42%), Positives = 463/714 (64%), Gaps = 29/714 (4%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           + ++ LS  +AR E + L ++I+ +D+ YY+   P++ D+EYDA +RR +A+  AFP+L 
Sbjct: 10  LSVDELSPAEARAEHARLGEDIARYDEAYYREDAPLVPDAEYDAARRRYEALEKAFPELV 69

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
               P     K+G + +    KV H++P LSL  +++ E++  F+ R+ RF    +   +
Sbjct: 70  ---TPESLTRKVGAKPSEKFAKVKHAVPMLSLGNVFSDEEVFDFVARVRRFLGLGERARL 126

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG   ++RYE G+   AA RGDG+ GEDV+A IR +  IP  L  + P+++E
Sbjct: 127 AFTAEPKIDGLSCSLRYEGGRLAQAATRGDGYEGEDVTANIRTLREIPHKLHGDAPDVLE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++  DF ALN+   A G+ P+ANPRNAA+G LR+L+P     R L+FF +G G+
Sbjct: 187 VRGEVYMTHADFAALNERQTAAGKPPFANPRNAAAGSLRQLDPKITAGRPLHFFAYGWGE 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+  + Q+ +L+    LG  VN   R  +    ++++Y  +++ R+TL YDIDG+VYK
Sbjct: 247 ASELPGETQWSVLEAFGRLGLKVNPLTRLCDGAEEMLAHYRAIEARRATLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+ SLQ++LG  +R+PRW  +HKF  ++A+T L DI+IQ+GRTG LTPVARLEPV +GG
Sbjct: 307 VDDISLQERLGFVSRAPRWAAAHKFPAERATTILRDIEIQVGRTGALTPVARLEPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNED I             +DIRVGD V+V+RAG+VIP++V+++  +R   A
Sbjct: 367 VVVSNATLHNEDEI-----------ARKDIRVGDTVVVQRAGDVIPQIVEVVTEKRPHGA 415

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +P+ FP  CP C S  +R+++ KTG+     RCTG L C AQ +ERLKHF SR+AF+IEG
Sbjct: 416 KPYHFPHVCPRCGSAALREIDEKTGEADVVRRCTGSLVCPAQAVERLKHFASRNAFDIEG 475

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q+++F+   D    I+  +DIFTL+ R + S TKI+N  GFG+ SV NL+ +I  R
Sbjct: 476 LGDRQIEYFY---DEGL-IKTASDIFTLEERDRASLTKIKNREGFGETSVRNLFAAIEAR 531

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I + RF+++LGIRHVG   AR LA+++  +++  +E         +    +  +  VG
Sbjct: 532 RTIPINRFLYALGIRHVGETNARRLARHFGDFESL-RETAREADPGTEARARIDSIDGVG 590

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVS----PSIGRHEKNVSSEIENKKLVFTGTLQKI 661
            ++A+A+ +F+  P N   ++ALL +V+    P I       SS +  K +VFTG L+++
Sbjct: 591 PVVAEALHDFFAEPHNEKELDALLSQVTLEPMPEIAS-----SSPVAGKTVVFTGALERL 645

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            R +A+    + GA V+A +S+KTD+++ G   GSKL KAQ+LG+++++E+++ 
Sbjct: 646 TRDEAKAQAERFGAKVAASVSKKTDLVVAGPGAGSKLAKAQELGIEVISEDEWF 699


>gi|240142614|ref|YP_002967127.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
 gi|240012561|gb|ACS43786.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
          Length = 712

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/715 (43%), Positives = 448/715 (62%), Gaps = 18/715 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           +P+  LS E AR E ++L  EI+ HD+ Y+    PI+ D+EYDAL+RR   I  A P LA
Sbjct: 10  VPVAELSNEDARIEHAALASEIAEHDERYHGQDAPIVTDAEYDALRRRAAEIEAAHPALA 69

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
              +      K+G + +    K+ H+IP LSLE  +  ED+ +F  RI RF        +
Sbjct: 70  AESEV---AKKVGAKPSSRFGKIVHAIPMLSLENAFVDEDVAEFAVRIRRFLDLPGGAPL 126

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  ++IRYE  + V+AA RGDG +GE+V+A    I  IP  L  + P+++E
Sbjct: 127 AFTAEPKIDGLSLSIRYENRRLVHAATRGDGAAGENVTANALTIQDIPDDLPRDAPDVVE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY+SK+ F A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+
Sbjct: 187 IRGEVYLSKSAFAAINARQEAAGKPLFANPRNAAAGSLRQLDPKITASRPLKFFAYSWGE 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           TS   A+ Q+  L +    GF VN   +  +T   ++  Y  + ++R+ L YDIDG+VYK
Sbjct: 247 TSAPIAEAQHAALARFDDWGFYVNPLTKLCSTVEEMLEVYRAIGAMRADLEYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+ +LQ++LG  +R+PRW ++HKF  +QA T L  I+IQ+GRTG LTPVA+L P+ +GG
Sbjct: 307 VDDLALQRRLGFVSRAPRWAVAHKFPAQQAETVLEAIEIQVGRTGSLTPVAKLRPLTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKGLD+ G+ +R GRD+RVGD V+V+RAG+VIP++VD+  ++R    
Sbjct: 367 VVVSNATLHNEDYIKGLDSDGQPIREGRDLRVGDHVIVQRAGDVIPQIVDVDPSKRSEGT 426

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP+C S  VR+ NPK+G+  +  RCTGGL C AQ +ER+KHF SR A +IEG
Sbjct: 427 APYEFPKLCPVCGSHAVREANPKSGREDSVRRCTGGLICQAQAVERIKHFASRGAMDIEG 486

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG ++++ F + +     +R P+DIFTL+RRQ      +    G G  SV NL+ +I+ R
Sbjct: 487 LGDERIEDFHRDD----LLRTPSDIFTLRRRQDAGEIDLTAREGMGPTSVANLFAAIDAR 542

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF--AQEINNIIAHNNDDWLSLIRVPL 603
           R + LER I  LGIRHVG   A+ LAK Y S      A ++ + +    D    LI    
Sbjct: 543 RKVPLERLIHGLGIRHVGETNAKLLAKAYRSLPAVREAAQVPDALKRMVD----LING-- 596

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G ++A A+VEF+  P N   V+ LL EV  +     K   S +  K +VFTG+L ++ R
Sbjct: 597 IGPVVAAAVVEFFLEPHNSEEVDRLLAEVGTTAPAAAKE--SPVTGKTIVFTGSLVRMSR 654

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +A+     LGA  +  +S+KTD+++ G   GSKL KA+Q GV++++E  +  L+
Sbjct: 655 DEAEAMAEGLGARTAGTVSKKTDLVVAGPGAGSKLAKAEQFGVRVIDENGWFDLV 709


>gi|166216283|sp|Q07PR9|DNLJ_RHOP5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 313/727 (43%), Positives = 460/727 (63%), Gaps = 26/727 (3%)

Query: 3   KRQLIP-IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + +P +  L+  +A+ EL  L  EI  HD  YYQ   P + D++YDAL+RR + I H 
Sbjct: 4   KSKTVPDVATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHK 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L     P+    K+G        KV H++P LSL   ++ +++ +F+ R+ RF    
Sbjct: 64  FPELVSGASPS---QKVGAAPARGFAKVQHAVPMLSLGNAFSDDEVAEFLQRVRRFLNLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN- 180
           D+       EPKIDG  +++RYE+G+ V AA RGDG  GEDV+A +R +  IP  L  N 
Sbjct: 121 DEIPAIVA-EPKIDGLSLSLRYEQGELVRAATRGDGSVGEDVTANVRTLKDIPHTLKGNR 179

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFF 239
           IP   E+RGEVY+ K+DFLALN +    G  P+ANPRN+A+G LR+ +     +R L FF
Sbjct: 180 IPAACELRGEVYMLKSDFLALNKKQEEAGEAPFANPRNSAAGSLRQKDVAITASRPLKFF 239

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S E   + Q++ML  +   GF VN  +   ++    + +Y  +   R+ LPYD
Sbjct: 240 AYAWGEFSGETPERTQHDMLGWLDHAGFVVNPEITLCHSVDDALVFYRRIGEERAALPYD 299

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q +LG   R+PRW I+HKFA +QA+T L  I+IQ+GRTG LTPVARL
Sbjct: 300 IDGVVYKVDRLDWQARLGFAGRAPRWAIAHKFAAEQATTILEKIEIQVGRTGALTPVARL 359

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG ++ NATLHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP+VVD+++
Sbjct: 360 APVTVGGVVVQNATLHNEDYIKGVGNDGQPLREGRDIRVGDTVIIQRAGDVIPQVVDVVL 419

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R  DA P+ FP  CP+C S  VR+     G++V   RCTG L C AQ +ERLKHFVSR
Sbjct: 420 DKRPADAVPYEFPQACPVCGSHAVRE----DGEVV--RRCTGALICPAQAVERLKHFVSR 473

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q++ F +       ++ P DIFTL+ R   +T K+E + G+G+ SV NL
Sbjct: 474 LAFDIDGLGEKQIELFHERG----WVKEPVDIFTLKTR--NATLKLEELEGYGETSVRNL 527

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD---- 594
           + +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +    A   ++    
Sbjct: 528 FAAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTIDAFLGAMRAAAAGQTEEGNTS 587

Query: 595 --WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
             +  L  +  +GDI+A+A+VEF+   RN+ A++ALL E+   +   +    S +  K +
Sbjct: 588 EAYQDLDNIGGIGDIVAEAVVEFFAEERNVEALDALLGELDEVLPAAQVKRDSAVAGKTV 647

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA++LGV +++E+
Sbjct: 648 VFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDFVVAGEDAGSKLTKARELGVSVLSED 707

Query: 713 QFLFLLQ 719
           ++L L+Q
Sbjct: 708 EWLALIQ 714


>gi|115524134|ref|YP_781045.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
 gi|115518081|gb|ABJ06065.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
          Length = 730

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 313/727 (43%), Positives = 460/727 (63%), Gaps = 26/727 (3%)

Query: 3   KRQLIP-IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + +P +  L+  +A+ EL  L  EI  HD  YYQ   P + D++YDAL+RR + I H 
Sbjct: 19  KSKTVPDVATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHK 78

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L     P+    K+G        KV H++P LSL   ++ +++ +F+ R+ RF    
Sbjct: 79  FPELVSGASPS---QKVGAAPARGFAKVQHAVPMLSLGNAFSDDEVAEFLQRVRRFLNLG 135

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN- 180
           D+       EPKIDG  +++RYE+G+ V AA RGDG  GEDV+A +R +  IP  L  N 
Sbjct: 136 DEIPAIVA-EPKIDGLSLSLRYEQGELVRAATRGDGSVGEDVTANVRTLKDIPHTLKGNR 194

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFF 239
           IP   E+RGEVY+ K+DFLALN +    G  P+ANPRN+A+G LR+ +     +R L FF
Sbjct: 195 IPAACELRGEVYMLKSDFLALNKKQEEAGEAPFANPRNSAAGSLRQKDVAITASRPLKFF 254

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S E   + Q++ML  +   GF VN  +   ++    + +Y  +   R+ LPYD
Sbjct: 255 AYAWGEFSGETPERTQHDMLGWLDHAGFVVNPEITLCHSVDDALVFYRRIGEERAALPYD 314

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q +LG   R+PRW I+HKFA +QA+T L  I+IQ+GRTG LTPVARL
Sbjct: 315 IDGVVYKVDRLDWQARLGFAGRAPRWAIAHKFAAEQATTILEKIEIQVGRTGALTPVARL 374

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG ++ NATLHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP+VVD+++
Sbjct: 375 APVTVGGVVVQNATLHNEDYIKGVGNDGQPLREGRDIRVGDTVIIQRAGDVIPQVVDVVL 434

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R  DA P+ FP  CP+C S  VR+     G++V   RCTG L C AQ +ERLKHFVSR
Sbjct: 435 DKRPADAVPYEFPQACPVCGSHAVRE----DGEVV--RRCTGALICPAQAVERLKHFVSR 488

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q++ F +       ++ P DIFTL+ R   +T K+E + G+G+ SV NL
Sbjct: 489 LAFDIDGLGEKQIELFHERG----WVKEPVDIFTLKTR--NATLKLEELEGYGETSVRNL 542

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD---- 594
           + +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +    A   ++    
Sbjct: 543 FAAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTIDAFLGAMRAAAAGQTEEGNTS 602

Query: 595 --WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
             +  L  +  +GDI+A+A+VEF+   RN+ A++ALL E+   +   +    S +  K +
Sbjct: 603 EAYQDLDNIGGIGDIVAEAVVEFFAEERNVEALDALLGELDEVLPAAQVKRDSAVAGKTV 662

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA++LGV +++E+
Sbjct: 663 VFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDFVVAGEDAGSKLTKARELGVSVLSED 722

Query: 713 QFLFLLQ 719
           ++L L+Q
Sbjct: 723 EWLALIQ 729


>gi|158421773|ref|YP_001523065.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
 gi|190359227|sp|A8IGY0|DNLJ_AZOC5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158328662|dbj|BAF86147.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
          Length = 739

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 319/731 (43%), Positives = 468/731 (64%), Gaps = 34/731 (4%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS  +A  E ++L QEI+ HD  YYQ   P+I D++YD L+RR + I   FP L   +  
Sbjct: 18  LSATEASDEHAALSQEIASHDARYYQEDAPVISDADYDRLRRRYEDIEARFPALKNDDSL 77

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    K+G   +    KV H +P LSL+  ++ E++ +F+ R+ RF    +   + FT E
Sbjct: 78  S---RKVGAAPSAKFAKVVHQVPMLSLQNAFSDEEVEEFVARVRRFLNLAESAELAFTAE 134

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGE 190
           PKIDG   ++RYE G  V AA RGDG  GEDV+A +R I  IP R+    +P+II++RGE
Sbjct: 135 PKIDGLSCSLRYEGGVLVRAATRGDGTQGEDVTANVRTIAEIPHRLTGAGVPDIIDIRGE 194

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSE 248
           VY+ K DFLALN      G+  +ANPRNAA+G LR+L+P +ITR   L FF +  G+ +E
Sbjct: 195 VYMGKADFLALNARQEEAGKPVFANPRNAAAGSLRQLDP-EITRSRPLRFFAYAWGQ-AE 252

Query: 249 IFAKG--QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
               G  Q+E++   R  G P N    +     G++++Y ++ + R++L YDIDG+VYKV
Sbjct: 253 PGPPGASQHEVVDAFRRFGLPTNPLTIRVTDAAGLLAHYRKIGAERASLGYDIDGVVYKV 312

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D  +LQ++LG  +RSPRW I+HKFA +QA+T +  I+IQ+GRTG LTPVA+L PV +GG 
Sbjct: 313 DSLALQERLGFVSRSPRWAIAHKFAAEQATTVIEAIEIQVGRTGALTPVAKLTPVTVGGV 372

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYI+ +  +G+ +R G DIRVGD V+V+RAG+VIP+VV +++++R   A 
Sbjct: 373 VVSNATLHNEDYIRAIGGNGEEIREGIDIRVGDTVVVQRAGDVIPQVVSVVLDKRPAGAT 432

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP+C S+ VR+++PKTGK  A  RCTGGL C AQ +ERL+HFVSR+AF+IEGL
Sbjct: 433 AYQFPHHCPVCNSQAVREVDPKTGKQDAVRRCTGGLICPAQAVERLRHFVSRNAFDIEGL 492

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G++Q   F++ +     I  PADIF LQ R + S +K+EN  G+G  S  NL+ +I  RR
Sbjct: 493 GEKQAHAFYEWK----LIAEPADIFRLQARNEQSLSKLENREGWGRTSAQNLFAAIEARR 548

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-----AQEINNII------------- 588
            I+L+RFIF+LGIRHVG   A+ LA++Y S +         E+   +             
Sbjct: 549 TIALDRFIFALGIRHVGETNAKRLARHYGSVEALRDAAIGAEMPTEMEEASEETPPTRRR 608

Query: 589 -AHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI 647
               N+ W  +  +  +G ++A+A+VEF++ P N   VE LLKEV+P       + +S +
Sbjct: 609 KPQGNEVWQEMTDIDGIGAVVAEAVVEFFREPHNRQVVEELLKEVTPQPLEAVAS-TSPV 667

Query: 648 ENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVK 707
             K +VFTG+L+++ R +A+    +LGA V+  +S KTD+++ G   GSKLEKA+ LGVK
Sbjct: 668 SGKTVVFTGSLERMTRDEAKAMAERLGAKVAGSVSGKTDLLVAGPGAGSKLEKARSLGVK 727

Query: 708 IMNEEQFLFLL 718
            + E+++  L+
Sbjct: 728 TITEDEWFDLV 738


>gi|92116846|ref|YP_576575.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
 gi|123083742|sp|Q1QNT2|DNLJ_NITHX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91799740|gb|ABE62115.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
          Length = 714

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 314/720 (43%), Positives = 459/720 (63%), Gaps = 24/720 (3%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++L+  QA+ E   L  EI  H++ YYQ   P + D+ YDAL++R +AI   FPDL  
Sbjct: 10  PVDSLTRAQAKIEHKRLALEIETHNERYYQKDAPTVSDAAYDALRQRLEAIEARFPDLIT 69

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +   N P   +G        KV H++P LSL   ++ E++ +F+ RI RF +   D+   
Sbjct: 70  A---NSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDEEVAEFVERIQRFLKLGPDDIPA 126

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIE 186
              EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   NIP   E
Sbjct: 127 IVAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPHNLRGRNIPTACE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGK 245
           +RGEVY+ K DFLALN +    G   +ANPRN+A+G LR+ +     +R L FF +  G+
Sbjct: 187 LRGEVYMLKTDFLALNKKQEDAGDTVFANPRNSAAGSLRQKDVAITASRPLKFFAYAWGE 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            ++  A  Q++ML+ ++ +GF VN  +   N+   ++ +Y ++   R++L YDIDG+VYK
Sbjct: 247 MTDRPADTQHDMLEWLKDVGFKVNPLIELCNSVEKVLKFYRKIGEQRASLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVARLEPV IGG
Sbjct: 307 VDRLDWQERLGFVSRSPRWAIAHKFAAEQATTILKGIDIQVGRTGAMTPVARLEPVTIGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ NATLHNEDYIKG+   G+ +R G D+RVGD V+V+RAG+VIP+VV +++++R   A
Sbjct: 367 VVVQNATLHNEDYIKGIGNDGQPIRDGVDLRVGDTVVVQRAGDVIPQVVSVVIDKRPNSA 426

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           QP++FP  CPIC S  VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+G
Sbjct: 427 QPYAFPHTCPICGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRLAFDIDG 480

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q+  F +       I+ PADIFTL  R++    K+E + GFG+VSV NL+ +I+ R
Sbjct: 481 LGEKQIQEFHERG----WIKEPADIFTL--RERNPKIKLEELEGFGEVSVRNLFAAIDAR 534

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD------WLSLI 599
           R I L R IF+LGIRHVG   A+ LA++Y     F   ++   A   DD      +  L 
Sbjct: 535 RTIELNRLIFALGIRHVGEGNAKLLARHYGGIDAFRAAMSEAAAAQTDDGNASEAYADLN 594

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  +GDI+A A+VEF+   RN+ A+  LL+E+        +N  S +  K +VFTG+L+
Sbjct: 595 NISGIGDIVADAVVEFFAETRNVKALNDLLEEIEVLPVAQARN-DSAVAGKTVVFTGSLE 653

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K  R +A+    ++GA VS  +S+KTD+++ G   GSKL+ A++ GV++++E+++L L++
Sbjct: 654 KFTRDEAKASAERMGAKVSGSVSKKTDLVVAGPGAGSKLKDAEKHGVQVISEDEWLKLIE 713


>gi|182677699|ref|YP_001831845.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|254781257|sp|B2IGH4|DNLJ_BEII9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|182633582|gb|ACB94356.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 699

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 300/714 (42%), Positives = 453/714 (63%), Gaps = 21/714 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PIE+LS  QA++E   L ++I+ HD  YYQ   P + D+EYDAL+RR +A+  AFP+L  
Sbjct: 6   PIESLSPAQAKREHRRLGEQITEHDRLYYQEDAPRVSDAEYDALRRRYEALETAFPELVS 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +E       KIG        K+ H +P LSL  I++ E++ +F+ R+ RF     D  + 
Sbjct: 66  AESLT---KKIGAAPAEKFAKIIHKVPMLSLANIFSDEEVGEFVARVRRFLGLGADAPLA 122

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            + EPKIDG   ++RYE G  V AA RGDG+ GEDV+A +R I  IP  L  + PEI+EV
Sbjct: 123 ISAEPKIDGLSCSLRYEGGYLVQAATRGDGYEGEDVTANVRTIQEIPHQLQGHAPEILEV 182

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEVY++  DF ALN+   A G+  +ANPRN+A+G LR+L+P     R L+FF +  G+ 
Sbjct: 183 RGEVYMTHADFAALNERQEAAGKTIFANPRNSAAGSLRQLDPKVTAGRPLHFFAYAWGEA 242

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q  M+   +  G PVN  ++  ++   ++++Y+++++ R+ L YDIDG+VYKV
Sbjct: 243 SEEPADTQMGMVTAFKAFGLPVNPLMQLCHSAEDLIAHYHDIEARRALLDYDIDGVVYKV 302

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +  +LQK+LG  +R+PRW  +HKF  ++A T L DI+IQ+GRTG LTPVARLEP+ +GG 
Sbjct: 303 NSIALQKRLGFVSRAPRWATAHKFPAEKAVTLLRDIEIQVGRTGALTPVARLEPITVGGV 362

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNED I             +DIR+GD V+++RAG+VIP+++  I+++R  DAQ
Sbjct: 363 VVSNATLHNEDEI-----------ARKDIRIGDMVMIQRAGDVIPQILGPILDKRPQDAQ 411

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP+C S  +R+++PKTG      RCTGGL C+AQ +ERLKHF SR+AF+IEGL
Sbjct: 412 PYEFPQVCPVCGSAAIREIDPKTGTADVVRRCTGGLVCAAQVVERLKHFASRNAFDIEGL 471

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+        I  P DIFTLQ R   S  K+++  G+G+ SV NL+ +I  RR
Sbjct: 472 GDKQIEQFYHDG----LIHTPVDIFTLQERDARSLKKLKDREGYGETSVRNLFQAIEARR 527

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I + RFI++LGIRHVG   AR  A+ + ++    + + +     +++   L  V   G 
Sbjct: 528 HIPVNRFIYALGIRHVGETNARRAARAFGTFDAL-RAVASRAEEGSEERSELTNVEGFGP 586

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AI +F+    N   ++ LL++V+P          S +  K +VFTG L+ + R +A
Sbjct: 587 VVAEAIFDFFHEQHNQDVLDGLLEQVTPEPMEAVAK-ESPVAGKTVVFTGALEHMTREEA 645

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +    +LGA V+  +S+KTD+++ G   GSKL KA +L ++ ++EE +L L+ +
Sbjct: 646 KAQAERLGAKVAGSVSKKTDLVVAGPGAGSKLAKAAELNIETISEEDWLKLVGE 699


>gi|75675255|ref|YP_317676.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
 gi|123773282|sp|Q3STR7|DNLJ_NITWN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|74420125|gb|ABA04324.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
          Length = 716

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 310/726 (42%), Positives = 461/726 (63%), Gaps = 22/726 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +   P+++L+  QAR E   L  EI  H++ YYQ   P + D+ YDAL+RR +AI   
Sbjct: 4   KSKTPPPVDSLTRSQARVEHKRLALEIETHNERYYQQDAPTVSDATYDALQRRLEAIEAR 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FPDL  +   + P   +G        KV H++P LSL   ++  ++ +F+ RI RF +  
Sbjct: 64  FPDLVTA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDAEVAEFVERIRRFLKLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LN 180
            D+      EPKIDG  +++RYE G  V AA RGDG +GEDV+A +R I  +P  L+  N
Sbjct: 121 ADDMPAIVAEPKIDGLSLSLRYENGDLVRAATRGDGFTGEDVTANVRTIADVPHKLNGHN 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           IP   E+RGEVY+ K DFLALN +    G   +ANPRN+A+G LR+ + +   +R L FF
Sbjct: 181 IPTACELRGEVYMLKEDFLALNKKQQEAGDTVFANPRNSAAGSLRQKDVSITASRPLKFF 240

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ ++  A+ Q +ML+ +R +GF VN  ++  ++   ++++Y  +   R+TL YDI
Sbjct: 241 AYAWGEMTDRPAETQNDMLEWLRDVGFIVNPLIQLCHSVDEVLAFYRRIGEQRATLGYDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG +TPVARLE
Sbjct: 301 DGVVYKVDRLDWQERLGFVSRSPRWAIAHKFAAEQAMTILRGIDIQVGRTGAMTPVARLE 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ NATLHNEDYI+GL   G+ +R G D+R+GD V+V+RAG+VIP+VV +I+ 
Sbjct: 361 PVTVGGVVVQNATLHNEDYIRGLGNDGQPIRDGIDLRIGDTVVVQRAGDVIPQVVSVIIE 420

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  +A+ + FP  CPIC S  VR+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 421 KRPANAKRYEFPDRCPICGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRL 474

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+  F+   D    +  P DIFTLQ R   +  K+ +  G+GDVSV NL+
Sbjct: 475 AFDIDGLGEKQIQEFY---DDGLVMH-PVDIFTLQERDARAENKLRDRDGYGDVSVRNLF 530

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI------NNIIAHNND 593
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y S ++F   +           ++++
Sbjct: 531 AAIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGSIESFRSAMTEAAAAQTEAGNDSE 590

Query: 594 DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  +GDI+A A+VEF+  PRN+ A+  LL+E+   +   +    S +  K +V
Sbjct: 591 AYADLTNIGGIGDIVADAVVEFFAEPRNVKALNDLLEEIE-VLPVAQARSDSAVAGKTVV 649

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L+K  R +A+    ++GA  S+ +S+KTD+++ G   GSKL+ A++ GVK+++E++
Sbjct: 650 FTGSLEKFTRDEAKASAERVGAKTSSSVSKKTDLVVAGPGAGSKLKDAEKFGVKVISEDE 709

Query: 714 FLFLLQ 719
           +L L++
Sbjct: 710 WLKLIE 715


>gi|90418183|ref|ZP_01226095.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337855|gb|EAS51506.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
          Length = 703

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 303/712 (42%), Positives = 447/712 (62%), Gaps = 26/712 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E L  ++A  EL  L  EI+ HD  YY+   P + D+EYD L+RR  AI   FP+L R 
Sbjct: 6   VETLDRDEAAAELERLAGEIAAHDRAYYREDAPTVTDAEYDTLRRRNAAIEARFPELIRE 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+    ++G E++    K+ H++P LSL+  ++ ED+  F  R+ RF +  DD  +  
Sbjct: 66  DSPSA---RVGTEVSEKFGKIRHAVPMLSLDNAFSDEDVADFAKRVRRFLKLDDDAPLAI 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYEKG+ V AA RGDG +GEDV+   R I  IP  L    PE+ EVR
Sbjct: 123 TAEPKIDGLSLSLRYEKGELVSAATRGDGATGEDVTRNARTIDDIPNRLKGKAPEVFEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKT 246
           GEVY+S   F  LN      G+  YANPRNAA+G LR+L+   ITR   L FF +  G+ 
Sbjct: 183 GEVYMSHAAFTDLNARQAEEGKPVYANPRNAAAGSLRQLD-AGITRARKLQFFAYAWGEA 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE+  + Q E++  +   GFPVN  +++  T  G++++Y+ ++  R+ L YDIDG+VYKV
Sbjct: 242 SEVPGETQTEVVAAIAGFGFPVNERMKRFETIEGLIAHYHAIEENRAGLGYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQK+LG  +RSPRW I+HKF  +QA+T L  I+IQ+GRTG LTPVA+L+PVN+GG 
Sbjct: 302 DDLALQKRLGFVSRSPRWAIAHKFPAEQATTVLRAIEIQVGRTGALTPVAKLDPVNVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHN + I+ L           D+RVGD V ++RAG+VIP+V+ I+ ++R  DA+
Sbjct: 362 MVANATLHNAEEIERL-----------DVRVGDTVQIQRAGDVIPQVLGIVADKRPEDAE 410

Query: 427 PFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           PF+FPS CP   ++ VVR+    +G      RCTG  AC  Q+ E LK FVSR AF+IEG
Sbjct: 411 PFAFPSVCPCELKTDVVRE-ETASGAQSVVRRCTGEFACPFQRREHLKLFVSRKAFDIEG 469

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q+D F+  +DP F +R PADIF +  R Q    K+++  GFG+VS  NL+ +I  R
Sbjct: 470 LGDKQIDLFY--DDPDFQVRTPADIFRMHGRNQEGLKKLKDKEGFGEVSAKNLFAAIEAR 527

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L+R IFSLGIRHVG   A++LA+ Y +++ F +    + A + +    +  +  +G
Sbjct: 528 RTIPLDRLIFSLGIRHVGETTAKTLARAYGTFEAFHEAALKVAAGDEEASGEMDALDDIG 587

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
             +  A   F+    N+  VE L+ E  V P+    +   +S +  + +VFTG+L+K+ R
Sbjct: 588 GAVITATARFFSEDHNLKLVEDLVAELDVQPA---EQPAATSPVSGQTIVFTGSLEKMTR 644

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            +A+     LGA V+  +S+KTD+++ G   GSKL+KA +LGV++++E+ + 
Sbjct: 645 DEAKAMAEGLGAKVAGSVSKKTDLVVAGPGAGSKLKKAAELGVEVIDEDAWF 696


>gi|83858905|ref|ZP_00952427.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
 gi|83853728|gb|EAP91580.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
          Length = 695

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 303/716 (42%), Positives = 456/716 (63%), Gaps = 30/716 (4%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           L  + AL+ ++A  EL  L +EIS HD  YY+   P I D+ YDAL+ R  AI   FP+L
Sbjct: 5   LKDVNALTSDEAASELERLAREISRHDKAYYEKDAPKISDAAYDALRARNSAIEARFPEL 64

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R + P+   +++G + +    +V H++P LSL   +  +D+R F  RI RF   KD+  
Sbjct: 65  KRKDSPS---DRVGAKPSEQFGEVVHAVPMLSLGNAFEDQDVRDFADRIRRFLNLKDEK- 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           + FT EPKIDG    +RYE+G+ V  A RGDG +GE+V+A ++ I  IP  L  ++P+++
Sbjct: 121 LVFTAEPKIDGLSANLRYEQGELVIGATRGDGRTGENVTANLKTIADIPHRLEGDVPDVL 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           EVRGEVY+S  DF  LN      G+  Y NPRNAA+G LR+++P     R L FF +  G
Sbjct: 181 EVRGEVYMSHADFAQLNAMQEERGKPAYKNPRNAAAGSLRQIDPNVTAERPLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + SE  A+ QY+ ++++  LGF +N+ + +  +   ++++Y  +++ R+ L YDIDG+VY
Sbjct: 241 ELSEPLAETQYDAVKRLGQLGFVINDDMVRVESVEDVLAHYRALEAKRADLGYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  AR+PRW I+HKF+ ++A TRL  I+IQ+GRTG LTPVA+LEPV +G
Sbjct: 301 KVDRLDWQERLGFVARAPRWAIAHKFSPEKAVTRLNAIEIQVGRTGALTPVAKLEPVTVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHN+D I+            +D+RVGD V+++RAG+VIP+VV++++++R   
Sbjct: 361 GVVVSNATLHNQDEIE-----------RKDVRVGDTVIIQRAGDVIPQVVEVVLDKRPEA 409

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+PF+FP+ CP+C S  VR+     G++V   RCTGGL C AQ +ERLKHFVSR AF+IE
Sbjct: 410 AEPFAFPTLCPVCGSHAVRE----EGEVV--RRCTGGLICDAQAVERLKHFVSRKAFDIE 463

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTK--IENILGFGDVSVTNLYDSI 542
           GLG +Q++ FF        ++ PADIFTL+ R +       I+   G+G+ S  NL+ SI
Sbjct: 464 GLGAKQIEAFFHE----GLVKQPADIFTLRARNEAGEINPPIQTREGWGERSAANLFGSI 519

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           ++RRNI L RF+F+LGIRHVG E AR +A+ + S+Q   +E         + + + + + 
Sbjct: 520 DQRRNIGLARFLFALGIRHVGEETARLIARSFTSWQ-VVRETAEAANEPGEAFAAFMDID 578

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+   +A+ EF+    N  A+ ALL  V+      +    S +  K +VFTG+L++  
Sbjct: 579 GIGETAVKALAEFFAESHNQDALNALLAHVTVEDA-EQVAAESPVAGKTVVFTGSLERFT 637

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA VS  +S KTDI++ G   GSKL+KAQ+LGV+ M E+++L L+
Sbjct: 638 RDEAKAKAQSLGAKVSGSVSGKTDILVAGPGAGSKLKKAQELGVQTMTEDEWLALI 693


>gi|316933200|ref|YP_004108182.1| NAD-dependent DNA ligase [Rhodopseudomonas palustris DX-1]
 gi|315600914|gb|ADU43449.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris DX-1]
          Length = 715

 Score =  585 bits (1508), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 308/728 (42%), Positives = 457/728 (62%), Gaps = 27/728 (3%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           +KK     I  L+  +A+ EL  L   I  HD  YYQ   P I D++YDAL+RR +AI  
Sbjct: 3   VKKNPAPDIATLTKAKAKVELMRLRLVIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQ 62

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L  +   + P   +G        KV H++P LSL   +  +++ +F  R+ RF + 
Sbjct: 63  KFPELVSA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKL 119

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SL 179
            D  +I    EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   
Sbjct: 120 DDVPAI--VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGK 177

Query: 180 NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNF 238
           +IP   E+RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L F
Sbjct: 178 HIPAACELRGEVYMLKQDFLALNKRQEEAGETVFANPRNSAAGSLRQKDVAVTASRPLKF 237

Query: 239 FVHGLGKTSE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLP 296
           F +  G+ S+  +    Q++MLQ +  +GF VN  +R  +T   I+++Y E+   R++LP
Sbjct: 238 FAYAWGEMSDYPMEEPTQHKMLQWLDHVGFVVNPLIRPCHTVEEILAFYREIGEQRASLP 297

Query: 297 YDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVA 356
           YDIDG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVA
Sbjct: 298 YDIDGVVYKVDRLDYQERLGFISRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVA 357

Query: 357 RLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDI 416
           RL+PV +GG ++ NATLHNEDYIKG+   G  +R G DIR GD V+V+RAG+VIP++V +
Sbjct: 358 RLQPVTVGGVVVQNATLHNEDYIKGIGNDGSPLRDGVDIREGDTVVVQRAGDVIPQIVSV 417

Query: 417 IVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFV 476
           ++++R   A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFV
Sbjct: 418 VLDKRPAGAEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFV 471

Query: 477 SRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVT 536
           SR AF+I+GLG++Q++ F +       ++ PADIFTL+ R   +  K+E + G+G+ SV 
Sbjct: 472 SRLAFDIDGLGEKQIELFHERG----WVQEPADIFTLKAR--NAELKLEQLEGYGETSVR 525

Query: 537 NLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAH 590
           NL+ +I+ RR I L R +F+LGIRHVG   A+ LA++Y +   F      A +      +
Sbjct: 526 NLFAAIDARRTIELHRLVFALGIRHVGEGNAKLLARHYGTLDAFLTAMRAAADAQTEEGN 585

Query: 591 NNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
            ++ +  L  +  +GD++A+A+VEF+   RN+ A++ALL E++  +   +    + +  K
Sbjct: 586 TSEAYQDLDNIAGIGDVVAEAVVEFFAEERNVKALDALLAELTEVLPAEQARRDTAVAGK 645

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ 
Sbjct: 646 TVVFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLT 705

Query: 711 EEQFLFLL 718
           E+++L L+
Sbjct: 706 EDEWLALI 713


>gi|217979603|ref|YP_002363750.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
 gi|254781370|sp|B8ETN6|DNLJ_METSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|217504979|gb|ACK52388.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
          Length = 700

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 304/715 (42%), Positives = 453/715 (63%), Gaps = 26/715 (3%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PI+A+++ QAR+E S L  EI+ HD  YY+   P + D+EYD L+RR   +  AFP+LA 
Sbjct: 5   PIDAMTLAQARREHSRLGAEIAAHDARYYREDAPTVSDAEYDRLRRRYGELESAFPELA- 63

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
              P+    K+G   +    K+ H IP LSL  +++  ++  F+ R+ RF     + S+ 
Sbjct: 64  --SPDSLTKKVGAAPSEKFAKIRHRIPMLSLGNVFSEAEVEDFVARVRRFLGLPTEASLA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG   ++R+E G+FV AA RGDG  GEDV+A +R I  IP  L    PE++EV
Sbjct: 122 ITAEPKIDGLSCSLRFENGEFVQAATRGDGFEGEDVTANVRTIAEIPARLKGEPPEVLEV 181

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGK 245
           RGEVY++  DF A+N      G+  +ANPRNAA+G LR+L+P +IT  R L+FF +  G+
Sbjct: 182 RGEVYMTHADFAAMNVRQQEAGKPLFANPRNAAAGSLRQLDP-NITAGRPLHFFAYAWGE 240

Query: 246 TSEIFAKG-QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
                  G Q  M+   +  G PVN  +   ++   +++ Y  ++  R+ L YDIDG+VY
Sbjct: 241 ILPAPPAGTQMGMVAAFKSYGLPVNPLMVLCHSAEELIAKYRSIEEKRAALGYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ++LG  +RSPRW ++HKF  +QA+T L DI+IQ+GRTG LTPVARL+PV +G
Sbjct: 301 KVDSLVLQERLGFVSRSPRWAVAHKFPAEQATTVLRDIEIQVGRTGALTPVARLDPVTVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G  + NATLHNED I             +D+R+GD V ++RAG+VIP+V+ +++N+R  +
Sbjct: 361 GVTVANATLHNEDEI-----------ARKDVRIGDTVRIQRAGDVIPQVLGVVLNKRPAE 409

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P+ FP  CPIC S  +R+++ KTG      RCTGGL C AQ +ERLKHF SR+A +IE
Sbjct: 410 AKPYVFPDHCPICGSAAIREIDEKTGVADVVRRCTGGLICPAQAIERLKHFASRNALDIE 469

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+        I  PADIFTL+ R + +  K+++  G+G+ S  NL+ +I +
Sbjct: 470 GLGDKQIEQFYHDG----LITKPADIFTLEARDKAALKKLKDREGYGETSTRNLFRAIEQ 525

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR  +L RFI++LGIRHVG   AR LA+++ S+    +E     A  ++    +  +  V
Sbjct: 526 RRAPALNRFIYALGIRHVGETNARRLARHFGSFSAL-RETGRAAAPGSEARAEINNIEGV 584

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS-SEIENKKLVFTGTLQKIQR 663
           G+++A+A+ +F+  P N  A++ALL  V+P     E+ VS + +  K +VFTG L+++ R
Sbjct: 585 GEVVAEAVADFFAEPHNEEALDALLAHVNPQP--MEEIVSDTPVAGKTVVFTGALERMTR 642

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +A+    +LGA V+A +S+KTD++I G   GSKL KA +LGV+ ++EE +L L+
Sbjct: 643 DEAKAMAERLGAKVAASVSKKTDLVIAGPGAGSKLAKAAELGVETISEEDWLKLV 697


>gi|260433791|ref|ZP_05787762.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417619|gb|EEX10878.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
          Length = 708

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 300/714 (42%), Positives = 448/714 (62%), Gaps = 15/714 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP++ L+ +QA++EL+ L   +   ++ Y+    P I D+EYDALKRR   I   FP L 
Sbjct: 5   IPVQELTEDQAKEELARLASALLRANELYHGQDAPEISDAEYDALKRRNLEIEARFPHLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R   P+ P  ++G   +    KV HS+  +SL   ++  D+R F+  I ++    +D+  
Sbjct: 65  R---PDSPTEQVGARPSEGFDKVRHSVRMMSLGNAFDETDVRDFVRSIQKYLGLSEDDVP 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A    +  IP+ L+   P+I+E
Sbjct: 122 EFTAEPKIDGLSLSLRYENGTLVQAATRGDGEVGENVTANALTVGDIPKALT-GAPKILE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLG 244
           VRGEVY+S  DF  LN +    G K +ANPRNAA+G LR+L+P ++TR   L FF +  G
Sbjct: 181 VRGEVYMSHEDFARLNQKQSESGGKLFANPRNAAAGSLRQLDP-EVTRSRPLRFFAYAWG 239

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + SE   + Q E L ++  LGF  N   R   +   ++++Y  ++  R+TL YDIDG+VY
Sbjct: 240 ELSEPLGQTQIEGLARLASLGFATNGLTRLCRSVEDMLAHYRTIEEQRATLGYDIDGVVY 299

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++ +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +G
Sbjct: 300 KVNDLALQARLGYRSTTPRWAIAHKFPAETAWTRLEAIDIQVGRTGALSPVARLHPVTVG 359

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G DA G V+R G+DIRVGD V V RAG+VIPK+ D+ +++R   
Sbjct: 360 GVVVSNATLHNEDYIAGRDAKGNVIRDGKDIRVGDWVQVYRAGDVIPKIADVDLSKRPDW 419

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP+ CP C S  +R+         +  RCTGG+ C AQ +E+LKHFVSR AF+IE
Sbjct: 420 AVPFEFPTKCPECGSDAIREEGD------SVRRCTGGIICPAQAVEKLKHFVSRKAFDIE 473

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+  +DP   ++ P DIFTLQ+R + +  K+ N  G+G  SV  L+ +I++
Sbjct: 474 GLGTKQIEMFY--DDPDLPVKTPVDIFTLQQRDEANLNKLANRKGWGRQSVAKLWAAIDE 531

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R + L R +F+LGIRHVG   +  LA +Y S++ F + +         +W  L+ +  V
Sbjct: 532 KRTVPLARLLFALGIRHVGEAASNLLANHYGSWEAFEKAMTAAADFEGPEWQELLSIDGV 591

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G+++A+ +V  +        ++ L+ +++           S +  K +VFTGTL+K+ R 
Sbjct: 592 GEVMARTLVSTFAQEAERKTIDDLVAQLNVLDAERPDTSDSPVAGKTIVFTGTLEKMTRA 651

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+     LGA VS  +S+KTDI++ G   GSK +KA +LGVK+++E+++L L+
Sbjct: 652 EAKARAEALGAKVSGSVSKKTDIVVAGPGAGSKAKKAAELGVKVLDEDEWLHLI 705


>gi|27381702|ref|NP_773231.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
 gi|81735382|sp|Q89FV8|DNLJ_BRAJA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|27354871|dbj|BAC51856.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
          Length = 716

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 306/721 (42%), Positives = 454/721 (62%), Gaps = 13/721 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + L  +  L+  QA+ EL  L  E+  HD  YYQ   P + D+EYDAL++R +AI   
Sbjct: 7   KSKPLRDVAELTKAQAKVELMRLALELEGHDKRYYQDDAPTVTDAEYDALRQRFNAIEKR 66

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+   +E P+    K+G   +    KV H++P LSL+  +  ED+R F+ RI RF  K 
Sbjct: 67  FPEFVSAESPS---QKVGAAPSGRFRKVRHAVPMLSLDNAFAEEDVRDFVGRIVRFL-KL 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
           DD+ I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L   N
Sbjct: 123 DDDKIDFSAEPKIDGLSMSLRYEGGELVTAATRGDGAEGEDVTANIRTLEDVPQKLKGRN 182

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P+I EVRGEVY++K  FLALN+   A G   +ANPRN+A+G LR+ +PT   +R L FF
Sbjct: 183 VPDICEVRGEVYMTKKAFLALNERQKAAGDTIFANPRNSAAGSLRQKDPTITASRPLGFF 242

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ S +  + Q  M+      GF  N   R  ++   +++++  ++  R+ L YDI
Sbjct: 243 AYAWGEMSAMPEETQTGMIHWFERCGFKTNPLTRLCHSVEELIAFHQRIEEERAELDYDI 302

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +R+PRW I+HKF  +QA T L DI+IQ+GRTG  TPV +LE
Sbjct: 303 DGVVYKVDRIDWQERLGFVSRTPRWGIAHKFPAEQAMTVLRDIEIQVGRTGSFTPVGKLE 362

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD++++
Sbjct: 363 PVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVVLD 422

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   A+ F FP  CP      V       G+  +  RCTG  AC  Q++E LK FVSR 
Sbjct: 423 KRPKTAKEFHFPKTCPCPLHTDVTREETAAGEEGSRARCTGEFACPYQKIEHLKLFVSRR 482

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++QL +FF   D  F ++ PADIFTL++R   +  K+E I G+G  SV NL+
Sbjct: 483 AFDIDGLGEKQLQYFF---DEGF-VKEPADIFTLEKR--NAKLKLEEIEGYGATSVRNLF 536

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
            +I  RR I+LERF+++LG+RHVG   A +LA+ Y S++ F      +   + +    + 
Sbjct: 537 AAIESRRRIALERFVYALGMRHVGETTALALARGYGSWEAFHDACLKVAKGDEEAMADMD 596

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  +GD + ++I +++    N   VE L KEV        K+ +S +  K +VFTG+L+
Sbjct: 597 ALDQIGDTVIKSIADYFGESHNRGIVERLTKEVEIVDAEKPKS-NSAVAGKTVVFTGSLE 655

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K+ R +A+    +LGA VS  +S+KTD+++ G   GSKL +A + GVK++ E+++L L+ 
Sbjct: 656 KMTRDEAKATAERLGAKVSGSVSKKTDLVVAGPGAGSKLAEANKHGVKVLTEDEWLKLIG 715

Query: 720 Q 720
           +
Sbjct: 716 E 716


>gi|154245706|ref|YP_001416664.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
 gi|254782313|sp|A7IG64|DNLJ_XANP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154159791|gb|ABS67007.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
          Length = 720

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 305/720 (42%), Positives = 459/720 (63%), Gaps = 27/720 (3%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP++ LS  +A  E  +L QEI+ HD  YY+   P++ D+EYDAL+ R +AI   FP L 
Sbjct: 19  IPVDDLSPAEAASEHKALAQEITGHDAAYYREDAPVVSDAEYDALRHRYEAIEERFPGL- 77

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R ED      K+G   +    KV H +P LSL   ++ E++ +F+ R+ RF     D+ +
Sbjct: 78  RGEDSLS--EKVGAAPSEKFGKVAHKVPMLSLANCFSDEEVVEFVARVKRFLNLGPDDEV 135

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEII 185
            FT EPKIDG   ++ YE G+   AA RGDG  GEDV+  +R I  IP R+    +P+ I
Sbjct: 136 AFTCEPKIDGLSCSLHYENGRLTVAATRGDGSQGEDVTQNVRTIADIPERLAGKGVPQTI 195

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           +VRGEVY++K DF ALN    A   K +ANPRNAA+G LR+L+ +   +R L FF +  G
Sbjct: 196 DVRGEVYMAKADFEALNARQAAAEEKVFANPRNAAAGSLRQLDSSITASRPLKFFAYAWG 255

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A+ Q+ +++     GF  N  +  A    G++++Y  +++ R+ L YDIDG+VY
Sbjct: 256 EASDLPAETQFGVVEAFARWGFTTNPLMVVAKDAAGLIAHYRSIEAQRALLGYDIDGVVY 315

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV+   LQ++LG  +RSPRW I+HKF  +QA+T L DI+IQ+GRTG LTPVA+L PV +G
Sbjct: 316 KVNSLELQRRLGFVSRSPRWAIAHKFPAEQATTVLEDIEIQVGRTGALTPVAKLTPVTVG 375

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++++ATLHNED I             +D+R+GD V+V+RAG+VIP+VV +I  +R   
Sbjct: 376 GVVVSSATLHNEDEI-----------ARKDVRIGDTVVVQRAGDVIPQVVRVIEEKRPAG 424

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           ++P+ FP+ CP C S  VR+++ K+GK+ A  RCTGGL C AQ +ERL+HFVSR+AF+IE
Sbjct: 425 SKPYEFPTHCPACGSHAVREVDTKSGKVDAVRRCTGGLICPAQMVERLRHFVSRNAFDIE 484

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q+  F++       I  PADIFTL+ R   S  ++EN  G+G  S  NL+ +I +
Sbjct: 485 GLGEKQVRAFYEWG----LIASPADIFTLETRNARSLQRLENRDGWGKTSAANLFAAIAE 540

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSL 598
           RR ++++RF+F+LGIRHVG   A+ L ++Y + +         +         N+ W  +
Sbjct: 541 RRTVAVDRFVFALGIRHVGETNAKRLMRHYGTVEALEAGALAAVIPGEEHPKGNEAWQEM 600

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
           I +  +GD++A+A++EF+  PRN   V ALLKEV+P     +   +S +  K +VFTG+L
Sbjct: 601 IGIDGIGDVVAEAVIEFFGEPRNREVVTALLKEVTPEP-MEQVAAASPVSGKTVVFTGSL 659

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+    +LGA V+  +S KT++++ G   GSKLEKAQ LGV+++ E+++  L+
Sbjct: 660 EKMTRDEAKAMAERLGAKVAGSVSAKTNLVVAGPGAGSKLEKAQALGVQVITEDEWFELV 719


>gi|166216284|sp|Q6N423|DNLJ_RHOPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 305/720 (42%), Positives = 452/720 (62%), Gaps = 27/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I  L+  +A+ EL  L  EI  HD  YYQ   P I D++YDAL+RR +AI   FP+L  +
Sbjct: 11  IATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPELVNA 70

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P   +G        KV H++P LSL   +  +++ +F  R+ RF +  D  +I  
Sbjct: 71  ---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKLDDVPAI-- 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
             EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   +IP   E+
Sbjct: 126 VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKHIPATCEL 185

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+ K DFLALN          +ANPRN+A+G LR+ + T   +R L FF +  G+ 
Sbjct: 186 RGEVYMLKQDFLALNKRQEEANETVFANPRNSAAGSLRQKDVTVTASRPLKFFAYAWGEM 245

Query: 247 SE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           S+  +    Q++MLQ +   GF VN  +   ++    +++Y  +   R++LPYDIDG+VY
Sbjct: 246 SDYPMEEPTQHKMLQWLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPYDIDGVVY 305

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVARL+PV +G
Sbjct: 306 KVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVARLQPVTVG 365

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++ NATLHNEDYIKG+   G+ +R G DIR GD V+V+RAG+VIP++V +++ +R   
Sbjct: 366 GVVVQNATLHNEDYIKGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVVMEKRPAG 425

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+
Sbjct: 426 AEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDID 479

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++ F +       ++ PADIFTL+ R   +  K+E + G+G+ SV NL+ +I+ 
Sbjct: 480 GLGEKQIELFHERG----WVQEPADIFTLKAR--NAELKLEQLEGYGETSVRNLFAAIDA 533

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYY------LSYQNFAQEINNIIAHNNDDWLSL 598
           RR+I L R +F+LGIRHVG   A+ LA++Y      LS    A +      + ++ +  L
Sbjct: 534 RRSIELHRLVFALGIRHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNTSEAYQDL 593

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +GD++A+A+VEF+   RNI A++ALL E++  +   +    + +  K +VFTG+L
Sbjct: 594 DNIAGIGDVVAEAVVEFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKTVVFTGSL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E+++L L+
Sbjct: 654 SKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTEDEWLALI 713


>gi|192292401|ref|YP_001993006.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
 gi|254781404|sp|B3QFL8|DNLJ_RHOPT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|192286150|gb|ACF02531.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
          Length = 715

 Score =  578 bits (1490), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 306/720 (42%), Positives = 450/720 (62%), Gaps = 27/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I  L+  +A+ EL  L  EI  HD  YYQ   P I D++YDAL+RR +AI   FP+L  +
Sbjct: 11  IATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPELVNA 70

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P   +G        KV H++P LSL   +  +++ +F+ R+ RF +  D  +I  
Sbjct: 71  ---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFVERVQRFLRLDDVPAI-- 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
             EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   +IP   E+
Sbjct: 126 VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKHIPAACEL 185

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L FF +  G+ 
Sbjct: 186 RGEVYMLKQDFLALNKRQEEAGETVFANPRNSAAGSLRQKDVLVTASRPLKFFAYAWGEM 245

Query: 247 SE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           S   +    Q++MLQ +   GF VN  +   ++    +++Y  +   R++LPYDIDG+VY
Sbjct: 246 STYPMDEPTQHKMLQWLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPYDIDGVVY 305

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL+PV +G
Sbjct: 306 KVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLQPVTVG 365

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++ NATLHNEDYI+G+   G+ +R G DIR GD V+V+RAG+VIP++V +++ +R   
Sbjct: 366 GVVVQNATLHNEDYIRGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVVMQKRPAG 425

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+
Sbjct: 426 AEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDID 479

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++ F +       ++ PADIFTL+ R      K+E + G+G+ SV NL+ +I+ 
Sbjct: 480 GLGEKQIELFHERG----WVQEPADIFTLKAR--NDQLKLEQLEGYGETSVRNLFAAIDA 533

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYY------LSYQNFAQEINNIIAHNNDDWLSL 598
           RR I L R IF+LGIRHVG   A+ LA++Y      LS    A +      + ++ +  L
Sbjct: 534 RRTIELHRLIFALGIRHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNTSEAYQDL 593

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +GD++A+A+VEF+   RNI A++ALL E++  +   +    + +  K +VFTG+L
Sbjct: 594 DNIAGIGDVVAEAVVEFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKTVVFTGSL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E+++L L+
Sbjct: 654 SKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTEDEWLALI 713


>gi|299131914|ref|ZP_07025109.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
 gi|298592051|gb|EFI52251.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
          Length = 706

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 312/725 (43%), Positives = 451/725 (62%), Gaps = 33/725 (4%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           K+ + P+E L+  QA+ EL+ L  EIS HD+ YYQ   P + D++YD L++R  AI   F
Sbjct: 6   KKAVTPVENLTKAQAKVELTRLALEISMHDERYYQKDAPTVSDADYDKLRQRLSAIEERF 65

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L   + P+    K+G + + +  K+ H++P LSL   ++ ED+ +F TR+ RF     
Sbjct: 66  PELVAKDSPS---QKVGAQPSRAFAKIRHAVPMLSLGNAFSDEDVAEFATRVRRFLNLGA 122

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNI 181
           D  +    EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  +P  L    +
Sbjct: 123 DEPLVIVAEPKIDGLSLSLRYENGELVSAATRGDGFEGEDVTANVRTIKDVPHTLRGKGV 182

Query: 182 PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFV 240
           P I EVRGEVY+ + DFLALN +        +ANPRN+A+G LR+ N     +R L FF 
Sbjct: 183 PAICEVRGEVYMMREDFLALNKKQAEADDTIFANPRNSAAGSLRQKNVEVTASRPLKFFA 242

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           +  G+ SE+ A  Q+EM++ +   GF VN  +        +++YY E+++ R++LPYDID
Sbjct: 243 YAWGEMSEMPAPTQFEMVKWLHKAGFVVNPRMTLCRDVEALLTYYREIETERASLPYDID 302

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKVD    Q +LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL P
Sbjct: 303 GVVYKVDRLDWQNRLGFISRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLTP 362

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG ++ NATLHNED I             +DIR GD V+++RAG+VIP+VV ++  +
Sbjct: 363 VTVGGVVVQNATLHNEDEI-----------ARKDIREGDTVVIQRAGDVIPQVVSVVTEK 411

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  +A+ +SFP  CPIC S  VR+ +       A  RCTG L C AQ +ERLKHFVSR A
Sbjct: 412 RRKNAKSYSFPHKCPICGSHAVREEDE------AVRRCTGALICPAQAVERLKHFVSRLA 465

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+  F+   D    I  P DIFTLQ+R   +  K+++  G+GDVSV NL+ 
Sbjct: 466 FDIEGLGDKQIQEFY---DDGL-IMHPVDIFTLQKRDARAVKKLKDREGYGDVSVNNLFA 521

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDD 594
           +I+ RR I L R IF+LGIRHVG   A+ LA++Y S +N    +           + ++ 
Sbjct: 522 AIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGSIENLRAAMAEAAAAQTEEGNTSEA 581

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVF 654
           +  L  +  +GDI+A A+VEF+   RN+ A++ LL E+   +   +    S +  K +VF
Sbjct: 582 YADLNNIGGIGDIVADAVVEFFAEKRNVKALDELLAEIE-VLPAEQVRTDSAVAGKTVVF 640

Query: 655 TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TG+L K  R +A+    +LGA VS  +S+KTD ++ G+  GSKL KA++LGV ++ E+++
Sbjct: 641 TGSLTKFTRDEAKAQAERLGAKVSGSVSKKTDYVVAGEEAGSKLTKARELGVAVLTEDEW 700

Query: 715 LFLLQ 719
           L L++
Sbjct: 701 LKLIE 705


>gi|148257407|ref|YP_001241992.1| DNA ligase (polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
 gi|166215399|sp|A5EPJ2|DNLJ_BRASB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146409580|gb|ABQ38086.1| DNA ligase (Polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
          Length = 716

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 307/723 (42%), Positives = 457/723 (63%), Gaps = 16/723 (2%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K ++ + +  L+  QA+ E   L  E+  HD  YYQ   P I D+EYD L+RR +AI   
Sbjct: 6   KPKKPVDVAELTKAQAKVEWKRLALELEVHDRLYYQDDAPKISDAEYDELRRRFNAIETR 65

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L  SE P+    K+G   +    KV H++P LSL+  +  ED+R F+ RI RF +  
Sbjct: 66  FPELVSSESPS---QKVGASPSGRFKKVRHAVPMLSLDNAFAEEDVRDFVGRIARFLKLA 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
           DD  I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L   N
Sbjct: 123 DDR-IDFSAEPKIDGLSMSLRYEGGELVTAATRGDGAEGEDVTANIRTLKDVPQKLHGRN 181

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P++ EVRGEVY++K  FLALN+     G   +ANPRN+A+G LR+ +P    +R L FF
Sbjct: 182 WPDVCEVRGEVYMTKQAFLALNERQKEAGDTIFANPRNSAAGSLRQKDPAITASRPLGFF 241

Query: 240 VHGLGKTSEIF-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S    A+ Q  M++     GF  N   R  ++   +++++  ++  R+ L YD
Sbjct: 242 AYAWGEISGTPPAETQTGMIKWFEQCGFTTNPLTRLCHSVEELIAFHRSIEEQRAELDYD 301

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q++LG  +R+PRW I+HKF  ++A T L DI+IQ+GRTG LTPV +L
Sbjct: 302 IDGVVYKVDRIDWQERLGFVSRTPRWAIAHKFPAERAMTVLKDIEIQVGRTGSLTPVGKL 361

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD+++
Sbjct: 362 EPVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVVI 421

Query: 419 NERHPDAQPFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           ++R   A+PF  P  CP    + VVR+    TG+  +  RCTG  AC  Q++E LK F S
Sbjct: 422 DKRPAQARPFHLPKTCPCPLHTDVVRE-ETATGEEGSRARCTGEFACPYQKIEHLKLFAS 480

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R AF+I+GLG++Q+ FFF+       ++ PADIFTLQ+R   +  K+E I G+G+ SV N
Sbjct: 481 RRAFDIDGLGEKQIAFFFEQG----WVKEPADIFTLQKR--NAGLKLEEIEGYGETSVRN 534

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           L+++I+ RR I+LERFI++LG+RHVG   A +LA+ Y S+  F +    + A + +    
Sbjct: 535 LFNAIDARREIALERFIYALGMRHVGETTALALARGYGSWDAFHEACLKVAAGDEEAIAE 594

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGT 657
           +  +  +GD + +++  ++    N   VE L +EV        K   S I  K +VFTGT
Sbjct: 595 MDALDQIGDTVIKSVAAYFAEDHNRGIVERLTQEVKILDAEKPKR-HSPIATKTVVFTGT 653

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           L+K+ R +A+    +LGA VS  +S+KTD ++ G   GSKL++AQ+ GV+++ E+++L L
Sbjct: 654 LEKMTRDEAKATAERLGAKVSGSVSKKTDYVVAGPGAGSKLKEAQKHGVQVLTEDEWLQL 713

Query: 718 LQQ 720
           + +
Sbjct: 714 IAE 716


>gi|254460861|ref|ZP_05074277.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium HTCC2083]
 gi|206677450|gb|EDZ41937.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium HTCC2083]
          Length = 706

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 301/713 (42%), Positives = 449/713 (62%), Gaps = 16/713 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I  LS+E+AR EL++L + ++  +  Y+    P + D+ YDALK+R  AI   FP L R 
Sbjct: 6   ITELSVEEARAELAALSKALNTANVAYHGKDNPDLSDANYDALKQRNAAIEDHFPTLVRE 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G  +     K+TH+   +SL   +  ED+  F   I ++    +D  + F
Sbjct: 66  DSPS---KLVGAPVQDGFGKITHAQRMMSLGNAFTDEDVADFTQGIRKYLGLSNDRPLAF 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE G  + AA RGDG +GEDV A    I  +P+ L  N PE+IEVR
Sbjct: 123 TAEPKIDGLSLSLRYENGTLIQAATRGDGTTGEDVLANALTIADVPKNLE-NAPEVIEVR 181

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKT 246
           GEVY++  DF ALN   +  G K +ANPRNAA+G LR+L+ ++IT  R L FF +  G  
Sbjct: 182 GEVYMTHADFDALNARQVERGSKTFANPRNAAAGSLRQLD-SEITKSRPLRFFAYAWGVL 240

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S+  A  Q+  + +++ LGF  N   ++      ++ +Y +++  R+ L YDIDG+VYKV
Sbjct: 241 SDPLANTQHGAIARLKMLGFQTNPLTQRFENVVDLIKHYQQIEQQRAALGYDIDGVVYKV 300

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ + Q +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG 
Sbjct: 301 DDLAYQSRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLSPVTVGGV 360

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYI+G D SG+++RGGRDIRVGD V + RAG+VIPK+ D+ +++R  D+ 
Sbjct: 361 VVSNATLHNEDYIEGRDNSGELIRGGRDIRVGDWVQIYRAGDVIPKIKDVDLSKRPSDSS 420

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF FP  CP CQS  +RD+        A  RC+GGL C AQ +E++KHFVSR AF+IEGL
Sbjct: 421 PFEFPKICPECQSAALRDVGD------AVRRCSGGLICPAQAVEKMKHFVSRGAFDIEGL 474

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+   DP   IR PADIFTL+ R     +K++N  G+G  S   L+ +I++RR
Sbjct: 475 GAKQVEMFY--HDPTLPIREPADIFTLKTRDAQQLSKLKNRDGWGAKSADKLFAAIDERR 532

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           NIS  R +++LG+RHVGA+ A  +A++Y S+  F   ++       D W  L+ +  VG+
Sbjct: 533 NISFARVLYALGLRHVGAQSASLIARHYGSWAVFVDAMDAASDQVGDAWDRLMSIDGVGE 592

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           I+A ++V  +  P    ++  +  E++  I   + +  S +  K +VF+GTL+K+ R +A
Sbjct: 593 IMASSLVTAFIQPGERASITRVTDELT-IIDAEKPDTDSPVTGKVVVFSGTLEKMTRAEA 651

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +     LGA VS  +S KTDI+I G   GSK +KA +L ++ ++E+ +L L++
Sbjct: 652 KARAEALGAKVSGSVSAKTDILIAGPGAGSKAKKAAELDIETLDEDSWLALIE 704


>gi|126736446|ref|ZP_01752187.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
 gi|126713984|gb|EBA10854.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
          Length = 715

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 307/714 (42%), Positives = 439/714 (61%), Gaps = 18/714 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           +P+ +LS EQA KELS L  +++  +  Y++   P I D+ YDALKRR  AI   FPDL 
Sbjct: 15  VPVASLSPEQATKELSWLATQLNAANTAYHRDDAPDISDATYDALKRRNAAIEAQFPDLK 74

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R + P+     +GG++     KV H +  LSL   ++ +D+ +F  RI ++     D  +
Sbjct: 75  RQDSPS---ETVGGQIAEGFGKVKHVVRMLSLGNAFDDDDVHEFDQRIRKYLGLAADALL 131

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE GK + AA RGDG +GE+V+   R I  IP  ++   P+++E
Sbjct: 132 TYTAEPKIDGLSLSLRYEDGKLIQAATRGDGETGENVTNNARTIADIPAKVN-GAPDVLE 190

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG 244
           VRGEVY+S +DF ALN     VG K +ANPRNAA+G LR+L+  +IT  R L FF +  G
Sbjct: 191 VRGEVYMSHDDFTALNARQAEVGGKTFANPRNAAAGSLRQLD-AEITKSRPLRFFAYAWG 249

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             S   A+ Q   + K++ LGF  N      +    ++++Y  +++ R+ L YDIDG+VY
Sbjct: 250 DLSARLAQTQSGAIAKLKTLGFSTNPLTEACDGPAAMIAHYKGIEAQRANLGYDIDGVVY 309

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD+ +LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +G
Sbjct: 310 KVDDLTLQRRLGFRSTTPRWAIAHKFPAELAWTVLEAIDIQVGRTGALSPVARLRPVTVG 369

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G D +G  +R GRDIRVGD V V RAG+VIPKV DI +  R  D
Sbjct: 370 GVVVSNATLHNEDYIAGRDGNGDPIREGRDIRVGDWVQVYRAGDVIPKVKDIDLARRPKD 429

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A P+  P+ CP C S  +R+         A  RCTGG+ C AQ +E+LKHF+SR AF+IE
Sbjct: 430 AMPYQMPARCPECGSDAIREEGD------AVRRCTGGIICPAQAVEKLKHFISRTAFDIE 483

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+        I  PADIFTL+ R      +++N  G+GD S  NL+D+I++
Sbjct: 484 GLGAKQVEQFYAD----GWIATPADIFTLRVRFSEGLQQLKNREGWGDKSAANLFDAIDE 539

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R ISL R I+SLGIRHVG   A  LA +Y S+  F Q +          W  L  +  V
Sbjct: 540 KREISLARVIYSLGIRHVGENSAALLANHYTSWTAFEQAMTAAQIGEGHAWDELNNIDGV 599

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++A +++   Q      +++ L+KE+        +   S +  K +VFTGTL+++ R 
Sbjct: 600 GAVMATSLITTMQQEAERASIDQLIKELDVQDA-EARATDSPVAGKTVVFTGTLERMTRA 658

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+     LGA VS  +S KTDI+I G   GSK +KA  LG++ M+E+ +L L+
Sbjct: 659 EAKARAETLGAKVSGSVSAKTDILIAGPGAGSKAKKAADLGIETMDEDAWLSLI 712


>gi|85714986|ref|ZP_01045971.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
 gi|85698183|gb|EAQ36055.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
          Length = 705

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 306/720 (42%), Positives = 449/720 (62%), Gaps = 33/720 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++L+  QAR E   L  EI  H++ YYQ   P + D+ YDA++RR +AI   FPDL  
Sbjct: 10  PVDSLTRSQARVEHKRLVLEIEAHNERYYQQDAPTVSDAAYDAMQRRLEAIEARFPDLVT 69

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +   + P   +G        KV H++P LSL   ++  ++ +F+ RI RF +   D+   
Sbjct: 70  A---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDAEVAEFVERIRRFLKLGADDIPA 126

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIE 186
              EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   +IP   E
Sbjct: 127 IVAEPKIDGLSLSLRYEHGELVRAATRGDGFTGEDVTANVRTIRDVPHTLRGRDIPAACE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGK 245
           +RGEVY+ K DFLALN +  A G   +ANPRN+A+G LR+ +     +R L FF +  G+
Sbjct: 187 LRGEVYMLKEDFLALNKKQEAAGDTVFANPRNSAAGSLRQKDVAITASRPLKFFAYAWGE 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            ++  A+ Q++ML+ +R +GF VN  +   ++   ++ +Y  +   R+TL YDIDG+VYK
Sbjct: 247 MTDRPAETQHDMLKWLRDVGFMVNPLIELCSSVEQVLQFYRRIGEQRATLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q++LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG +TPVARLEPV +GG
Sbjct: 307 VDRLDWQERLGFVSRSPRWAIAHKFAAEQAMTILRGIDIQVGRTGAMTPVARLEPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ NATLHNED I             +DI VGD V+V+RAG+VIP+VV +I+ +R  +A
Sbjct: 367 VVVQNATLHNEDEIT-----------RKDIHVGDTVVVQRAGDVIPQVVSVIIGKRPRNA 415

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           QP+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+G
Sbjct: 416 QPYVFPHKCPVCGSHAVREEGE------AVRRCTGTLICPAQAVERLKHFVSRLAFDIDG 469

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q+  F+   D    I  P DIFTLQ+R   +T K+ +  G+GDVSV NL+ +I+ R
Sbjct: 470 LGEKQIQEFY---DDGL-IMHPVDIFTLQKRDARATKKLRDREGYGDVSVRNLFAAIDAR 525

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD------WLSLI 599
           R I L R IF+LGIRHVG   A+ LA++Y   +NF   +        D+      +  L 
Sbjct: 526 RKIELNRLIFALGIRHVGEGNAKLLARHYGGIENFRSAMAEAAGAQTDEGNASEAYADLN 585

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  +G+I+A A+VEF+  PRN+ A+  LL+E+   +   +    S +  K +VFTG+L+
Sbjct: 586 NIGGIGEIVANAVVEFFAEPRNVKALNDLLEEIE-VLPVAQTRSDSAVAGKTVVFTGSLE 644

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K  R +A+    ++GA VS  +S+KTD+++ G   GSKL+ A++ GV++++E+++L L++
Sbjct: 645 KFTRDEAKASAERMGARVSGSVSKKTDLVVAGPGAGSKLKDAEKFGVRVISEDEWLKLIE 704


>gi|154252874|ref|YP_001413698.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
 gi|190359267|sp|A7HVV8|DNLJ_PARL1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154156824|gb|ABS64041.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
          Length = 710

 Score =  575 bits (1482), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 309/711 (43%), Positives = 452/711 (63%), Gaps = 21/711 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L++E+A +EL  L  EI  HD  YYQ   P I D+EYD L+RR +AI   +P+L R 
Sbjct: 17  VDHLTLEEAPEELERLAAEIEKHDKLYYQKDAPRISDAEYDTLRRRNEAIEARYPELVRE 76

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +++G +      KV H +P LSL   ++ ED+R F  RI RF   K+++ +  
Sbjct: 77  DSPS---HRVGAQPADGFGKVVHKVPMLSLSNAFDDEDVRDFALRIRRFLNLKEEDILPI 133

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
           T EPKIDG    +RYEKGKFV  A RGDG  GE+V+  ++ I  IP  L   NIP+++EV
Sbjct: 134 TAEPKIDGLSAALRYEKGKFVMGATRGDGREGENVTENLKTIGDIPAELKGKNIPDVVEV 193

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN+     G+  +ANPRNAA+G LR+L+     +R L FF +  G+ 
Sbjct: 194 RGEVYMSHEDFAALNERQREAGKPVFANPRNAAAGSLRQLDAKITASRPLRFFAYTWGEM 253

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S++ A  Q  ++   R  GF VN    + +T   ++ +Y++++  R+TL YDIDG+VYKV
Sbjct: 254 SDLPADTQSGVMDAFRKWGFTVNPLFGRCDTVEALIDFYHDIEERRATLGYDIDGVVYKV 313

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q +LG  +RSPRW ++HKF  +QA T L  I+IQ+GRTG LTPVARL PV +GG 
Sbjct: 314 DRLDWQNRLGFVSRSPRWALAHKFPAEQAMTVLEKIEIQVGRTGALTPVARLTPVTVGGV 373

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHN D I+ L            +R GD V+V+RAG+VIP++V + V +R    +
Sbjct: 374 VVSNATLHNADEIERLG-----------VRPGDTVVVQRAGDVIPQIVRV-VEDRPRGKK 421

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            F FP  CP C S  VR++NPKTGKL A  RCTGGL C AQ +ERL+HFVSR+AF+IEGL
Sbjct: 422 KFVFPDTCPECGSHAVREVNPKTGKLDAVARCTGGLVCPAQAVERLRHFVSRNAFDIEGL 481

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G++Q+  FF  ED    I+ P DIFTL  R   S  K+++  G+G  S   L+D+I+ RR
Sbjct: 482 GEKQIAAFF--EDGL--IKKPDDIFTLAARDAKSLKKLKDREGWGATSARKLFDAIDARR 537

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            + L+RFIF LGIRHVG   AR LA+ Y +  +F +++       ++ +  L+ +  VG+
Sbjct: 538 EVELDRFIFGLGIRHVGETNARLLARSYGTLDHFEEQMRAAADREDEAYAELLSIDGVGE 597

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A++IV+F+    N   ++ L +     +   ++  SS +  K +VFTG+L+K+ R +A
Sbjct: 598 VLAESIVDFFAEKHNREVLDGLREAGVKGVPLPKQETSSPVAGKTVVFTGSLEKMTRSEA 657

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           +    QLGA V+  +S KTDI++ G + GSKL KA++LG++I++E+Q++ L
Sbjct: 658 KARAEQLGAKVAGSVSAKTDILVAGADAGSKLAKARELGIEILDEDQWIEL 708


>gi|126462048|ref|YP_001043162.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17029]
 gi|166216229|sp|A3PJ74|DNLJ_RHOS1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126103712|gb|ABN76390.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17029]
          Length = 704

 Score =  575 bits (1481), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 303/712 (42%), Positives = 437/712 (61%), Gaps = 17/712 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ L+  +A  EL+ L + I   +  Y+ +  P I D++YDALK R  AI   FP+L R
Sbjct: 6   PVDQLTEAEAATELARLAEAIEAANTAYHTHDAPQISDADYDALKLRNRAIEEQFPELRR 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           S+ P+   +++GG +     KV H +  LSLE  +++ ++  +I RI R+     D  + 
Sbjct: 66  SDSPS---DRVGGALAEGFAKVRHEVRMLSLENAFDLAEVEDWIERIRRYLGHVGD--LL 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYEKG+ V AA RGDG +GE+V+   R I  +P  L    P+++EV
Sbjct: 121 FTAEPKIDGLSLSLRYEKGRLVQAATRGDGETGENVTENARTIADLPTELD-GAPDLLEV 179

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN    A G++ +ANPRNAA+G LR+L+P    +R L FF +  G  
Sbjct: 180 RGEVYMSHEDFAALNGRQEAAGQRLFANPRNAAAGSLRQLDPAVTASRPLRFFAYAWGAH 239

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q+E + ++  LGF  N   R       +++ + E++  R+ L YDIDG+VYKV
Sbjct: 240 SEPLAATQHEAIARLAALGFATNPLTRLCTGPEELLAQHAEIERQRAALGYDIDGVVYKV 299

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQ++LG RA +PRW I+HKFA + A T+L  IDIQ+GRTG L+PVARL+PV +GG 
Sbjct: 300 DDLALQRRLGFRASTPRWAIAHKFAAQLAWTQLEGIDIQVGRTGALSPVARLKPVTVGGV 359

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHNEDYI G D+ G+ +RGG+DIRVGD V V RAG+VIPKV D+ ++ R   A 
Sbjct: 360 VVANATLHNEDYIAGRDSKGQEIRGGKDIRVGDWVQVYRAGDVIPKVADVDLDRRPEGAA 419

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP C S  +R+            RCTGGL C AQQ+ERLKHFVSR AF+IEGL
Sbjct: 420 RYRFPETCPECGSEAIREPGDSV------RRCTGGLICPAQQVERLKHFVSRAAFDIEGL 473

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++  ++       IR PADIF L  R +    ++EN  G+G  S  NL+ +I  RR
Sbjct: 474 GAKQVEALWRD----GWIRQPADIFELPNRYREGIQRLENREGWGRKSAENLFAAIEARR 529

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I+L R IF+LGIRHVG   A  LA +Y S+  F   +         +W  L+ +  VG 
Sbjct: 530 RIALHRLIFALGIRHVGETTATLLATHYGSWAAFEAAMTRAEVGAGPEWQDLLSIDGVGA 589

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A ++V  +       AV+AL   ++         V+S +  K +VFTGTL+K+ R +A
Sbjct: 590 VLATSLVTAFHQEAERAAVDALAAHLTVEDAEVRAPVASPVAGKIVVFTGTLEKMSRAEA 649

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA VS  +S +TD+++ G   GSK ++A  LG++ ++E+ +L L+
Sbjct: 650 KARAEALGAKVSGSVSARTDVVVAGPGAGSKAKQAAALGIETIDEDGWLRLI 701


>gi|149915267|ref|ZP_01903795.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
 gi|149810988|gb|EDM70827.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
          Length = 720

 Score =  575 bits (1481), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 304/714 (42%), Positives = 441/714 (61%), Gaps = 16/714 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ LS +QA +EL+ L   ++  D  Y+    PI+ D+ YDAL +R  AI   FPDL R
Sbjct: 17  PVDKLSADQAAQELARLADLVAQADAAYHGQDAPIMSDAAYDALVQRNAAIEARFPDLMR 76

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
            + P+    ++G   +    KVTH++  LSL   +  +++R+F  RI R+     + ++ 
Sbjct: 77  EDSPS---RRVGFTPSEGFGKVTHAVRMLSLGNAFEDDEIREFDARIRRYLGLSPEAALT 133

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIE 186
           +T EPKIDG  +++RYE+G+ V AA RGDG  GE+V+A  R I  IP  L    +PE++E
Sbjct: 134 YTSEPKIDGLSLSLRYEQGRLVQAATRGDGAEGENVTANARTIADIPHDLGGAGVPELLE 193

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGK 245
           VRGEVY+S  DF ALN        K +ANPRNAA+G LR+L+P    R  L FF +  G 
Sbjct: 194 VRGEVYMSHADFEALNTRQTERSDKTFANPRNAAAGSLRQLDPKITARRPLKFFAYAWGA 253

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE  A  Q E + ++   GF  N      +    +++ Y  ++ +R+ L YDIDG+VYK
Sbjct: 254 HSEPLAPSQMEAIARLAGFGFQTNPLTALCDGPDEMLAQYRRIEQLRAELGYDIDGVVYK 313

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V+E +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 314 VNEIALQHRLGYRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLHPVTVGG 373

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI G DA G  +RGG+DIRVGD V V RAG+VIPKV D+ +++R  D+
Sbjct: 374 VVVSNATLHNEDYIAGRDAKGNKIRGGKDIRVGDWVQVYRAGDVIPKVADVDLSKRPEDS 433

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P++FP  CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+IEG
Sbjct: 434 APYTFPKVCPECGSDAIREEGD------AVRRCTGGLICPAQAVEKLKHFVSRAAFDIEG 487

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSINK 544
           LG +Q++ F         IR PADIFTL+ R      T+++N  G+G+ S  NL+D+I++
Sbjct: 488 LGAKQVEQFHADG----WIREPADIFTLKDRYGPGCLTQLKNRDGWGEKSAANLFDAIDE 543

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR I+L R +F+LGIRHVG   +  LA++Y ++  F   ++   A    DW  L+ +  V
Sbjct: 544 RRRIALGRLLFALGIRHVGEAASMMLARFYGTWDEFTAAMDGAAAGEGPDWDRLLGIDGV 603

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++AQ++V  +       +++ L+  +            S +  K +VFTGTL+K+ R 
Sbjct: 604 GKVMAQSLVTTFAQDEERASIDRLVAHLEIERAERPDTDGSPVAGKTVVFTGTLEKMTRA 663

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+     LGA VS  +S KTD++I G   GSK + A+QLGV++++E+ +L L+
Sbjct: 664 EAKARAEALGAKVSGSVSAKTDLVIAGPGAGSKAKAAEQLGVEMIDEDGWLALI 717


>gi|110679832|ref|YP_682839.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
 gi|123172419|sp|Q166E0|DNLJ_ROSDO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|109455948|gb|ABG32153.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
          Length = 705

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 298/713 (41%), Positives = 440/713 (61%), Gaps = 15/713 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++L+ + A+KELS L   +   +  Y+    PII D+++DA KRR  AI   FP L R
Sbjct: 5   PLDSLTEKAAKKELSKLADLLDQANTAYHANDAPIISDADFDAYKRRNLAIEERFPHLKR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P    +++G   +    KV HSI  LSL   ++  D+  F+ RI +     D  ++ 
Sbjct: 65  ADSPT---DRVGAAPSAGFSKVVHSIAMLSLANAFDEADVSDFVQRIRKHLGLSDIEALS 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYE G  V AA RGDG  GE+V+   R IP IP  +S N P+++EV
Sbjct: 122 FTSEPKIDGLSLSLRYENGTLVQAATRGDGAIGENVTENARTIPDIPEQIS-NAPDVLEV 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN    + G K +ANPRNAA+G LR+L+     +R L FF +  G  
Sbjct: 181 RGEVYMSHADFEALNARQASAGAKLFANPRNAAAGSLRQLDARITQSRPLRFFAYAWGTL 240

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE   K Q + +++++  GF  N+   + N    +++ Y  ++  R++L YDIDG+VYKV
Sbjct: 241 SEPLGKTQMQSIERLQSFGFQTNDLTEKCNGPEELLAQYRRIEERRASLDYDIDGVVYKV 300

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+PV +GG 
Sbjct: 301 DDLDLQRRLGFRSTTPRWAIAHKFPAELAWTELQGIDIQVGRTGALSPVARLKPVTVGGV 360

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYI G D  G V+RGG+DIRVGD V V RAG+VIPKV D+ + +R  DA 
Sbjct: 361 VVSNATLHNEDYIAGRDNKGDVIRGGKDIRVGDFVQVYRAGDVIPKVADVDLKKRPADAI 420

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP+ CP C S  +R+         A  RCTGGL C AQ +ERLKHFVSR AF+I+GL
Sbjct: 421 PYVFPATCPECGSDALREAGD------AVRRCTGGLICPAQAVERLKHFVSRAAFDIDGL 474

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+K       I  PADIFTL+ R  +   +++N  G+G+ S  NL+D+I+ +R
Sbjct: 475 GAKQIEQFYKDG----WISEPADIFTLRDRFGSGIQQLKNRDGWGEKSANNLFDAIDDKR 530

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I L R IF+LGIRHVG   +  +A++Y ++  F + +      + + W  L+ +  VG 
Sbjct: 531 QIPLARLIFALGIRHVGEAASNLIAQHYSTFDAFEKSMLAAQDKDGEAWDDLLSIDGVGT 590

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++AQ+++          +++ L+ ++            S +  K +VFTGTL K+ R +A
Sbjct: 591 VMAQSVIHAMGQAAERASIDRLVAQLDVQPSEAVVTDGSPVAGKTVVFTGTLSKMTRAEA 650

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +     LGA V+  +S KTD ++ G   GSK +KA +LGV+ ++E+ +L L++
Sbjct: 651 KSRAESLGARVAGSVSAKTDFLVAGPGAGSKAKKAAELGVQTLDEDGWLALIE 703


>gi|254488738|ref|ZP_05101943.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
 gi|214045607|gb|EEB86245.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
          Length = 706

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 305/714 (42%), Positives = 442/714 (61%), Gaps = 17/714 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I ++ LS +QA +EL  L   ++  +  YY    P I D+EYD LKRR   I   FP L 
Sbjct: 5   IAVQDLSKDQAAEELRRLSGLLAQANRQYYAEDAPQISDAEYDCLKRRNTEIETRFPSLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P     +IG   +    KV H +P LSL   +  ED+ +F  RI ++     D  +
Sbjct: 65  RADSPT---EQIGATPSEGFSKVRHEVPMLSLGNAFEDEDVVEFDGRIRKYLGLPSDADL 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A  R I TIP+ L  + P++IE
Sbjct: 122 DFTAEPKIDGLSLSLRYENGLLVQAATRGDGAVGENVTANARTIQTIPKKLD-SAPDVIE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLG 244
           +RGEVY+S +DF ALN      G K +ANPRNAA+G LR+L+  +ITR   L FF +  G
Sbjct: 181 IRGEVYMSHDDFDALNARQGERGGKLFANPRNAAAGSLRQLD-AEITRSRPLKFFAYAWG 239

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             SE   + Q E +++M  +GF  N      ++   ++  Y ++++ R+TL YDIDG+VY
Sbjct: 240 ALSEPLGQTQSEAIKRMENMGFCTNPLTELCSSVAEMIDQYRKIEAQRATLGYDIDGVVY 299

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++ +LQ++LG R+ +PRW I+HKF  + A T L DI IQ+GRTG L+PVARL+PV +G
Sbjct: 300 KVNDLALQERLGFRSTTPRWAIAHKFPAELAWTTLEDITIQVGRTGALSPVARLKPVTVG 359

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYIKG+D+ G  +R G+DIRVGD V V RAG+VIPK+ D+ ++ R  D
Sbjct: 360 GVVVSNATLHNEDYIKGVDSKGNQIRDGKDIRVGDWVQVYRAGDVIPKIADVDLSRRPSD 419

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           + PF FP+ CP C S  +R+         A  RC GGL C AQ +E+LKHFVSR AF+I+
Sbjct: 420 SVPFDFPTICPECGSDAIREEGD------AVRRCMGGLVCPAQAVEKLKHFVSRAAFDID 473

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+        I  PADIFTLQ R  +   +++N  G+G+ S T L+ +I+ 
Sbjct: 474 GLGAKQVEQFYTDG----WIAEPADIFTLQARYGSGVQQLKNREGWGEKSATKLFQAIDD 529

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R I L R IF+LGIRHVG   +  +A +Y ++  F   + N    +   W  LI V  V
Sbjct: 530 KRTIPLARLIFALGIRHVGEAASNLIALHYGTWSAFITAMENAREASGPAWDDLISVDGV 589

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++AQ++V  +       +++ L+ E+S           S ++ K +VFTGTL+K+ R 
Sbjct: 590 GQVMAQSLVSTFAQEAERASIDRLVAELSIQDATRPDTQGSPVDGKTVVFTGTLEKMTRA 649

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+    +LGA VS  +S KTDI++ G   GSK +KA +LG++I++E+ +L L+
Sbjct: 650 EAKARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAAELGIEILDEDAWLDLI 703


>gi|91977847|ref|YP_570506.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
 gi|123735250|sp|Q133Y4|DNLJ_RHOPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91684303|gb|ABE40605.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
          Length = 714

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 307/720 (42%), Positives = 449/720 (62%), Gaps = 28/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A+ EL  L   I  HD  YYQ   P I D++YDAL+RR +AI   FP+L  +
Sbjct: 12  IDKLTKPKAKVELMRLRLAIEGHDKAYYQDDAPKIPDADYDALRRRLEAIEAKFPELLSA 71

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
             P+     +G        KV H++P LSL   ++ +++ +F+ R+ RF + +D  +I  
Sbjct: 72  SSPS---QTVGAAPARGFSKVQHAVPMLSLGNAFSDDEVGEFVERVQRFLKLEDIPAI-- 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
             EPKIDG  +++RYE G  V AA RGDG +GEDV+A +R I  IP  L +  IP   E+
Sbjct: 127 VAEPKIDGLSLSLRYENGTLVRAATRGDGFTGEDVTANVRTIADIPTTLKAKTIPAACEL 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVY+ K+DFLALN      G   +ANPRN+A+G LR+ +     +R L FF +  G+ 
Sbjct: 187 RGEVYMLKHDFLALNKRQEEAGDTVFANPRNSAAGSLRQKDVAITASRPLKFFAYAWGEM 246

Query: 247 SE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           S+  + +  Q+ ML  +   GF VN  +   ++    +++Y  +   R+ LPYDIDG+VY
Sbjct: 247 SDYPMESPTQHAMLAWLGDAGFTVNPEITLCHSVDDALAFYRRIGEQRAALPYDIDGVVY 306

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q +LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG LTPVARL+PV +G
Sbjct: 307 KVDRLDYQARLGFVSRSPRWAIAHKFAAEQAVTVLEKIDIQVGRTGALTPVARLQPVTVG 366

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++ NATLHNEDYIKG+ + G  +R G DIR GD V+V+RAG+VIP++V +++++R  D
Sbjct: 367 GVVVQNATLHNEDYIKGVGSDGSPLRDGVDIREGDTVVVQRAGDVIPQIVTVVLDKRPAD 426

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
              + FP  CP+C S   R+         A  RCTG L C AQ +ERLKHFVSR AF+I+
Sbjct: 427 LPAYKFPHKCPVCGSHAAREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDID 480

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q+  F +       +R PADIFTL+ R   +  K+E++ G+G+ SV NL+ +I+ 
Sbjct: 481 GLGEKQIVLFHERG----WVREPADIFTLKARN--AELKLEDLEGYGETSVRNLFAAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAHNNDDWLSL 598
           RRNI L R IF+LGIRHVG   A+ LA++Y S   F      A E      + ++ +  L
Sbjct: 535 RRNIELNRLIFALGIRHVGEGNAKLLARHYGSIDVFLAAMRAAAEGQTPEGNTSEAYQDL 594

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +GD++A+A+VEF+  PRN+ A++ALL+E+   +   +    + +  K +VFTG L
Sbjct: 595 DNIAGIGDVVAEAVVEFFAEPRNVGALDALLREIE-VLPVEQAKQDTAVAGKTVVFTGAL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E+++L L+
Sbjct: 654 TKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKARDLGVAVLTEDEWLALI 713


>gi|39936579|ref|NP_948855.1| DNA ligase [Rhodopseudomonas palustris CGA009]
 gi|39650435|emb|CAE28958.1| DNA ligase [Rhodopseudomonas palustris CGA009]
          Length = 692

 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 300/705 (42%), Positives = 444/705 (62%), Gaps = 27/705 (3%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L  EI  HD  YYQ   P I D++YDAL+RR +AI   FP+L  +   + P   +G    
Sbjct: 3   LRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPELVNA---SSPTQTVGAAPA 59

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H++P LSL   +  +++ +F  R+ RF +  D  +I    EPKIDG  +++RY
Sbjct: 60  RGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKLDDVPAI--VAEPKIDGLSLSLRY 117

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKNDFLALN 202
           E G+ V AA RGDG +GEDV+A +R I  +P  L   +IP   E+RGEVY+ K DFLALN
Sbjct: 118 ENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKHIPATCELRGEVYMLKQDFLALN 177

Query: 203 DEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE--IFAKGQYEMLQ 259
                     +ANPRN+A+G LR+ + T   +R L FF +  G+ S+  +    Q++MLQ
Sbjct: 178 KRQEEANETVFANPRNSAAGSLRQKDVTVTASRPLKFFAYAWGEMSDYPMEEPTQHKMLQ 237

Query: 260 KMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERA 319
            +   GF VN  +   ++    +++Y  +   R++LPYDIDG+VYKVD    Q++LG  +
Sbjct: 238 WLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPYDIDGVVYKVDRLDYQERLGFVS 297

Query: 320 RSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYI 379
           RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVARL+PV +GG ++ NATLHNEDYI
Sbjct: 298 RSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVARLQPVTVGGVVVQNATLHNEDYI 357

Query: 380 KGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQS 439
           KG+   G+ +R G DIR GD V+V+RAG+VIP++V +++ +R   A+P+ FP  CP+C S
Sbjct: 358 KGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVVMEKRPAGAEPYHFPHKCPVCGS 417

Query: 440 RVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSED 499
             VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+GLG++Q++ F +   
Sbjct: 418 HAVREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDIDGLGEKQIELFHERG- 470

Query: 500 PAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGI 559
               ++ PADIFTL+ R   +  K+E + G+G+ SV NL+ +I+ RR+I L R +F+LGI
Sbjct: 471 ---WVQEPADIFTLKAR--NAELKLEQLEGYGETSVRNLFAAIDARRSIELHRLVFALGI 525

Query: 560 RHVGAEIARSLAKYY------LSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           RHVG   A+ LA++Y      LS    A +      + ++ +  L  +  +GD++A+A+V
Sbjct: 526 RHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNTSEAYQDLDNIAGIGDVVAEAVV 585

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           EF+   RNI A++ALL E++  +   +    + +  K +VFTG+L K  R +A+    +L
Sbjct: 586 EFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKTVVFTGSLSKFTRDEAKAAAERL 645

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           GA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E+++L L+
Sbjct: 646 GAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTEDEWLALI 690


>gi|146342488|ref|YP_001207536.1| DNA ligase [Bradyrhizobium sp. ORS278]
 gi|166215400|sp|A4YZJ3|DNLJ_BRASO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146195294|emb|CAL79319.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+])
           [Bradyrhizobium sp. ORS278]
          Length = 716

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 298/722 (41%), Positives = 456/722 (63%), Gaps = 14/722 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +Q + +  L+  QA+ E   L  E+  HD  YYQ   P I D+ YD L+RR +AI   
Sbjct: 6   KSKQSVDVADLTKAQAKVEWKRLALELETHDRLYYQEDAPKISDAAYDELRRRFNAIEKR 65

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L   + P+     +G   +    KV H++P LSL+  +  ED+R F+ RI RF +  
Sbjct: 66  FPELVSRDSPS---QTVGAAPSGRFKKVRHAVPMLSLDNAFAEEDVRDFVGRIARFLKLA 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
           +D+ I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L   N
Sbjct: 123 EDDRIAFSAEPKIDGLSMSLRYEGGQLVTAATRGDGAEGEDVTANIRTLKDVPQKLHGRN 182

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P+I E+RGEVY++K  FLALN+     G   +ANPRN+A+G LR+ +PT   +R L FF
Sbjct: 183 LPDICEIRGEVYMTKQAFLALNERQKEAGDTIFANPRNSAAGSLRQKDPTITASRPLGFF 242

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G  S + A+ Q  M++     GF  N   +  ++   +++++  ++  R+ L YDI
Sbjct: 243 AYAWGDMSAMPAETQSGMIKWFEHCGFTTNPLTKLCHSVEELIAFHRAIEEQRAELDYDI 302

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +R+PRW I+HKF  ++A T L DI+IQ+GRTG  TPV +LE
Sbjct: 303 DGVVYKVDRIDWQERLGFVSRTPRWGIAHKFPAERAMTVLKDIEIQVGRTGSFTPVGKLE 362

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD++++
Sbjct: 363 PVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVLID 422

Query: 420 ERHPDAQPFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           +R  DA+ F+FP  CP    + VVR+     G+  +  RCTG  AC  Q++E LK F SR
Sbjct: 423 KRPADAEVFAFPRKCPCPLHTDVVRE-ETAAGEEGSRARCTGEFACPYQKIEHLKLFASR 481

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q+ FFF   D  + ++ PADIFTLQ+R   +  K+E + G+G+ SV NL
Sbjct: 482 RAFDIDGLGEKQIQFFF---DEGW-VKEPADIFTLQKR--NAKLKLEEVEGYGETSVRNL 535

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           +++I  RR ++LERFI++LG+R+VG   A +LA+ Y S++ F      +   + +    +
Sbjct: 536 FNAIEARREMALERFIYALGMRYVGETTALALARGYGSWEAFHDACLKVANGDEEAIAEM 595

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +G+ + +++  ++    N   VE L +EV        K  +S I  K +VFTGTL
Sbjct: 596 DALDQIGETVIKSVAAYFGEDHNRGIVERLTREVKILDAEKPKR-NSPIATKTVVFTGTL 654

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+    +LGA VS  +S+KTD ++ G   GSKL+ A++ GVK++ E+++L L+
Sbjct: 655 EKMTRDEAKATAERLGAKVSGSVSKKTDYVVAGPGAGSKLKDAEKHGVKVLTEDEWLQLI 714

Query: 719 QQ 720
            +
Sbjct: 715 GE 716


>gi|146277206|ref|YP_001167365.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17025]
 gi|166216230|sp|A4WRP6|DNLJ_RHOS5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145555447|gb|ABP70060.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17025]
          Length = 704

 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 297/685 (43%), Positives = 424/685 (61%), Gaps = 17/685 (2%)

Query: 35  YYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIP 94
           Y+ +  P I D++YDALKRR  AI   FP L RS+ P+    ++GG +     KV H + 
Sbjct: 33  YHTHDAPRISDADYDALKRRNRAIEERFPALRRSDSPS---ERVGGALAEGFAKVRHEVR 89

Query: 95  TLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALR 154
            LSLE  + + ++ ++I RI RF     D  + FT EPKIDG  +++RYEKG+ V AA R
Sbjct: 90  MLSLENAFELAEVEEWIERIRRFLGHVGD--LRFTAEPKIDGLSLSLRYEKGRLVQAATR 147

Query: 155 GDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYA 214
           GDG +GE+V+   R I  +P  L+   P+++EVRGEVY+   DF ALN+   A G++ +A
Sbjct: 148 GDGETGENVTENARTIGDLPTELT-GAPDLLEVRGEVYMRHADFAALNERQEATGQRLFA 206

Query: 215 NPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVR 273
           NPRNAA+G LR+L+P    +R L+FF +  G  SE  A  Q   + ++  LGF  N   R
Sbjct: 207 NPRNAAAGSLRQLDPAVTASRPLHFFAYAWGAHSEPLADTQQGAIARLSALGFATNPLTR 266

Query: 274 QANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEK 333
                  ++++Y +++  R++L YDIDG+VYKVD+ +LQ++LG RA +PRW I+HKFA +
Sbjct: 267 LCTGPDELLAHYADIERQRASLGYDIDGVVYKVDDLALQRRLGFRASTPRWAIAHKFAAE 326

Query: 334 QASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGR 393
            A T+L  IDIQ+GRTG L+PVARL+PV +GG ++ NATLHNEDYI G D+ G+ +RGG+
Sbjct: 327 LAWTQLEGIDIQVGRTGALSPVARLKPVTVGGVVVANATLHNEDYIAGRDSKGQEIRGGK 386

Query: 394 DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLV 453
           DIRVGD V V RAG+VIPKV ++ ++ R   A+P+ FP  CP C S  +R+         
Sbjct: 387 DIRVGDWVQVYRAGDVIPKVAEVDLSRRPEGAEPYRFPDTCPDCGSAAIREPGDSV---- 442

Query: 454 AAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTL 513
              RCTGGL C AQQ+ERLKHFVSR AF+IEGLG +Q++  ++       IR PADIF L
Sbjct: 443 --RRCTGGLICPAQQVERLKHFVSRAAFDIEGLGARQVEALWRD----GWIRQPADIFEL 496

Query: 514 QRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKY 573
             R +    ++EN  G+G  S  NL  +I  RR I+L R IF+LGIRHVG   A  LA +
Sbjct: 497 PNRYRDGLQRLENREGWGRKSAENLLAAIEARRRIALHRLIFALGIRHVGETTATLLATH 556

Query: 574 YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS 633
           Y S+  F   +         +W  L+ +  VG ++A ++V  +       A++AL   ++
Sbjct: 557 YGSWAAFEAAMTRAEVGTGSEWQDLLSIDGVGAVLATSLVTTFHQEAERAAIDALAAHLT 616

Query: 634 PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDN 693
                    V S I  K +VFTGTL+K+ R++A+     LGA VS  +S +TD+++ G  
Sbjct: 617 VEDAEMRAPVESPIAGKIVVFTGTLEKMSRNEAKARAEALGAKVSGSVSARTDLVVAGPG 676

Query: 694 PGSKLEKAQQLGVKIMNEEQFLFLL 718
            GSK ++A  LGV+ + E+ +L L+
Sbjct: 677 AGSKAKQAAALGVETIGEDAWLRLI 701


>gi|260462100|ref|ZP_05810344.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
 gi|259031960|gb|EEW33227.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
          Length = 734

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/732 (41%), Positives = 441/732 (60%), Gaps = 32/732 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P I D+EYDAL+RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELQRLAEEIAEHDRRYHTEDAPTITDAEYDALRRRNLAIEERFPGLVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
            + P+    ++G        KV H++P LSL K +  ED+  FI R  RF+ +  D  I 
Sbjct: 65  EDSPS---LRVGAAPAEGFAKVRHAVPMLSLAKAYTDEDVTDFIERGRRFFDRDKDLDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIE 186
           FT EPKIDG   ++RYEKG FV  A RG+G  GED++A +R I  IP  L     PEIIE
Sbjct: 122 FTAEPKIDGLSASLRYEKGVFVQGATRGNGTVGEDITANLRTIADIPAKLKGSGWPEIIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     A G + Y NPRN A+G LR+ + +   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKARSAAAGGQDYVNPRNTAAGSLRQKDASVTASRNLKFFAYAWGY 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+E  A  QY  +QK    GF ++  + +A +   +V++Y+ ++  RS+L YDIDG+VYK
Sbjct: 242 TTEDPAPTQYGAVQKFADWGFKISPLMVRAKSVEELVAHYHRIEEQRSSLGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW I+HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAIAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKG D++G+ +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGFDSNGQPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP+C S   R++N KTGK  +  RCTG L C+AQ +ERL+HFVSR A +IEG
Sbjct: 422 TPYEFPHTCPVCGSPATREINEKTGKEDSRRRCTGELICAAQAVERLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKI-------------------EN 526
           LG + +D FF     A  I+  ADIFTL+ R+   T  +                   +N
Sbjct: 482 LGAENIDTFFN----AGLIKTAADIFTLRDRRPAVTKALAERREEQARQREAASGKTRKN 537

Query: 527 ILGFGD---VSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           +    D     +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LA+ + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAALLARTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       +  +GD +  A+ +F+ N RN   +E LL++V P       + 
Sbjct: 597 VGKETAAAEDPHTVFPSINGIGDTVIDALRDFFGNQRNDDVLEKLLEQVKPKPYIVTVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTGTL+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTIVFTGTLEKMTRSEAKAMAERLGAKVAGSVSAKTDLLVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFL 715
           LGV++++E+ +L
Sbjct: 717 LGVEVIDEDTWL 728


>gi|221639033|ref|YP_002525295.1| DNA ligase [Rhodobacter sphaeroides KD131]
 gi|254781405|sp|B9KRK2|DNLJ_RHOSK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221159814|gb|ACM00794.1| DNA ligase [Rhodobacter sphaeroides KD131]
          Length = 704

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 302/712 (42%), Positives = 438/712 (61%), Gaps = 17/712 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ L+  +A  EL+ L + I   +  Y+ +  P I D++YDAL+ R  AI   FP+L R
Sbjct: 6   PVDQLTEAEAAAELARLAEAIEAANTAYHTHDAPQISDADYDALRLRNRAIEEQFPELRR 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           S+ P+   +++GG +     KV H +  LSLE  +++ ++  +I RI R+     D  + 
Sbjct: 66  SDSPS---DRVGGALAEGFAKVRHEVRMLSLENAFDLAEVEDWIERIRRYLGHVGD--LL 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYEKG+ V AA RGDG +GE+V+   R I  +P  L    P+++EV
Sbjct: 121 FTAEPKIDGLSLSLRYEKGRLVQAATRGDGETGENVTENARTIADLPTELD-GAPDLLEV 179

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN    A G++ +ANPRNAA+G LR+L+P    +R L FF +  G  
Sbjct: 180 RGEVYMSHEDFAALNGRQEAAGQRLFANPRNAAAGSLRQLDPAVTASRPLRFFAYAWGAH 239

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q+E + ++  LGF  N   R       +++ + E++  R+ L YDIDG+VYKV
Sbjct: 240 SEPLAATQHEAIARLAALGFTTNPLTRLCTGPEELLAQHAEIERQRAALGYDIDGVVYKV 299

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQ++LG RA +PRW I+HKFA + A T+L  ID+Q+GRTG L+PVARL+PV +GG 
Sbjct: 300 DDLALQRRLGFRASTPRWAIAHKFAAQLAWTQLEGIDVQVGRTGALSPVARLKPVTVGGV 359

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHNEDYI G D+ G+ +RGG+DIRVGD V V RAG+VIPKV D+ ++ R   A 
Sbjct: 360 VVANATLHNEDYIAGRDSKGQEIRGGKDIRVGDWVQVYRAGDVIPKVADVDLDRRPEGAA 419

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C S  +R+            RCTGGL C AQQ+ERLKHFVSR AF+IEGL
Sbjct: 420 PYRFPETCPECGSEAIREPGDSV------RRCTGGLICPAQQVERLKHFVSRAAFDIEGL 473

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++  ++       IR PADIF L  R +    ++EN  G+G  S  NL+ +I  RR
Sbjct: 474 GAKQVEALWRD----GWIRQPADIFELPNRYREGIQRLENREGWGRKSAENLFAAIEARR 529

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I+L R IF+LGIRHVG   A  LA +Y S+  F   +         +W  L+ +  VG 
Sbjct: 530 RIALHRLIFALGIRHVGETTATLLATHYGSWAAFEAAMTRAEVGAGPEWQDLLSIDGVGA 589

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A ++V  +       AVEAL   ++         V+S +  + +VFTGTL+K+ R +A
Sbjct: 590 VLATSLVTAFHQEAERAAVEALAAHLTVEDAEVRAPVASPVAGRIVVFTGTLEKMSRAEA 649

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA VS  +S +TD+++ G   GSK ++A  LG++ ++E+ +L L+
Sbjct: 650 KARAEALGAKVSGSVSARTDLVVAGPGAGSKAKQAAALGIETIDEDGWLRLI 701


>gi|77463176|ref|YP_352680.1| DNA ligase [Rhodobacter sphaeroides 2.4.1]
 gi|123730578|sp|Q3J355|DNLJ_RHOS4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77387594|gb|ABA78779.1| DNA ligase [Rhodobacter sphaeroides 2.4.1]
          Length = 704

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/712 (42%), Positives = 438/712 (61%), Gaps = 17/712 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ L+  +A  EL+ L + I   +  Y+ +  P I D++YDALK R  AI   FP+L R
Sbjct: 6   PVDQLTEAEAAAELARLAEAIEAANTAYHTHDAPQISDADYDALKVRNRAIEEQFPELRR 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           S+ P+   +++GG +     KV H +  LSLE  +++ ++  +I RI R+     D  + 
Sbjct: 66  SDSPS---DRVGGALAEGFAKVRHDVRMLSLENAFDLAEVEDWIERIRRYLGHVGD--LL 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYEKG+ V AA RGDG +GE+V+   R I  +P  L    P+++EV
Sbjct: 121 FTAEPKIDGLSLSLRYEKGRLVQAATRGDGETGENVTENARTIADLPTELD-GAPDLLEV 179

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN    A G++ +ANPRNAA+G LR+L+P    +R L FF +  G  
Sbjct: 180 RGEVYMSHEDFAALNGRQEAAGQRLFANPRNAAAGSLRQLDPAVTASRPLRFFAYAWGAH 239

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q+E + ++  LGF  N   R       +++ + +++  R+ L YDIDG+VYKV
Sbjct: 240 SEPLAATQHEAIARLAALGFATNPLTRLCTGPEELLAQHAQIERQRAALGYDIDGVVYKV 299

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQ++LG RA +PRW I+HKFA + A T+L  IDIQ+GRTG L+PVARL+PV +GG 
Sbjct: 300 DDLALQRRLGFRASTPRWAIAHKFAAQLAWTQLEGIDIQVGRTGALSPVARLKPVTVGGV 359

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHNEDYI G D+ G+ +RGG+DIRVGD V V RAG+VIPKV D+ ++ R   A 
Sbjct: 360 VVANATLHNEDYIAGRDSKGQEIRGGKDIRVGDWVQVYRAGDVIPKVADVDLDRRPEGAA 419

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C S  +R+            RCTGGL C AQQ+ERLKHFVSR AF+IEGL
Sbjct: 420 PYRFPETCPECGSEAIREPGDSV------RRCTGGLICPAQQVERLKHFVSRAAFDIEGL 473

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++  ++       IR PADIF L  R +    ++EN  G+G  S  NL+ +I  RR
Sbjct: 474 GAKQVEALWRD----GWIRQPADIFELPNRYRDGMQRLENREGWGRKSAENLFAAIEARR 529

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I+L R IF+LGIRHVG   A  LA +Y S+  F   +         +W  L+ +  VG 
Sbjct: 530 RIALHRLIFALGIRHVGETTATLLATHYGSWAAFEAAMTRAEVGAGPEWQDLLSIDGVGA 589

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A ++V  +       AV+AL   ++         V+S +  K +VFTGTL+K+ R +A
Sbjct: 590 VLATSLVTAFHQEAERAAVDALAAHLTVEDAEVRAPVASPVAGKIVVFTGTLEKMSRAEA 649

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA VS  +S +TD+++ G   GSK ++A  LG++ ++E+ +L L+
Sbjct: 650 KARAEALGAKVSGSVSARTDLVVAGPGAGSKAKQAAALGIETIDEDGWLRLI 701


>gi|332558050|ref|ZP_08412372.1| DNA ligase [Rhodobacter sphaeroides WS8N]
 gi|332275762|gb|EGJ21077.1| DNA ligase [Rhodobacter sphaeroides WS8N]
          Length = 704

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/712 (42%), Positives = 438/712 (61%), Gaps = 17/712 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ L+  +A  EL+ L + I   +  Y+ +  P I D++YDALK R  AI   FP+L R
Sbjct: 6   PVDQLTEAEAAAELARLAEAIEAANTAYHTHDAPQISDADYDALKLRNRAIEEQFPELRR 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           S+ P+   +++GG +     KV H +  LSLE  +++ ++  +I RI R+     D  + 
Sbjct: 66  SDSPS---DRVGGALAEGFAKVRHDVRMLSLENAFDLAEVEDWIERIRRYLGHVGD--LL 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYEKG  V AA RGDG +GE+V+   R I  +P  L  + P+++EV
Sbjct: 121 FTAEPKIDGLSLSLRYEKGHLVQAATRGDGETGENVTENARTIADLPTELD-SAPDLLEV 179

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF ALN    A G++ +ANPRNAA+G LR+L+P    +R L FF +  G  
Sbjct: 180 RGEVYMSHEDFAALNGRQEAAGQRLFANPRNAAAGSLRQLDPAVTASRPLRFFAYAWGAH 239

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q+E + ++  LGF  N   R       +++ + E++  R+ L YDIDG+VYKV
Sbjct: 240 SEPLAATQHEAIARLAALGFATNPLTRLCTGPEELLAQHAEIERQRAALGYDIDGVVYKV 299

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQ++LG RA +PRW I+HKFA + A T+L  IDIQ+GRTG L+PVARL+PV +GG 
Sbjct: 300 DDLALQRRLGFRASTPRWAIAHKFAAQLAWTQLEGIDIQVGRTGALSPVARLKPVTVGGV 359

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHNEDYI G D+ G+ +RGG+DIRVGD V V RAG+VIPKV D+ ++ R   A 
Sbjct: 360 VVANATLHNEDYIAGRDSKGQEIRGGKDIRVGDWVQVYRAGDVIPKVADVDLDRRPEGAA 419

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C S  +R+            RCTGGL C AQQ+ERLKHFVSR AF+IEGL
Sbjct: 420 PYRFPETCPECGSEAIREPGDSV------RRCTGGLICPAQQVERLKHFVSRAAFDIEGL 473

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++  ++       IR PADIF L  R +    ++EN  G+G  S  NL+ +I  RR
Sbjct: 474 GAKQVEALWRD----GWIRQPADIFELPNRYREGIQRLENREGWGRKSAENLFAAIEARR 529

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I+L R IF+LGIRHVG   A  LA +Y S+  F   +         +W  L+ +  VG 
Sbjct: 530 RIALHRLIFALGIRHVGETTATLLATHYGSWAAFEAAMTRAEVGAGPEWQDLLSIDGVGA 589

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A ++V  +       AV+AL   ++         V+S +  + +VFTGTL+K+ R +A
Sbjct: 590 VLATSLVTAFHQEAERAAVDALAAHLTVEDAEVRAPVASPVAGRIVVFTGTLEKMSRAEA 649

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA VS  +S +TD+++ G   GSK ++A  LG++ ++E+ +L L+
Sbjct: 650 KARAEALGAKVSGSVSARTDLVVAGPGAGSKAKQAAALGIETIDEDGWLRLI 701


>gi|209963935|ref|YP_002296850.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
 gi|254781401|sp|B6IRF1|DNLJ_RHOCS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209957401|gb|ACI98037.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
          Length = 719

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 304/731 (41%), Positives = 435/731 (59%), Gaps = 42/731 (5%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP+E L+++QA  E ++L +EI++H   YY    P I DS YDAL+ R   +   FP+L 
Sbjct: 10  IPVETLTLDQAAAEHAALVREIAHHRALYYGKDAPEIADSAYDALEHRLAGLEARFPELV 69

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
               P+ P   +G   +    KV H +P LSL+  +  ED+  F+ +I RF   K+ + +
Sbjct: 70  ---TPDSPTQTVGAAPSAGFGKVRHRVPMLSLDNAFTAEDVDGFVEQIARFLNLKEVDGL 126

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            F  EPKIDG  +++RYE G    AA RGDG  GEDV+A +R I  IP  L    P ++E
Sbjct: 127 EFVAEPKIDGLSLSLRYENGALAQAATRGDGAEGEDVTANVRTIREIPDRLPAGAPSVLE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+ + +F ALN      G K +ANPRNAA+G LR+L+P+    R L FF +  G 
Sbjct: 187 VRGEVYMVREEFFALNRRQAEAGEKVFANPRNAAAGSLRQLDPSVTAKRPLCFFAYSWGD 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE     Q+E LQ+++ LGF V    R   +   ++ YY  + + R+ LP+DIDG+VYK
Sbjct: 247 LSEPLGATQWEALQRLKALGFRVPAQSRLCRSKAELLDYYAGIGAGRAALPFDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V+   LQ++LG R R+PRW  +HKF  ++A T L  I IQ+GRTG LTPVA LEPV +GG
Sbjct: 307 VNRLDLQERLGFRTRTPRWATAHKFPAERAQTLLRAITIQVGRTGALTPVAELEPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++ ATLHN D I             +DIRVGD V+V+RAG+VIP+VV+++   R  D+
Sbjct: 367 VVVSRATLHNADEI-----------ARKDIRVGDTVVVQRAGDVIPQVVEVVTERRPADS 415

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF FP  CP C S  VR+ +       A  RCTGGL C AQ +ERL+HFVSR+AF+IEG
Sbjct: 416 APFVFPDHCPECGSAAVREEDG------AVSRCTGGLVCPAQAVERLRHFVSRNAFDIEG 469

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +++  F+  +     IR PADIFTL+RR+     ++  + GFG  SV NL+ +I+ R
Sbjct: 470 LGIERIQLFYDQD----RIRSPADIFTLERREAQRLDRLVAMTGFGRKSVENLFRAIDAR 525

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII---AHNNDD-------- 594
           R I L+RFIF+LGIR VG   A+ LA+ Y S   + + +       + N D+        
Sbjct: 526 RRIPLDRFIFALGIRQVGEATAKLLARTYRSVGPWTERMAAAAAERSANPDEAKKPELVG 585

Query: 595 --WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRH---EKNVSSEIEN 649
             +  L  +  +G  +A  I  F+  P N  A++ALLKE+  ++  H    +   S +  
Sbjct: 586 EAYAELCAIEQIGMSVADDICAFFAEPHNRDALDALLKELE-AVEDHVPPPRADGSPVAG 644

Query: 650 KKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIM 709
           K +VFTGTL+ + R +A+     LGA V+  +S KTD ++VG + GSK  KA++LG+ I+
Sbjct: 645 KTVVFTGTLETMGRSEAKARAEALGAKVAGSVSGKTDYVVVGADAGSKAAKARELGLTIL 704

Query: 710 NEEQFLFLLQQ 720
            E+++L L+ Q
Sbjct: 705 TEQEWLDLISQ 715


>gi|163731899|ref|ZP_02139346.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
 gi|161395353|gb|EDQ19675.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
          Length = 705

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 292/716 (40%), Positives = 445/716 (62%), Gaps = 17/716 (2%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
            +P+++L+ + A +ELS L + +   +  Y+    P + D+EYDA KRR  A+   FP L
Sbjct: 3   FVPLDSLNEKAAEEELSRLAELLEQANTAYHTKDAPFMSDAEYDAYKRRNLALEDRFPHL 62

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R++ P    + +G   +    KV+HS+  LSL   ++ ED+  F+ RI +     D   
Sbjct: 63  KRADSPT---DVVGAAPSAGFAKVSHSMAMLSLANAFDDEDVFDFVQRIRKHLGLSDAEP 119

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           + FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A    I  IP+ +  N P+++
Sbjct: 120 LHFTSEPKIDGLSLSLRYENGALVQAATRGDGAVGENVTANALTINDIPQRVP-NAPDVL 178

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGL 243
           EVRGEVY+S  DF ALN++  A G K +ANPRNAA+G LR+L+   IT  R L FF +  
Sbjct: 179 EVRGEVYMSHTDFEALNEKQNAAGAKAFANPRNAAAGSLRQLDAR-ITQNRPLRFFAYAW 237

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G  +    K Q + +++++ LGF  N    + +    +++ Y  ++  R++L YDIDG+V
Sbjct: 238 GTLTAPLGKTQSDSIERLKNLGFQTNELTDRCDGPEALLAQYRRIEERRASLDYDIDGVV 297

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKVD+  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+P+ +
Sbjct: 298 YKVDDLDLQRRLGFRSTTPRWAIAHKFPAELAWTELQSIDIQVGRTGALSPVARLKPITV 357

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG +++NATLHNEDYI G D  G V+R G+DIR GD V V RAG+VIPKV D+ +++R  
Sbjct: 358 GGVVVSNATLHNEDYIAGRDNKGGVIRDGKDIRAGDYVQVYRAGDVIPKVADVDLDKRPA 417

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           +A PF FP+ CP C S  +R+         A  RCTGGL C AQ +ERLKHFVSR AF+I
Sbjct: 418 EAIPFVFPTTCPECGSDALREAGD------AVRRCTGGLICPAQAVERLKHFVSRAAFDI 471

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +GLG +Q++ F+K       +  PADIFTL+ R ++   +++N  G+G+ S TNL+D+I+
Sbjct: 472 DGLGAKQIEQFYKDG----WVSEPADIFTLRDRYESGMQQLKNRDGWGEKSATNLFDAID 527

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
           ++R I L R +F+LGIRHVG   +  +A++Y ++  F +          D W  L+ +  
Sbjct: 528 EKREIPLARLLFALGIRHVGEAASNLIAQHYSTFDAFEKSTLAAQIEEGDAWDDLLSIDG 587

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           VG ++AQ++V     P    +++ L+ ++     +   +  S +  K +VFTGTL+++ R
Sbjct: 588 VGTVMAQSLVHTMGQPAERASIDRLVAQLKVQPSKPIVSDGSPVAGKTVVFTGTLERMTR 647

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            +A+     LGA V+  +S KTD ++ G   GSK +KA +LG++ ++E+ +L L++
Sbjct: 648 AEAKSRAESLGAKVAGSVSAKTDFLVAGPGAGSKAKKAVELGIRTLDEDGWLALIE 703


>gi|296445905|ref|ZP_06887856.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
 gi|296256573|gb|EFH03649.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
          Length = 713

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 292/720 (40%), Positives = 452/720 (62%), Gaps = 33/720 (4%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           +R+  P+  LS  +A+ E S L +EI+ +D  YYQ   P I D+EYDAL++R +A+  AF
Sbjct: 15  ERERPPVAELSPRRAKLEHSRLAEEIAEYDRRYYQEDDPAISDAEYDALRQRYEALEKAF 74

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           P+L      +  L K  G      F K+ H +  LSL  ++  E++ +F+ R+ RF    
Sbjct: 75  PELG----GDASLTKTVGAAPAEKFAKIRHVVRMLSLGNVFADEEVHEFVARVRRFLNFS 130

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN- 180
           D   + FT EPKIDG   ++RYEKG+ V AA RGDG  GED++A IR +  IP+ L  + 
Sbjct: 131 DAAPLLFTAEPKIDGLSCSLRYEKGELVSAATRGDGEEGEDITANIRTLEEIPQRLRGDV 190

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFF 239
           IPE++E+RGEVY+ + DF ALN      G+  +ANPRN+A+G LR+L+P    +R L FF
Sbjct: 191 IPEVLEIRGEVYMRREDFFALNQRQAEAGKPLFANPRNSAAGSLRQLDPNVTASRPLRFF 250

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +G G+ S + A  Q  M+Q     G   N   +   +   ++++Y  ++++R+TL YDI
Sbjct: 251 AYGWGEVSVMPADTQLGMVQAFASFGLATNPLTQLCGSAEELLAHYRNIEALRATLGYDI 310

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD+  LQ +LG  +R+PRW ++HKF  +QA T + DI+I +GRTG LTP+ARLE
Sbjct: 311 DGVVYKVDDIGLQIRLGFVSRAPRWAVAHKFPAEQAKTIVRDIEINVGRTGALTPIARLE 370

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG +++NATLHNED I             +DIR+GD V+V+RAG+VIP++V+++++
Sbjct: 371 PVTVGGVVVSNATLHNEDEI-----------ARKDIRIGDTVVVQRAGDVIPQIVEVVLD 419

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   A P+ FP  CP C S  +R+++ K G      RCTG L C AQ +ERLKHF SR+
Sbjct: 420 KRPEGATPYVFPHECPACGSAALREIDEK-GVEDVVRRCTGSLVCPAQAIERLKHFASRN 478

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           A +IEGLG +Q+++FF        +R  ++IFTL  R + S TK+EN  G+G+ SV NL+
Sbjct: 479 AMDIEGLGDKQIEYFFTD----GLVRTASEIFTLAERDRASLTKLENKEGYGETSVRNLF 534

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
            +I+ RR + + RF+++LGIRHVG   AR LA+++  + +  ++     A  ++    + 
Sbjct: 535 AAIDARRTVPINRFLYALGIRHVGETNARRLARHFPDFASL-RDTAREAAPGSEARERIE 593

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS----PSIGRHEKNVSSEIENKKLVFT 655
            +  +G ++A+A+ +F+  P N   ++ALL  VS    P+I       +S +  K +VFT
Sbjct: 594 SIEGIGGVVAEALHDFFAEPHNEREIDALLAHVSLEPMPTI-----ENASPVAGKTVVFT 648

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           G L+++ R +A+    + GA +S  +S+KTD+++ G   GSKL KA++LGV++++EE++ 
Sbjct: 649 GALERLTREEAKAQAERFGAKISGSVSKKTDLVVAGPGAGSKLAKAKELGVEVISEEEWF 708


>gi|300021787|ref|YP_003754398.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523608|gb|ADJ22077.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
          Length = 712

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 292/712 (41%), Positives = 447/712 (62%), Gaps = 26/712 (3%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           A S+E    E++ L  EI  HD+ YY+   P I D++YDAL+RR   +  A P+L R+  
Sbjct: 20  ATSVED---EIARLSAEIERHDELYYRNDAPEISDADYDALRRRLTQLEDAHPELKRAGS 76

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+    K+G     +  K+ H +P LSL   ++ +D+  F+ R+ RF    + + +  T 
Sbjct: 77  PS---EKVGSAPVAAFGKIAHDVPMLSLGNAFDDQDVVDFVQRVRRFLNLGESDELEITA 133

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRG 189
           EPKIDG  I+IRYE G+ V AA RGDG  GE+V+A ++ I  IP +L   ++P++I++RG
Sbjct: 134 EPKIDGLSISIRYEGGRLVQAATRGDGAEGENVTANVKTIKDIPHLLVGKDVPDVIDIRG 193

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           E+Y+   DF  LN    A G K +ANPRNAA+G LR+L+ +    R L FF +  G  S+
Sbjct: 194 EIYLGHKDFEKLNAAQAASGGKVFANPRNAAAGSLRQLDSSITAQRPLQFFAYAWGAASK 253

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + +  Q  ++   +  G PVN  +    +   ++ YY  ++S R+ L YDIDG+VYKV+ 
Sbjct: 254 LPSDTQRGVVAAFKSWGLPVNPLMEITRSPDELLDYYRGIESKRAKLDYDIDGVVYKVNR 313

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++LG  +RSPRW I+HKFA ++A+T L  IDIQ+GRTG LTPVA+LEPV +GG ++
Sbjct: 314 LDYQERLGFVSRSPRWAIAHKFAAERATTVLNKIDIQVGRTGALTPVAKLEPVTVGGVVV 373

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHNED I             +DIR GD V+V+RAG+VIP++V++++++R   A P+
Sbjct: 374 SNATLHNEDEIS-----------RKDIREGDTVVVQRAGDVIPQIVEVVLDKRPQHAAPY 422

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CPIC S  VR+ + +        RCTGGL C AQ  ERLKHFVSR+AF+IEGLG 
Sbjct: 423 KFPAVCPICGSHAVRESDEEGNAADVVRRCTGGLVCGAQLKERLKHFVSRNAFDIEGLGG 482

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           ++++FFF++      I+  ADIFTL++R Q S   +  + GF + SV  L+ +IN RR +
Sbjct: 483 EKIEFFFETG----RIKSAADIFTLEKRDQKSDEPLTKVRGFKETSVNKLFAAINARRTV 538

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII--AHNNDDWLSLIRVPLVGD 606
            L+RF+F+LGIRH+G   A+ LAK Y +++     ++  I     ++ +  +  +  +G+
Sbjct: 539 PLDRFLFALGIRHIGETTAKDLAKAYGTFEALRAAVDAAIQGGKGSEAYQDIDNIEGIGE 598

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  A+++F+    N   ++ALLKEV+ +  +  + VSS +  K +VFTGTL K+ R++A
Sbjct: 599 TVVDALIDFFSEQHNQEQLDALLKEVNVTAFKRVQ-VSSPVTGKTVVFTGTLTKLTRNEA 657

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +    +LGA VS  +S+KTD ++ G   GSKL+ A+ LGV +++E+ +L L+
Sbjct: 658 KAQAERLGAKVSGSVSKKTDYVVAGAEAGSKLDNARALGVIVLDEDGWLELI 709


>gi|159044058|ref|YP_001532852.1| DNA ligase [Dinoroseobacter shibae DFL 12]
 gi|190359252|sp|A8LK52|DNLJ_DINSH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157911818|gb|ABV93251.1| DNA ligase [Dinoroseobacter shibae DFL 12]
          Length = 741

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 300/713 (42%), Positives = 437/713 (61%), Gaps = 17/713 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           + +EALS   ARKEL+ L + ++  +  Y++   P + D++YDALK+R  AI   FPDL 
Sbjct: 40  VAVEALSEAAARKELARLSELLARANAEYHRDDAPSLSDADYDALKQRNAAIEARFPDLK 99

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R + P+   +++G   + +  KVTH++  LSL   ++ ED+R F TRI RF    +D  +
Sbjct: 100 RGDSPS---DQVGAAPSDTFSKVTHAVRMLSLANAFSDEDIRDFDTRIRRFLGLAEDAPL 156

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  V AA RGDG  GE+V+A  R I  IP  L    PE++E
Sbjct: 157 AYTAEPKIDGLSLSLRYEHGTLVQAATRGDGAVGENVTANARTIDDIPHRLD-GAPEVLE 215

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLG 244
           VRGEVY+S  DF  LN      G K +ANPRNAA+G LR+L+  +ITR   L FF +  G
Sbjct: 216 VRGEVYMSHADFAELNARQAETGGKTFANPRNAAAGSLRQLD-AEITRARPLKFFAYAWG 274

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S   A+ Q E L + R  GF +N    +  T   +++ Y  +++ R+TL YDIDG+VY
Sbjct: 275 EISAPLAETQTETLARFREFGFTINPLTVRCETPEDMLAQYRAIEAQRATLGYDIDGVVY 334

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           K+D+  LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +G
Sbjct: 335 KLDDLDLQRRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLAPVTVG 394

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI+G D +G  +R G DIRVGD V V RAG+VIPK+ D+ ++ R   
Sbjct: 395 GVVVSNATLHNEDYIQGRDNTGAPIRWGTDIRVGDWVQVYRAGDVIPKIRDVDLSRRPEG 454

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP+ CP C S   R+         A  RC+GGL C AQ +E+LKHFVSR A +I+
Sbjct: 455 AAPFDFPTTCPECGSDAPREPGD------AVRRCSGGLICPAQAVEKLKHFVSRGALDID 508

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F++       I  PADIFTL+ R      +++N  G+GD S  NL+ +I+ 
Sbjct: 509 GLGAKQVEQFYRDG----WIAEPADIFTLRARFGQGLQQLKNREGWGDKSAENLFRAIDT 564

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            R     + +F LGIRH+G   +  LA +YL+ +     ++  +   +D W  L+ +  V
Sbjct: 565 ARTAPFAKVLFGLGIRHIGESASSLLANHYLTMEALLAAVDAAVDETSDAWADLLNIDGV 624

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G+++A+A+V          +V  LL ++ P+     +   S +  K LVFTGTL+ + R 
Sbjct: 625 GEVMARALVTTLTQEAERASVNRLLAQIDPAPATPPQVGDSPVAGKTLVFTGTLETMSRA 684

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           +A+     LGA V+  +S KTD++I G   GSK  KA+ LG+++++E+ +  L
Sbjct: 685 EAKATAEALGAKVAGSVSAKTDLLIAGPGAGSKATKAEALGIEVIDEDAWRVL 737


>gi|298293088|ref|YP_003695027.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
 gi|296929599|gb|ADH90408.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
          Length = 725

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 298/728 (40%), Positives = 451/728 (61%), Gaps = 31/728 (4%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+ ++A KE + L  EI+ HD  YYQ   P + D++YDAL+RR +AI   FP+L 
Sbjct: 8   IDVEKLTADEAAKEHARLGDEIAGHDRRYYQDDAPSVSDADYDALRRRYEAIEAQFPELK 67

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
             +  +    K+G   +    KV H +P LSL   +  E++ +F+ R+ RF     D  +
Sbjct: 68  GIDSLS---EKVGAAPSSKFAKVRHRVPMLSLGNAFADEEVEEFVARVRRFLGLSADAEV 124

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEII 185
            FT EPKIDG   ++RYE G+FV AA RGDG  GEDV+  +R I  IP  L  N +P I 
Sbjct: 125 AFTAEPKIDGLSCSLRYENGQFVQAATRGDGFEGEDVTNNVRTIGEIPERLKGNDVPGIF 184

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY+   DF A+N+   A G+  +ANPRNAA+G LR+L+P    +R L FF +  G
Sbjct: 185 EVRGEVYMGHADFAAINERQSASGKPLFANPRNAAAGSLRQLDPKITASRPLRFFAYAWG 244

Query: 245 KTSE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
           + ++  + +  Q+ +++     G P N       +   ++++Y+ ++  R++L YDIDG+
Sbjct: 245 EVADGALPSDTQFGVIEAFSRWGLPTNPLTVLCRSAQELLAHYHAIEEQRASLGYDIDGV 304

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD  +LQ++LG  +RSPRW ++HKF  ++A T+L  I+IQ+GRTG LTPVA+L P+ 
Sbjct: 305 VYKVDSLALQQRLGFVSRSPRWALAHKFPAQRAITQLERIEIQVGRTGALTPVAKLTPIT 364

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGG-----RDIRVGDRVLVKRAGEVIPKVVDII 417
           +GG +++NA+LHNEDYIKG+   G  +RG       DIR GD V+++RAG+VIP+VV + 
Sbjct: 365 VGGVVVSNASLHNEDYIKGIGGDGLPIRGTFNDEPVDIREGDWVVIQRAGDVIPQVVSVE 424

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           +  R  DA+P+ FP+ CP C S  VR+         A  RCTGGL C AQ +ER++HFVS
Sbjct: 425 LERRPKDAKPYQFPTICPACGSHAVREDGE------AVRRCTGGLICPAQAVERIRHFVS 478

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQT--STTKIENILGFGDVSV 535
           RDAF+IEGLG++Q+  FF   D    ++ PADIFTL+ R     S T+++N  G+G+ S 
Sbjct: 479 RDAFDIEGLGEKQVQAFF---DWGL-VKQPADIFTLEARDSAPDSLTRLKNRDGWGETSA 534

Query: 536 TNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI------NNIIA 589
            NL+ +I  RR + + RF+++LGIRH+G   A+ L ++Y + +   +             
Sbjct: 535 KNLFAAIAARRKVPVNRFLYALGIRHIGETNAKRLMRHYPTIEALREAALAAEMPGEAYP 594

Query: 590 HNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIEN 649
             N+ W  +  +  +G ++A+A+V+F+  P N  A++ALLKEV+P            +  
Sbjct: 595 KGNEAWAEMNAIEGIGAVVAEAVVDFFHEPNNEAALDALLKEVTPEP-MEAVAGGGAVAG 653

Query: 650 KKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIM 709
           K +VFTG L+K+ R +A+    +LGA V+  +S+KTD ++ G + GSKL KA++LGV ++
Sbjct: 654 KTVVFTGALEKMTRDEAKAMAERLGAKVAGSVSKKTDYVVAGADAGSKLAKARELGVSVL 713

Query: 710 NEEQFLFL 717
            E+++L L
Sbjct: 714 TEDEWLEL 721


>gi|83942325|ref|ZP_00954786.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
 gi|83846418|gb|EAP84294.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
          Length = 706

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 298/712 (41%), Positives = 437/712 (61%), Gaps = 17/712 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ LS E+A+ EL+ L   +   +  Y+    P + D+EYD LKRR  AI   FP L R+
Sbjct: 7   LQELSEEEAKAELARLADLLGRANTAYHTQDAPDLSDAEYDRLKRRNQAIEERFPGLKRA 66

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +K+G        KV H +  LSL   +  ED+  F  RI ++        + F
Sbjct: 67  DSPS---DKVGATPAEGFGKVRHDVAMLSLGNAFEDEDVVDFDARIRKYLGLPSGTPLAF 123

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I TIP  +    P ++EVR
Sbjct: 124 TAEPKIDGLSLSLRYENGELVQAATRGDGAVGENVTANARTIDTIPTRIK-GAPALLEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKT 246
           GEVY+  +DF ALN    A G K +ANPRNAA+G LR+L+P +ITR   L FF +  G  
Sbjct: 183 GEVYMRHDDFDALNARQTANGGKTFANPRNAAAGSLRQLDP-EITRARPLAFFAYAWGAL 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S   A+ Q++ +++++  GF  N      +    ++++Y +++  R+TL YDIDG+VYKV
Sbjct: 242 SAPLAESQFQAIERLKAFGFDTNPLTTLCDGPQEMIAHYRKIEEQRATLGYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++  LQ +LG R+ +PRW I+HKF  + A TRL DI IQ+GRTG L+PVARL PV +GG 
Sbjct: 302 NDLGLQDRLGFRSTTPRWAIAHKFPAELAWTRLEDITIQVGRTGALSPVARLHPVTVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYIKGLD+ G  +R G+DIRVGD V V RAG+VIPK+ D+ + +R  DA+
Sbjct: 362 VVSNATLHNEDYIKGLDSKGARIREGKDIRVGDWVQVYRAGDVIPKIADVDLGKRPEDAR 421

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + +P+ CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GL
Sbjct: 422 AYVYPTTCPECGSDAIREEGD------AVRRCTGGLICPAQAVEKLKHFVSRAAFDIDGL 475

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+        I  PADIFTL+ R  +   +++N  G+G+ S   L+ +I  +R
Sbjct: 476 GAKQVEQFYGDG----WIAEPADIFTLKTRYGSGMQQLKNREGWGEKSADKLFQAIEDKR 531

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            ISL R IF+LGIRHVG   +  +A++Y S+  F   + +  + +   W  LI V  VG 
Sbjct: 532 KISLSRLIFALGIRHVGEAASNLIAQHYGSWTAFEAAMGHAKSGDGPAWDDLIGVDGVGQ 591

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++AQ++V  +       +++ L+ E+S           S +  K +VFTGTL+K+ R +A
Sbjct: 592 VMAQSLVSTFAQEAERASIDRLVTELSVQDVALPDTEGSPVAGKTVVFTGTLEKMTRAEA 651

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +    +LGA VS  +S KTDI++ G   GSK +KA  LG++ ++E+ +L L+
Sbjct: 652 KARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAADLGIQTLDEDGWLALI 703


>gi|13471538|ref|NP_103104.1| DNA ligase [Mesorhizobium loti MAFF303099]
 gi|75543387|sp|Q98KC4|DNLJ_RHILO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|14022280|dbj|BAB48890.1| DNA ligase [Mesorhizobium loti MAFF303099]
          Length = 734

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 301/732 (41%), Positives = 438/732 (59%), Gaps = 32/732 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P I D+EYDAL+RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELKRLAEEIAGHDRRYHAEDAPTITDAEYDALRRRNLAIEERFPGLVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
            + P+    ++G        KV H++P LSL K +  ED+  FI R  RF+ +  D  I 
Sbjct: 65  EDSPS---RRVGAPPAEGFAKVRHAVPMLSLAKAYTDEDVTDFIERGRRFFDRDKDLDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIE 186
           FT EPKIDG   ++RYE G FV  A RGDG  GED++A +R I  IP  L     P++IE
Sbjct: 122 FTAEPKIDGLSASLRYENGVFVQGATRGDGAVGEDITANLRTIADIPAKLKGSGWPDVIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     A G + Y NPRN A+G LR+ + +   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKARSAAAGGQDYVNPRNTAAGSLRQKDASVTASRNLKFFAYAWGF 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+   A  QYE +QK    GF ++  + +A +   +V+ Y+ ++  RS+L YDIDG+VYK
Sbjct: 242 TTADPAPTQYESVQKFADWGFKISPLMVRAKSVEELVAQYHLIEEQRSSLGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW ++HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAVAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKG D++G  +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGFDSNGLPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP+C S   R++N KTGK  +  RCTG L C+AQ +ERL+HFVSR A +IEG
Sbjct: 422 VPYEFPHTCPVCGSPATREINEKTGKEDSRRRCTGELICAAQAVERLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKI-------------------EN 526
           LG + +D FF     A  I+  ADIFTL+ R+   T  +                   +N
Sbjct: 482 LGAENIDTFFN----AGLIKTAADIFTLRDRRPAVTKALAERREEQARQREAASGKTRKN 537

Query: 527 ILGFGD---VSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           +    D     +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LAK + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAAVLAKTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       V  +GD +  A+ +F+ N RN   ++ LL++V P       + 
Sbjct: 597 VGKETAAAEDPHTVFPSVNGIGDTVIDALCDFFGNERNDDVLDKLLEQVKPKPYIVTVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTGTL+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTIVFTGTLEKMTRSEAKAMAERLGAKVAGSVSAKTDLLVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFL 715
           LGV++++E+ +L
Sbjct: 717 LGVEVIDEDTWL 728


>gi|86749131|ref|YP_485627.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
 gi|123004307|sp|Q2IYJ4|DNLJ_RHOP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86572159|gb|ABD06716.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
          Length = 714

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 305/720 (42%), Positives = 445/720 (61%), Gaps = 27/720 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I  L+  +A+ E   L  EI  H+  YYQ+  P + D+EYDAL+RR +AI   FP+L  +
Sbjct: 11  IATLTKAKAKVEAMRLRLEIERHNSAYYQHDAPTVSDAEYDALRRRLEAIEAKFPELVSA 70

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P   +G        KV H++P LSL   +  +++ +F+ R+ RF +     SI  
Sbjct: 71  ---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVTEFVERVQRFLRLDAVPSI-- 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
             EPKIDG  +++RYE G+ + AA RGDG +GEDV+A +R I  IP  L +  IP   E+
Sbjct: 126 VAEPKIDGLSLSLRYEHGELMRAATRGDGFTGEDVTANVRTIADIPTTLKAKTIPAACEL 185

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L FF +  G+ 
Sbjct: 186 RGEVYMLKQDFLALNKRQEEAGDTVFANPRNSAAGSLRQKDVAITASRPLKFFAYAWGEM 245

Query: 247 SE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           S+  +    Q++ML  ++  GF VN  +    +    +++Y  +   R+ LPYDIDG+VY
Sbjct: 246 SDYPMDEPTQFKMLGWLKQAGFVVNPEITLCTSVDDALAFYRRIGEQRAALPYDIDGVVY 305

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL+PV +G
Sbjct: 306 KVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLQPVTVG 365

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++ NATLHNEDYIKGL   G  +R G DIR GD V+V+RAG+VIP++V +++++R  D
Sbjct: 366 GVVVQNATLHNEDYIKGLGNDGSPLRDGVDIREGDTVVVQRAGDVIPQIVSVVLDKRPAD 425

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A P+ FP  CP+C S   R+         A  RCTG L C AQ +ERLKHFVSR AF+I+
Sbjct: 426 ATPYHFPHKCPVCGSHAAREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDID 479

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q+  F +       ++ PADIFTLQ R   +  K+E+I G+G+ SV NL+ +I+ 
Sbjct: 480 GLGEKQIVLFHERG----WVKEPADIFTLQARN--AALKLEDIEGYGETSVRNLFAAIDA 533

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQ------NFAQEINNIIAHNNDDWLSL 598
           RR I L R IF+LGIRHVG   A+ LA++Y +          A E      + ++ +  L
Sbjct: 534 RRTIELHRLIFALGIRHVGEGNAKLLARHYGTLDAFLAAMRAAAEGQTEEGNTSEAYQDL 593

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +G+++A A+VEF+  PRN+ A++ALL E+   +   +    + +  K +VFTG+L
Sbjct: 594 DNIAGIGEVVAAAVVEFFAEPRNVAALDALLAELKDVLPAEQARRDTAVAGKTVVFTGSL 653

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            K  R +A+    +LGA V+  +S+KTD ++ G + GSKL KA+ LGV ++ E+++L L+
Sbjct: 654 TKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGADAGSKLTKAKDLGVAVLTEDEWLALI 713


>gi|209884394|ref|YP_002288251.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
 gi|254781382|sp|B6JB45|DNLJ_OLICO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209872590|gb|ACI92386.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
          Length = 706

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 305/725 (42%), Positives = 446/725 (61%), Gaps = 33/725 (4%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           K+ L  ++ L+  QA+ E   L  EI+ HD+ YYQ   P + D+ YD+L++R +A+   F
Sbjct: 6   KKPLPSVDQLTKAQAKVEHKRLALEIAMHDERYYQKDAPTVSDAAYDSLRQRLNAVEARF 65

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L  ++ P+    K+G + + +  K+ H++P LSL   ++ E++ +F+ R+ RF     
Sbjct: 66  PELVTTDSPS---QKVGAQPSRAFAKIRHAVPMLSLGNAFSDEEVAEFVARVRRFLNLGA 122

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNI 181
           D  +    EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  +P  L   NI
Sbjct: 123 DEPLAVVAEPKIDGLSLSLRYENGELVNAATRGDGFEGEDVTANVRTIKDVPHKLKGKNI 182

Query: 182 PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFV 240
           P + EVRGEVY+ + DFL LN +    G   +ANPRN+A+G LR+ N     +R L FF 
Sbjct: 183 PAVCEVRGEVYMLREDFLTLNKKQADSGDTIFANPRNSAAGSLRQKNVAITASRPLKFFA 242

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           +  G+ S + A  Q+EM++     GF VN  +        ++ YY E+++ R+ L YDID
Sbjct: 243 YAWGEMSAMPATTQFEMVKWFEKAGFAVNPRMILCRDVEALLRYYREIETERAQLSYDID 302

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKVD    Q +LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL  
Sbjct: 303 GVVYKVDRLDWQTRLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLAA 362

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG ++ NATLHNED I             +DIR GD V+++RAG+VIP+VV ++ ++
Sbjct: 363 VTVGGVVVQNATLHNEDEI-----------ARKDIREGDTVVIQRAGDVIPQVVSVVTDK 411

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R   A+P+SFP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR A
Sbjct: 412 RPKHAKPYSFPHVCPVCGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRLA 465

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+  F+ ++     I  P DIFTL +R   +T K+++  G+GDVSV NL+ 
Sbjct: 466 FDIEGLGDKQIHEFYDAK----LIMHPVDIFTLAKRDAHATDKLKDREGYGDVSVRNLFA 521

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD------ 594
           +I+ RR I L R IF+LGIRHVG   A+ LA++Y + +NF   +    A   ++      
Sbjct: 522 AIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGTIENFRAAMAEAAAAQTEEGNPSEA 581

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVF 654
           +  L  +  VGDI+A A+VEF+   RN+ A+  LL E+   +   +    S +  K +VF
Sbjct: 582 YADLNAIGGVGDIVADAVVEFFAEERNVKALNELLHEIE-VLPAEQVRADSAVAGKTVVF 640

Query: 655 TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TG+L K  R +A+    +LGA VS  +S+KTD ++ G+  GSKL KA++LGV ++ E+++
Sbjct: 641 TGSLTKFTREEAKAQAERLGAKVSGSVSKKTDYVVAGEEAGSKLTKARELGVAVLTEDEW 700

Query: 715 LFLLQ 719
           L L++
Sbjct: 701 LKLIE 705


>gi|163741160|ref|ZP_02148552.1| DNA ligase, NAD-dependent [Phaeobacter gallaeciensis 2.10]
 gi|161385513|gb|EDQ09890.1| DNA ligase, NAD-dependent [Phaeobacter gallaeciensis 2.10]
          Length = 741

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 304/755 (40%), Positives = 446/755 (59%), Gaps = 65/755 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++ ++AR     L+ E+   D  Y+Q   P I D++YDA KR   A+A  FP+LA   D 
Sbjct: 1   MTSDEARARFLLLQDELRVADLAYHQADDPEISDADYDAKKREYRALAEHFPELA---DG 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
              L  +G  +     K+TH+   +SL   ++ ED+R F   + ++      + + +T E
Sbjct: 58  ATALETVGAPVASGFGKITHAQRMMSLGNAFDDEDVRDFDKGLRKYLGLGASDPLAYTAE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYE GK ++AA RGDG  GE+V+   R I  IP+ ++   P ++EVRGEV
Sbjct: 118 PKIDGLSLSLRYENGKLIHAATRGDGAVGENVTENARTIADIPQEIAA-APAVLEVRGEV 176

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEI 249
           Y+S  DF ALND   A G K +ANPRNAA+G LR+LN  +ITR   L FF +  G+ SE 
Sbjct: 177 YMSHEDFAALNDRHAAQGGKTFANPRNAAAGSLRQLN-AEITRSRPLRFFAYSWGELSEP 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A+ Q+E L ++R +GF  N   +  +T   +++ Y  +++ R+TL YDIDG+VYKVD  
Sbjct: 236 LAETQFEALARLREMGFQTNPLTKHCSTTDALIAQYRLIEAQRATLGYDIDGVVYKVDAL 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL+PV +GG +++
Sbjct: 296 ALQARLGFRSTTPRWAIAHKFPAELAWTRLEGIDIQVGRTGALSPVARLQPVTVGGVVVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI GLD+ G+ +R G+DIR+GD V V RAG+VIPK+ D+ +++R  DA PF+
Sbjct: 356 NATLHNEDYIAGLDSKGEEIRDGKDIRIGDWVQVYRAGDVIPKIADVDLSKRPEDAVPFA 415

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP C S  VR+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GLG +
Sbjct: 416 FPAACPECGSDAVREEGD------AVRRCTGGLICPAQAVEKLKHFVSRKAFDIDGLGAK 469

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++ F+   D   +I+ PADIFTLQ R   +  K++N  G+G+ S  NL+ +I ++R I 
Sbjct: 470 QIEAFYG--DAVLAIKTPADIFTLQARDAKTLAKLKNRDGWGETSAANLFAAIEEKRRIE 527

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN------------------------ 585
           L R IF LGIRHVG   AR LA +Y  +   A  ++                        
Sbjct: 528 LARLIFGLGIRHVGEVGARDLALHYADWDAMAAAVDTARPAALAQRAADEAEDRERVAAA 587

Query: 586 -------------------NIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVE 626
                              N+ +     W  L  +  +G  +  ++ + + N     A +
Sbjct: 588 QENRRARIKEARDRAVATLNVPSEARAAWDDLTGIDGIGATLGVSLSDAFANTEERAAFD 647

Query: 627 AL---LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
           AL   L  + P   +++    S +    +VFTGTL+K+ R +A+     LGA V+  +S+
Sbjct: 648 ALRGHLDIIPPEAPQND----SPVTGLTVVFTGTLEKMTRAEAKARAEGLGAKVAGSVSK 703

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           KTDI++ G   GSK +KA+ LGV+I++E+ +L L+
Sbjct: 704 KTDILVAGPGAGSKEQKARDLGVRILDEDGWLELI 738


>gi|319782858|ref|YP_004142334.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168746|gb|ADV12284.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 734

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 299/732 (40%), Positives = 441/732 (60%), Gaps = 32/732 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P+I D+EYDAL RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELKRLAEEIAEHDRRYHTEDAPVITDAEYDALARRNLAIEERFPALVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
            + P+    ++G        KV H++P LSL K +  +D+  FI R  RF+ +  +  I 
Sbjct: 65  EDSPS---LRVGAAPAEGFTKVRHAVPMLSLAKAYTDDDVTDFIERGRRFFDRDKELDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIE 186
           FT EPKIDG   ++RYE G FV  A RG+G  GED++A ++ I  IP  L     PE IE
Sbjct: 122 FTAEPKIDGLSASLRYENGVFVQGATRGNGAVGEDITANLKTIADIPAKLKGSGWPETIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     AVG + Y NPRN A+G LR+ +P+   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKQRSAAVGGQDYVNPRNTAAGSLRQKDPSVTASRNLKFFAYAWGY 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+   A  QY+ +QK    GF ++  + +A +   ++++Y+ ++  RS L YDIDG+VYK
Sbjct: 242 TTADPAPTQYDSVQKFAEWGFKISPLMVRAKSAEELIAHYHRIEEQRSALGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW I+HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAIAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKGLD++G+ +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGLDSTGQPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CPIC S   R++N KTGK  +  RCTG L C AQ +E L+HFVSR A +IEG
Sbjct: 422 VPYEFPHTCPICGSPATREINEKTGKEDSRRRCTGELICPAQAVEGLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKI-------------------EN 526
           LG + +D FF     A  IR  ADIFTL+ R+   T  +                   +N
Sbjct: 482 LGAENIDTFFN----AGLIRTAADIFTLRDRRPAVTRALAERREEQARQREAASGKTRKN 537

Query: 527 ILGFGDVS---VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           +    D +   +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LA+ + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAAVLARTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       V  +GD +  A+ +F+ N RN   ++ALL++V P       + 
Sbjct: 597 VGKETAAAEDPHSVFPSVNGIGDTVIDALRDFFGNERNDDVLDALLRQVKPKPYIVNVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTG+L+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTVVFTGSLEKMTRSEAKAMAERLGAKVAGSVSAKTDLVVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFL 715
           LG+++++E+ +L
Sbjct: 717 LGIEVIDEDAWL 728


>gi|163736311|ref|ZP_02143730.1| DNA ligase, NAD-dependent [Phaeobacter gallaeciensis BS107]
 gi|161390181|gb|EDQ14531.1| DNA ligase, NAD-dependent [Phaeobacter gallaeciensis BS107]
          Length = 752

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 305/758 (40%), Positives = 448/758 (59%), Gaps = 65/758 (8%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +++L+ ++AR     L+ E+   D  Y+Q   P I D++YDA KR   A+A  FP+LA  
Sbjct: 9   LKSLTSDEARARFLLLQDELRAADLAYHQADDPEISDADYDAKKREYRALAEHFPELA-- 66

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            D    L  +G  +     K+TH+   +SL   ++ ED+R F   + ++      + + +
Sbjct: 67  -DGATALETVGAPVASGFGKITHAQRMMSLGNAFDDEDVRDFDKGLRKYLGLGASDPLAY 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK ++AA RGDG  GE+V+   R I  IP+ ++   P ++EVR
Sbjct: 126 TAEPKIDGLSLSLRYENGKLIHAATRGDGAVGENVTENARTIADIPQEIAA-APAVLEVR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKT 246
           GEVY+S  DF ALND   A G K +ANPRNAA+G LR+LN  +ITR   L FF +  G+ 
Sbjct: 185 GEVYMSHEDFAALNDRHAAQGGKTFANPRNAAAGSLRQLN-AEITRSRPLRFFAYSWGEL 243

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A+ Q+E L ++R +GF  N   +  +T   +++ Y  +++ R+TL YDIDG+VYKV
Sbjct: 244 SEPLAETQFEALTRLREMGFQTNPLTKYCSTTDALIAQYRLIEAQRATLGYDIDGVVYKV 303

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D  +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL+PV +GG 
Sbjct: 304 DALALQARLGFRSTTPRWAIAHKFPAELAWTRLEGIDIQVGRTGALSPVARLQPVTVGGV 363

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYI GLD+ G+ +R G+DIR+GD V V RAG+VIPK+ D+ + +R  DA 
Sbjct: 364 VVSNATLHNEDYIAGLDSKGEEIRDGKDIRIGDWVQVYRAGDVIPKIADVDLPKRPEDAV 423

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF+FP+ CP C S  VR+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GL
Sbjct: 424 PFAFPAACPECGSDAVREEGD------AVRRCTGGLICPAQAVEKLKHFVSRKAFDIDGL 477

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+   D   +I+ PADIFTLQ R   +  K++N  G+G+ S  NL+ +I ++R
Sbjct: 478 GAKQIEAFYG--DAVLTIKTPADIFTLQARDAKTLAKLKNRDGWGETSAANLFAAIEEKR 535

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN--------------------- 585
            I L R IF LGIRHVG   AR LA +Y  +   A  ++                     
Sbjct: 536 RIELARLIFGLGIRHVGEVGARDLALHYADWDAMAAAVDTARPAALAQRAADEAEDRERV 595

Query: 586 ----------------------NIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNIC 623
                                 N+ +     W  L  +  +G  +  ++ + + N     
Sbjct: 596 AAAQENRRARIKEARDRAVATLNVPSEARAAWDDLTGIDGIGATLGVSLSDAFANTEERA 655

Query: 624 AVEAL---LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
           A +AL   L  + P   +++    S +    +VFTGTL+K+ R +A+     LGA V+  
Sbjct: 656 AFDALRGHLDIIPPEAPQND----SPVTGLTVVFTGTLEKMTRAEAKARAEGLGAKVAGS 711

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +S+KTDI++ G   GSK +KA+ LGV+I++E+ +L L+
Sbjct: 712 VSKKTDILVAGPGAGSKEQKARDLGVRILDEDGWLELI 749


>gi|254440003|ref|ZP_05053497.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
 gi|198255449|gb|EDY79763.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
          Length = 706

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 297/712 (41%), Positives = 440/712 (61%), Gaps = 15/712 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           IE L+ ++A +EL+ L   ++  +  Y+Q   P I D++YDALK R   I   F DL R 
Sbjct: 7   IENLTKDEAAQELARLSALLAQANAEYHQADAPRIPDADYDALKLRNAMIEARFSDLKRR 66

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+     +G        KV H++  LSL   +  +D+ +F   + +F   +  + + F
Sbjct: 67  DSPS---ETVGATPADGFGKVPHALRMLSLGNAFTDDDVTEFDKSVRKFLGLETGD-LAF 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V AA RGDG  GE+V+A  R I  +P+VL L+ P+I+EVR
Sbjct: 123 TAEPKIDGLSLSLRYENGKLVQAATRGDGAVGENVTANARTIKDVPQVL-LDAPKILEVR 181

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+S +DF ALN     VG K +ANPRNAA+G LR+L+ +   +R L FF +  G+ S
Sbjct: 182 GEVYMSHSDFAALNTRQSNVGSKTFANPRNAAAGSLRQLDASITKSRPLKFFAYAWGEVS 241

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
              A  Q   + +++ LGF  N   +   +   ++++Y +++  R+TL YDIDG+VYKVD
Sbjct: 242 APLADTQSGAIARLKTLGFQTNPLTKICASPSEMIAHYRDIEMQRATLGYDIDGVVYKVD 301

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + SLQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG +
Sbjct: 302 DLSLQRRLGFRSTTPRWAIAHKFPAELAWTTLDAIDIQVGRTGALSPVARLSPVTVGGVV 361

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           + NATLHNEDYI G    G  +RGG+DIRVGD V + RAG+VIPKV D+ +++R  +  P
Sbjct: 362 VANATLHNEDYIAGRGNKGDDIRGGKDIRVGDWVQIYRAGDVIPKVADVDLSKRLGETAP 421

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP+ CP C S  VR+     G +V   RCTGGL C AQ +E+LKHFVSR AF+I+GLG
Sbjct: 422 FDFPTTCPKCGSDAVRE----EGDVV--RRCTGGLICPAQAVEKLKHFVSRAAFDIDGLG 475

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            +Q++ F+   D   +++ PADIFTL  R   S TK+ N  G+GD SV  L+ +++++R 
Sbjct: 476 AKQIEAFYN--DDQLAVKEPADIFTLGARDMGSLTKLANRDGWGDTSVKKLWQAVDEKRE 533

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           I + R IF+LGIRHVG   +  LA +Y ++  F   +          W  L+ +  VG +
Sbjct: 534 IPVARLIFALGIRHVGENASNLLAIHYGTWSTFEDAMTQASVGEGAGWDDLLGIDGVGAV 593

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +A ++V  +       +++ L+ ++ P      ++ +S +  K +VFTG+L+K+ R +A+
Sbjct: 594 MAASVVTTFHQSAERASIDRLVAQLRPQDSARPRS-NSPVAGKTVVFTGSLEKMTRAEAK 652

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
                LGA VS  +S KTD++I G   GSK +KA  LG++ M+E+ +L L +
Sbjct: 653 ARAESLGAKVSGSVSAKTDLLIAGPGAGSKAKKATDLGIETMDEDGWLALTK 704


>gi|126726435|ref|ZP_01742276.1| DNA ligase [Rhodobacterales bacterium HTCC2150]
 gi|126704298|gb|EBA03390.1| DNA ligase [Rhodobacterales bacterium HTCC2150]
          Length = 705

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 298/712 (41%), Positives = 439/712 (61%), Gaps = 18/712 (2%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +++ +AR EL  L + I+  +  Y+    P I D+EYD L+R    I  AFPDL R++ P
Sbjct: 8   MTMAEARSELKRLAKVIAAANSSYHTADAPEISDAEYDRLRRLNSEIEAAFPDLKRADSP 67

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +   + +G E+  +  KV H +  LSL   +   ++  F+ R+  +        + FT E
Sbjct: 68  S---DNVGAEVAEAFSKVKHDVRMLSLGNAFEDTEVDDFVGRVRSYLGHV--GPLAFTAE 122

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYE G+ V AA RGDG +GE+V+   R I  IP  L  N P+++EVRGEV
Sbjct: 123 PKIDGLSLSLRYENGELVQAATRGDGETGENVTHSARTISNIPHHLD-NAPDLLEVRGEV 181

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEI 249
           Y+  +DF ALN+  I  G K +ANPRNAA+G LR+L+  +ITR   L FF +  G  SE 
Sbjct: 182 YMRHDDFAALNERQIEKGEKTFANPRNAAAGSLRQLD-ANITRSRPLAFFAYAWGALSEP 240

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A  Q   + ++R LGF  N+  +   +   ++++Y  ++  RSTL YDIDG+VYKVD+ 
Sbjct: 241 LATTQLAAVNRLRSLGFQTNDLTKLCASAQELITHYKSIEEQRSTLGYDIDGVVYKVDDL 300

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL+PV +GG +++
Sbjct: 301 ELQRRLGFRSTTPRWAIAHKFPAELAWTRLRGIDIQVGRTGALSPVARLDPVTVGGVVVS 360

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI+G    G+ +R G+D RVGD V V RAG+VIPK+ D+ + ER  DA P+ 
Sbjct: 361 NATLHNEDYIQGRGNKGEEIRDGKDFRVGDWVQVYRAGDVIPKLADVNLAERPDDAAPYE 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP CQS  +RD         A  RC+GGL C AQ +E+LKHFVSR  F+I+GLG +
Sbjct: 421 FPTICPECQSPAIRDDGD------AVRRCSGGLICPAQAIEKLKHFVSRGCFDIDGLGNK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTK-IENILGFGDVSVTNLYDSINKRRNI 548
           Q++ FF   DP   ++ PADIFTLQ R   +  K ++N  G+GD S   L+ +I+++RNI
Sbjct: 475 QVEAFFG--DPELPVKEPADIFTLQVRDADNGLKRLKNRDGWGDKSTQKLFAAIDEKRNI 532

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
            L R IFSLGIRHVG   A  LA+++ SY  F   ++     +++ +  LI +  VG++ 
Sbjct: 533 PLNRLIFSLGIRHVGEAAANLLARHFSSYDKFIIAMDEATDRDSNAYQDLIAIDGVGEVF 592

Query: 609 AQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
           A ++V  +       +++ L + ++          +S +  K +VFTGTL+++ R +A+ 
Sbjct: 593 ANSLVTAFSATSERASIDRLTQHLNIQDVVQADTGNSAVAGKIVVFTGTLEQMSRAEAKA 652

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
                GA VS  +S+KTDI++ G   GSK  KA  LG+ +++E  +L L+ +
Sbjct: 653 QAEAAGAKVSGSVSKKTDILVAGPGAGSKATKAAALGITVIDEAAWLALIAE 704


>gi|110634347|ref|YP_674555.1| DNA ligase, NAD-dependent [Mesorhizobium sp. BNC1]
 gi|123162160|sp|Q11GT5|DNLJ_MESSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110285331|gb|ABG63390.1| DNA ligase, NAD-dependent [Chelativorans sp. BNC1]
          Length = 703

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 304/712 (42%), Positives = 449/712 (63%), Gaps = 22/712 (3%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP++ L+ EQA+ EL+ L QEI  HD  YY    P + D+EYDAL+RR  AI  AFP+L 
Sbjct: 6   IPVDELTEEQAKDELARLAQEIGRHDRLYYSEDAPEVSDAEYDALRRRNLAIEQAFPNLI 65

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P+    +IG        KV H +P LSL+  +  +D+  F+ R+ RF + +    I
Sbjct: 66  RADSPS---KRIGAPAVEKFEKVRHKVPMLSLDNAFTDDDVVDFVARVRRFLKMEPHAPI 122

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T EPKIDG  ++IRYE G+ V AA RGDG  GE+V+A  RA+  IP VLS + PEI+E
Sbjct: 123 AMTAEPKIDGLSLSIRYENGRLVSAATRGDGQVGENVTANARAVADIPNVLSGDFPEILE 182

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++  DFLALN+   A G++ Y NPRN A+G LR+L+ +    R L FF +  G+
Sbjct: 183 VRGEVYMTHRDFLALNERQRAEGKQTYVNPRNTAAGSLRQLDASITAARPLKFFAYAWGE 242

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+ ++ Q  M++ ++  GF  N  +    T   ++ +Y+ ++  R+TL YDIDG+VYK
Sbjct: 243 VSEMPSQTQMGMVEALKSYGFRTNKLMCLCETARELLEHYHAIEERRATLGYDIDGVVYK 302

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++ +LQ++LG  +RSPRW I+HKFA ++A T L DIDIQ+GRTG LTPVARLEPV +GG
Sbjct: 303 VNDLALQQRLGYVSRSPRWAIAHKFAAEKAFTILRDIDIQVGRTGALTPVARLEPVTVGG 362

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++TNATLHN + I+ L            I++GD V V+RAG+VIP+++    + R  DA
Sbjct: 363 VVVTNATLHNAEEIERL-----------GIKIGDTVQVQRAGDVIPQILGYAEDRRPADA 411

Query: 426 QPFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           + F FPS CP   ++ VVRD     G+ V   RC+G  AC  Q++E L+ FVSR AF+IE
Sbjct: 412 KEFVFPSVCPCELKTPVVRDSTAGGGEGV-VRRCSGEFACPFQRIEHLRLFVSRRAFDIE 470

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF+  DP   ++ PADIFTL  R   +  K+++  G+G VS  NL+ +I  
Sbjct: 471 GLGEKQIEFFFR--DPDLPVKSPADIFTLAERDAQNIKKLKDKEGWGTVSAGNLFAAIEA 528

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R I L+R I+ LGIRHVG   A +LA+ Y S++ F      I   +      +  +  +
Sbjct: 529 KRTIPLDRMIYGLGIRHVGERTAVTLARGYGSWKAFHDSALAIAGGDLSAREEMDALEDI 588

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS-SEIENKKLVFTGTLQKIQR 663
           GD +  AI  ++    N   VEAL  +V  ++   E+ V+ S +  K +VFTG L+++ R
Sbjct: 589 GDAVIDAIATYFAEEHNCRLVEALAAQV--NVLEAERPVADSPVAGKTIVFTGALERMSR 646

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            +A++   +LGA V+  +S KTD+++ G   GSKL+KA +LG+++++E+ + 
Sbjct: 647 DEAKDMAERLGAKVAGSVSSKTDLVVAGPGAGSKLKKAAELGIEVIDEDMWF 698


>gi|83953544|ref|ZP_00962265.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
 gi|83841489|gb|EAP80658.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
          Length = 706

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 295/712 (41%), Positives = 434/712 (60%), Gaps = 17/712 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ LS E+A+ EL+ L   +   +  Y+    P + D+EYD LKRR  AI   FP L R+
Sbjct: 7   LQELSEEEAKAELARLADLLGRANAAYHTQDAPDLSDAEYDRLKRRNQAIEERFPRLKRA 66

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P+   +K+G        KV H +  LSL   +  ED+  F  RI ++        + F
Sbjct: 67  DSPS---DKVGAAPAEGFGKVRHDVAMLSLGNAFEDEDVVDFDARIRKYLGLPSGTPLAF 123

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I TIP  +    P ++EVR
Sbjct: 124 TAEPKIDGLSLSLRYENGELVQAATRGDGAVGENVTANARTIDTIPTRIQ-GAPALLEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKT 246
           GEVY+  +DF ALN    A G K +ANPRNAA+G LR+L+  +ITR   L FF +  G  
Sbjct: 183 GEVYMRHHDFDALNARQTANGGKTFANPRNAAAGSLRQLD-AEITRARPLAFFAYAWGAL 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S   A  Q+  ++++   GF  N      +    ++++Y +++  R+TL YDIDG+VYKV
Sbjct: 242 SAPLADTQFHAIERLSAFGFDTNPLTTLCDGPQEMIAHYRKIEEQRATLGYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++ +LQ +LG R+ +PRW I+HKF  + A TRL DI IQ+GRTG L+PVARL+PV +GG 
Sbjct: 302 NDLALQDRLGFRSTTPRWAIAHKFPAELAWTRLEDITIQVGRTGALSPVARLKPVTVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYIKGLD+ G  +R G+DIRVGD V V RAG+VIPK+ D+ + +R  D++
Sbjct: 362 VVSNATLHNEDYIKGLDSKGASIRDGKDIRVGDWVQVYRAGDVIPKIADVDLGKRPEDSE 421

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + +P+ CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GL
Sbjct: 422 AYVYPTTCPECGSDAIREEGD------AVRRCTGGLICPAQAVEKLKHFVSRAAFDIDGL 475

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+        I  PADIFTL+ R  +   +++N  G+G+ S   L+ +I  +R
Sbjct: 476 GAKQVEQFYADG----WIAEPADIFTLKARYGSGMQQLKNREGWGEKSADKLFQAIEDKR 531

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I L R IF+LGIRHVG   +  +A++Y S+  F   + +  + +   W  LI V  VG 
Sbjct: 532 KIPLSRLIFALGIRHVGEAASNLIAQHYGSWTAFEAAMGHAKSGDGPAWDDLIGVDGVGQ 591

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++AQ++V  +       +++ L+ E+S           S +  K +VFTGTL+K+ R +A
Sbjct: 592 VMAQSLVSTFAQEAERASIDRLVTELSVQDVARPDTEGSPVAGKTVVFTGTLEKMTRAEA 651

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +    +LGA VS  +S KTDI++ G   GSK +KA  LG++ ++E+ +L L+
Sbjct: 652 KARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAADLGIQTLDEDGWLALI 703


>gi|312114833|ref|YP_004012429.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
 gi|311219962|gb|ADP71330.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
          Length = 777

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 306/739 (41%), Positives = 447/739 (60%), Gaps = 51/739 (6%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E LS E A+ E  +L  EI+ HD   YQ + P I D+EYD L+ R +A+  AFP L    
Sbjct: 57  EHLSAEDAKDEHDALAAEIARHD-LLYQDAAPEISDAEYDRLRLRLNALEAAFPSLI--- 112

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P  P   +G   +    KV H++  LSL  +++ ED+  F  R+ RF +   D ++  T
Sbjct: 113 TPESPSQTVGATPSEKFAKVRHTVRMLSLGNVFSDEDVADFAGRVRRFLKFAPDEALDVT 172

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVR 188
            E KIDG  +++RYE G+   AA RGDG  GEDV+A +R I  IP+V+  N +P + EVR
Sbjct: 173 AEMKIDGLSVSLRYENGRLAVAATRGDGSEGEDVTANVRTIADIPQVIRANDVPAVFEVR 232

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF------VH 241
           GEVY+S  DF ALN+  +  G + +ANPRNAA+G LR+L+P     R L FF      V 
Sbjct: 233 GEVYMSHADFQALNERQVGKGGRMFANPRNAAAGSLRQLDPAITAARPLRFFAWGWGEVR 292

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
           G G+ S + A   + +LQ +   GFP+   V    +   +++ Y  ++  R++L YDIDG
Sbjct: 293 GWGEASALPADTNFGVLQAIHGWGFPLPP-VEICRSVEEMLAVYRAIEMKRASLGYDIDG 351

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKV+   LQ++LG  +R+PRW  +HKF+ ++A+T L  IDIQ+GRTG LTPVA+L PV
Sbjct: 352 VVYKVNRLDLQERLGFISRTPRWATAHKFSAEKATTVLNGIDIQVGRTGALTPVAKLAPV 411

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG ++ NATLHNED I+            +D+R+GD V+V+RAG+VIP+++  ++ +R
Sbjct: 412 TVGGVVVQNATLHNEDEIRR-----------KDVRIGDTVIVQRAGDVIPQILGPVLEQR 460

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
             DA  F FP+ CP+C S  VR+ +PKTGK+ A  RCTGGL C+AQ +ERL+HFVSR AF
Sbjct: 461 PADAVEFVFPTLCPVCGSHAVRETHPKTGKVDAVRRCTGGLICAAQAVERLRHFVSRHAF 520

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG++ +  FF        I+ PADIFT+  R      K+    G+G  S  NL+ +
Sbjct: 521 DIEGLGEKNIQAFFDEG----RIKAPADIFTMAARDGVDLPKLSEKEGWGAQSAANLFAA 576

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF--------AQEINN-----II 588
           I  RR ISLERFIF+LGIRHVG   A+ LAK + S            A E+       + 
Sbjct: 577 IEARRTISLERFIFALGIRHVGETTAKLLAKTFGSLDALRAAMAEPDAAELRPGDELLLE 636

Query: 589 AHNNDDWLSLIRVPL---------VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRH 639
           + + +D  SL R  +         +GD++AQ+IV+F+  P N  AV+AL +E++    + 
Sbjct: 637 SASGEDKRSLHRAIILAKLNEIDGIGDVVAQSIVDFFDEPHNREAVDALRRELTIEAYKP 696

Query: 640 EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLE 699
           ++ VSS +    +VFTG L++  R +A+    + GA V+  +S+ T  ++ G   GSKL+
Sbjct: 697 DQ-VSSLLAGATVVFTGKLERFTRDEAKAQAERFGAKVAGSVSKATTYLVAGPGAGSKLK 755

Query: 700 KAQQLGVKIMNEEQFLFLL 718
           KA+ LGVK+M E+++L ++
Sbjct: 756 KAEDLGVKVMTEDEWLEMI 774


>gi|254510866|ref|ZP_05122933.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium KLH11]
 gi|221534577|gb|EEE37565.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium KLH11]
          Length = 750

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 301/752 (40%), Positives = 440/752 (58%), Gaps = 59/752 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+ E A++EL+ L  E+   +  Y+    P + D +YDALKRR   I   FPDL R++ P
Sbjct: 10  LTEEDAQQELARLAAELLRANQLYHAEDAPELSDGDYDALKRRNAEIEARFPDLKRTDSP 69

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    ++G   +    KV+H++  +SL   ++  D+  F   I ++     D  + FT E
Sbjct: 70  S---EQVGARPSDGFAKVSHAMRMMSLGNAFDDTDIVDFDRSIRKYLGLTGDAPLAFTAE 126

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYE+G+ V AA RGDG  GE+V+A  R +  IP  ++   P+++EVRGEV
Sbjct: 127 PKIDGLSLSLRYEQGELVQAATRGDGEVGENVTANARTVADIPHRIA-GAPDVLEVRGEV 185

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEI 249
           Y+S  DF ALN      G K +ANPRNAA+G LR+L+ ++ITR   L FF +  G+ S  
Sbjct: 186 YMSHQDFEALNTRQAETGGKTFANPRNAAAGSLRQLD-SEITRARPLKFFAYAWGELSAP 244

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A+ Q   +Q+++  GF +N   R   T   ++ +Y  +++ R+TL YDIDG+VYKVD+ 
Sbjct: 245 LAETQMGAIQRLKAFGFQINALTRLCATPSQMLDHYRRIEAQRATLGYDIDGVVYKVDDL 304

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG +++
Sbjct: 305 GLQSRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLHPVTVGGVVVS 364

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI G DA G V+R G+DIRVGD V V RAG+VIPK+ D+ +++R  DAQP++
Sbjct: 365 NATLHNEDYIAGRDAKGGVIRDGKDIRVGDWVQVYRAGDVIPKLADVDLSKRPADAQPYA 424

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP C S   R+         A  RCTGGL C AQ +E+LKHFVSR AF+IEGLG +
Sbjct: 425 FPTTCPECGSDATREEGD------AVRRCTGGLICPAQAVEKLKHFVSRKAFDIEGLGAK 478

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++ F+   DP   I  PADIFTLQ R   +  +++N  G+GD S  NL+++I  +R I 
Sbjct: 479 QIEMFYG--DPVLPINTPADIFTLQERDTKALARLKNRDGWGDTSANNLFEAIEDKRKIP 536

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQ-------------------NFAQEINNIIAH 590
             R +F+LGIRHVG   A+ LA +Y  +                    + A+E+  I A 
Sbjct: 537 FARLLFALGIRHVGEVGAKDLALFYRDWDVMAASIDTARPAALAQRAADEAEEVERIAAA 596

Query: 591 NN------------------------DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVE 626
           +                           W  LI +  +G  +  ++ + + N     A +
Sbjct: 597 DEGRRAKLKDARDSVIAGREVPADAASAWADLIGIDGIGATLGLSLSDAFANADERAAFD 656

Query: 627 ALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTD 686
            L K +   +        S +  K +VFTGTL+K+ R +A+     LGA VS  +S+KTD
Sbjct: 657 TLRKHLE-IVAPDAPASDSPVAGKTVVFTGTLEKMTRAEAKARAEALGAKVSGSVSQKTD 715

Query: 687 IIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +++ G   GSK +KA  LG++ ++E+ +L L+
Sbjct: 716 LLVAGPGAGSKAKKAADLGIRTLDEDGWLQLI 747


>gi|254476645|ref|ZP_05090031.1| DNA ligase, NAD-dependent [Ruegeria sp. R11]
 gi|214030888|gb|EEB71723.1| DNA ligase, NAD-dependent [Ruegeria sp. R11]
          Length = 783

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 303/758 (39%), Positives = 452/758 (59%), Gaps = 65/758 (8%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           ++L++E+AR     L+ E+   D  Y+Q   P I D++YDA KR+  A+A AFP+LA   
Sbjct: 41  QSLTLEEARPLFEQLQDELRAADLAYHQKDAPEISDADYDAKKRQYRALAEAFPNLAAEA 100

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
                L+ +G  +     K+TH+   +SL   ++ +D+  F   + ++        + +T
Sbjct: 101 TE---LDTVGAPVASGFGKITHAQRMMSLGNAFDDDDVADFDKGLRKYLGLSASEPLAYT 157

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  +++RYE G  V+AA RGDG  GE+V+A  R I  IP+ +  N P I+EVRG
Sbjct: 158 AEPKIDGLSLSLRYENGTLVHAATRGDGAVGENVTANARTIDDIPQEIP-NAPAILEVRG 216

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTS 247
           EVY+S  DF ALN+   A G K +ANPRNAA+G LR+L+  +ITR   L FF +  G+ S
Sbjct: 217 EVYMSHEDFAALNERHEARGGKTFANPRNAAAGSLRQLD-AEITRARPLRFFAYSWGELS 275

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E   + Q++ L ++R +GF  N   R   +   ++++Y +++  R+TL YDIDG+VYKVD
Sbjct: 276 EPLGETQFDALARLRKMGFQTNPLTRHCTSVADLIAHYRQIEEQRATLGYDIDGVVYKVD 335

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
             +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL+PV +GG +
Sbjct: 336 ALALQDRLGFRSTTPRWAIAHKFPAELAWTRLEGIDIQVGRTGALSPVARLQPVTVGGVV 395

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHNEDYI GLD+ G+ +R G+DIR+GD V V RAG+VIPK+ D+ +++R   A+ 
Sbjct: 396 VSNATLHNEDYIAGLDSKGEEIRDGKDIRIGDWVQVYRAGDVIPKIADVDLSKRPDGAEA 455

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           ++FP+ CP C S  VR+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GLG
Sbjct: 456 YAFPTTCPQCDSPAVREEGD------AVRRCTGGLICPAQAVEKLKHFVSRKAFDIDGLG 509

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            +Q++ F+  E    +I+ PADIF+LQ R   + TK++N  G+G+ S  NL+ +I  +R 
Sbjct: 510 AKQIEMFYGDE--TLAIKTPADIFSLQARDAQNLTKLKNRDGWGETSAANLFAAIEDKRE 567

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINN----IIAHNNDD--------- 594
           I+L R IF LGIRHVG   AR LA +Y+ +   A+ ++      +AH   D         
Sbjct: 568 IALARLIFGLGIRHVGEVGARDLALHYMDWDAMAEAVDTARPAALAHRAADEAEDAERIA 627

Query: 595 ------------------------------WLSLIRVPLVGDIIAQAIVEFYQNPRNICA 624
                                         W  L  +  +G  +  ++ + + N     A
Sbjct: 628 AAQANRRARIKEVRDSAIAQCDVPPAARAAWEDLTGIDGIGATLGLSLSDAFANADERAA 687

Query: 625 VEAL---LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL 681
            +AL   L  V P   + +    S +  K +VFTGTL+K+ R +A+     LGA V+  +
Sbjct: 688 FDALRAYLTIVPPEAPQKD----SPVAGKTVVFTGTLEKMTRAEAKARAEGLGAKVAGSV 743

Query: 682 SRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           S+KTDI++ G   GSK +KA+ LG++I++E+ +L L++
Sbjct: 744 SKKTDILVAGPGAGSKEQKARDLGIRILDEDGWLTLIE 781


>gi|163747147|ref|ZP_02154503.1| DNA ligase, NAD-dependent [Oceanibulbus indolifex HEL-45]
 gi|161379708|gb|EDQ04121.1| DNA ligase, NAD-dependent [Oceanibulbus indolifex HEL-45]
          Length = 685

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 292/687 (42%), Positives = 422/687 (61%), Gaps = 17/687 (2%)

Query: 35  YYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIP 94
           Y+    P I D+EYDALKRR  AI   +PDL R + P     ++G  +     KV H++ 
Sbjct: 12  YHTEDAPEISDAEYDALKRRNAAIEARYPDLKRDDSPT---EQVGAPVAEGFGKVRHAVS 68

Query: 95  TLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALR 154
            LSL   ++ E++  F  RI ++   + D  + +T EPKIDG  +++RYE G  V AA R
Sbjct: 69  MLSLANAFDAEEVTDFDARIRKYLGVEADAPLAYTAEPKIDGLSLSLRYENGLLVQAATR 128

Query: 155 GDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYA 214
           GDG  GE+V+A  R I  IP  +    P+++EVRGEVY+S  DF ALN+     G K +A
Sbjct: 129 GDGAVGENVTANARTIQDIPHQID-EAPDLLEVRGEVYMSHADFAALNERQAERGGKTFA 187

Query: 215 NPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGV 272
           NPRNAA+G LR+L+  +ITR   L FF +  G  S   A+ Q   + ++  LGF  N   
Sbjct: 188 NPRNAAAGSLRQLD-AEITRARPLRFFAYAWGALSAPLAETQKGAIDRLAKLGFVTNPLT 246

Query: 273 RQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAE 332
              +    +V++Y ++++ R+TL YDIDG+VYKVD+ +LQ++LG R+ +PRW I+HKFA 
Sbjct: 247 ALCDGPSDMVAHYAKIEAQRATLGYDIDGVVYKVDDLALQERLGFRSTTPRWAIAHKFAA 306

Query: 333 KQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGG 392
           + A TRL  IDIQ+GRTG L+PVARL+PV +GG +++NATLHNEDYIKGLD+ G  +RGG
Sbjct: 307 ELAWTRLEGIDIQVGRTGALSPVARLQPVTVGGVVVSNATLHNEDYIKGLDSKGAEIRGG 366

Query: 393 RDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKL 452
           +DIRVGD V + RAG+VIPKV D+ +++R  DA PF FPS CP C S  +R+        
Sbjct: 367 KDIRVGDWVQIYRAGDVIPKVADVDLSKRPKDAAPFVFPSVCPECGSDAIREPGD----- 421

Query: 453 VAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFT 512
            A  RCTGGL C AQ +E+LKHFV+R AF+I+GLG +Q++ F+        I  PADIFT
Sbjct: 422 -AVRRCTGGLICPAQAVEKLKHFVARGAFDIDGLGAKQVEQFYHDG----WIAEPADIFT 476

Query: 513 LQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAK 572
           L+ R      +++N  G+G  S  NL+ +I  +R I + R IF+LGIRHVG   +  +A 
Sbjct: 477 LKERFGNGVQQLKNREGWGPKSADNLFQAIKDKRKIPMSRLIFALGIRHVGDAASNLIAL 536

Query: 573 YYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV 632
           +Y  + +F   +          W  LI V  VG ++A ++V  +       +++ L+  +
Sbjct: 537 HYGDWDSFETAMAEARGLEGPAWDDLIAVDGVGSVMAGSLVSAFAQEAERASIDRLVAHL 596

Query: 633 SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGD 692
           +           S +  K +VFTGTL+K+ R +A+    +LGA VS  +S KTDI++ G 
Sbjct: 597 TVVPTERPDTEGSPVAGKTVVFTGTLEKMSRAEAKARAERLGAKVSGSVSAKTDILVAGP 656

Query: 693 NPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             GSK +KA  LG++ ++E+ +L L++
Sbjct: 657 GAGSKAKKAADLGIETLDEDGWLALIE 683


>gi|84686905|ref|ZP_01014789.1| DNA ligase, NAD-dependent [Maritimibacter alkaliphilus HTCC2654]
 gi|84665102|gb|EAQ11582.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium HTCC2654]
          Length = 710

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 296/720 (41%), Positives = 431/720 (59%), Gaps = 15/720 (2%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M       +E L    AR EL+ L   ++  +  Y+    P + D+ YDA KRR   I  
Sbjct: 1   MTGHSETAVEKLDEAGARAELARLADLLASANTAYHTEDAPEMSDAAYDAAKRRNAEIEA 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L R + P    +++G        KV H +  LSL   ++ + +  F  ++  F   
Sbjct: 61  RFPELKRDDSPT---DQVGAAPAEGFSKVRHRVRMLSLANAFDDDHVIDFDRQVRAFLGF 117

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             +  + FT EPKIDG  +++RYE G+ + AA RGDG  GE+V+A  R I  IP+ LS  
Sbjct: 118 SAEEPLAFTAEPKIDGLSLSLRYENGELMQAATRGDGGEGENVTANARTIDDIPQRLS-G 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNF 238
            P+++EVRGEVY+S +DF  LN+   A G K +ANPRNAA+G LR+L+ + IT  R L F
Sbjct: 177 APDVLEVRGEVYMSHDDFARLNESQSAKGGKTFANPRNAAAGSLRQLD-SRITEARPLRF 235

Query: 239 FVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
           + +  G+ S+  A  Q   ++K+  LGF  N   +   T   +  +Y+ ++  R+TL YD
Sbjct: 236 YAYAWGELSDPLADTQMGAIEKLADLGFSTNPLTKIVETPEAMFDHYHAIEEQRATLGYD 295

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV++ +LQK+LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL
Sbjct: 296 IDGVVYKVNDLALQKRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARL 355

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG +++NATLHNEDYI G D+ G  +RGG+DIRVGD V V RAG+VIPKV D+ +
Sbjct: 356 SPVTVGGVVVSNATLHNEDYIAGRDSKGGDIRGGKDIRVGDWVQVYRAGDVIPKVADVDL 415

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
            +R  DA+P+ FP  CP C S  +R+         A  RCTGG+ C AQ +E+LKHFVSR
Sbjct: 416 TKRPDDAEPYVFPDTCPECGSEAIREEGD------AVRRCTGGMICPAQAVEKLKHFVSR 469

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+IEGLG +Q++ F+  E     IR PADIFT  RR   +  K++N  G+G+ S   L
Sbjct: 470 SAFDIEGLGAKQVEAFYFDE--GLPIREPADIFTFARRDGAALAKLKNRDGWGEKSAAKL 527

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           +++I +RR I L R IF+LGIRHVG   A  LA++Y  +  F   +          W  L
Sbjct: 528 FEAIEERRRIPLNRVIFALGIRHVGENSANLLARHYGDWPTFEAAMTGASPEGGAAWEEL 587

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
           + +  VG+ +A ++V  +       +++ L+ E+        +   S +  K +VFTGTL
Sbjct: 588 LSIDGVGETMATSLVTTFHQEAERASIDRLVAELDIEPVEAPQTEGSPVAGKTVVFTGTL 647

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+     LGA VS  +S KTD+++ G   GSK +KA +LG++ ++E+ +L L+
Sbjct: 648 EKMTRAEAKARAEALGAKVSGSVSAKTDLLVAGPGAGSKAKKAAELGIETIDEDGWLDLI 707


>gi|119386790|ref|YP_917845.1| DNA ligase, NAD-dependent [Paracoccus denitrificans PD1222]
 gi|166216224|sp|A1B9F5|DNLJ_PARDP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119377385|gb|ABL72149.1| DNA ligase, NAD-dependent [Paracoccus denitrificans PD1222]
          Length = 765

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 305/760 (40%), Positives = 444/760 (58%), Gaps = 63/760 (8%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           L P+  L ++ A  E + L +E++  +  YYQ   P I D+EYDA KRR + I   FPDL
Sbjct: 22  LPPVSGLDVKAAEAEHARLSEEVAQANLAYYQEDAPFISDAEYDASKRRLEEIEARFPDL 81

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           A S     P  ++G   +    KV H +P LSLE  ++  D+  F+ R+  F        
Sbjct: 82  AHS---GSPTAQVGAAPDTRFAKVPHRLPMLSLENGFSQGDVEAFVQRVRSFLNLASGAP 138

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEI 184
           +  T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I  IP  LS +  PE+
Sbjct: 139 LEVTAEPKIDGLSLSLRYEGGRLVQAATRGDGAVGENVTANARTIADIPGQLSGDGYPEV 198

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGL 243
           +E+RGE Y+S  DF  LN      GR  +ANPRNAA+G LR+L+P+    R L FF +  
Sbjct: 199 LEIRGECYMSHEDFEKLNQSE--TGRV-FANPRNAAAGSLRQLDPSVTAARPLRFFAYAW 255

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G+ S  FA  Q E +++M+  GF  N   R   +   ++S + E++ +R+TL YDIDG+V
Sbjct: 256 GEVSASFAGTQMEAVRRMQAFGFQTNPLTRICASVSEMLSAWAEIEQMRATLGYDIDGVV 315

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKV++ + Q +LG R+ +PRW ++HKF  ++A TRL  IDIQ+GRTG L+PVARL PV +
Sbjct: 316 YKVNDLAYQARLGMRSTTPRWALAHKFPAERAWTRLEAIDIQVGRTGALSPVARLHPVTV 375

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG +++NATLHNEDYI G  A G  +RGG+DIR+GD V V RAG+VIPKV D+ + +R  
Sbjct: 376 GGVVVSNATLHNEDYIAGRGADGSEIRGGKDIRIGDWVEVYRAGDVIPKVADVDLAKRPS 435

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           +A+P++FP+ CP C S  +R+     G  V   RCTGGL C AQ +E+L+HFVSR AF+I
Sbjct: 436 EAEPYAFPTTCPECGSPAIRE----EGDSV--RRCTGGLICPAQAVEKLRHFVSRAAFDI 489

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSI 542
           EGLG + ++  F+       I  PADIFTLQ R      T+++N  G+G+ S  +L+ +I
Sbjct: 490 EGLGAKLVEELFRDG----WIAEPADIFTLQDRYGPGQLTQLKNREGWGEKSAASLFQAI 545

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINN----IIAHN------- 591
            KRR I L R +F+LGIRHVG   A+ LA++Y S++     ++      +AH        
Sbjct: 546 EKRREIPLARLLFALGIRHVGEVAAQDLARHYGSWEALEIALDTARPAALAHRVAEDAAL 605

Query: 592 --------------------------------NDDWLSLIRVPLVGDIIAQAIVEFYQNP 619
                                              W  LI    +G ++A ++ + + N 
Sbjct: 606 AEREAARAEGRRARPSEARAAALAQVDLSPEATAAWTGLIAADGIGPVLAMSLSDAFANE 665

Query: 620 RNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSA 679
           R   A++ L+  ++  +    +   S I  K LVFTGTL+K+ R +A+     LGA V+ 
Sbjct: 666 RERAAIDRLVSFLT-VLPPEARATDSAIAGKTLVFTGTLEKMTRAEAKARAEALGAHVAG 724

Query: 680 ILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            +S KTD++I G   GSK +KA +LG+K+++E+++L + Q
Sbjct: 725 SVSAKTDLLIAGPGAGSKAKKAAELGIKVIDEDEWLAIAQ 764


>gi|294677201|ref|YP_003577816.1| DNA ligase [Rhodobacter capsulatus SB 1003]
 gi|294476021|gb|ADE85409.1| DNA ligase (NAD(+)) [Rhodobacter capsulatus SB 1003]
          Length = 707

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 296/713 (41%), Positives = 433/713 (60%), Gaps = 21/713 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +++L+  +A  E+  L   I   +  Y+    P I D++YDALKRR  AI   FPDLAR+
Sbjct: 10  LDSLTRAEAEAEVPELVARIEAANHAYHTLDAPKISDADYDALKRRLAAIEARFPDLARA 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P     ++G  +     KV H I  LSLE  +   D+  F  R+  +     ++++  
Sbjct: 70  DSPT---MRVGAAVAEGFGKVAHEIRMLSLENAFLDADVADFDGRMRSYLGLGPESALPC 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE G  V AA RGDG  GE+V+   R I  IP+ L+   P ++EVR
Sbjct: 127 TAEPKIDGLSLSLRYEDGLLVQAATRGDGEVGENVTENARTIADIPQRLT-GAPAVLEVR 185

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEVY+S  DF ALN      G K +ANPRNAA+G +R+L+     +R L FF +  G  S
Sbjct: 186 GEVYMSHADFAALNARQAERGDKTFANPRNAAAGSVRQLDARITASRPLKFFAYSWGVLS 245

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E  +  Q   +++++ LGF  N   R       ++++Y  +++ R+TL YDIDG+VYKV+
Sbjct: 246 EPLSDTQLGAIERLKALGFQTNPLTRLCADTAEMLAHYRAIEAQRATLGYDIDGVVYKVN 305

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ +LG R+ +PRW I+HKF  + A TRL  I+IQ+GRTG L+PVARL PV +GG +
Sbjct: 306 DLALQARLGFRSTTPRWAIAHKFPAELAWTRLEKIEIQVGRTGALSPVARLAPVTVGGVV 365

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHNEDYI GL + G+V+R G+DIR GD V V RAG+VIPKV D+ ++ R P AQP
Sbjct: 366 VSNATLHNEDYIAGLSSKGEVIRDGKDIREGDWVQVYRAGDVIPKVADVDLSRRDPAAQP 425

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+IEGLG
Sbjct: 426 FVFPHLCPECGSEALREEGD------AVRRCTGGLICPAQAVEKLKHFVSRAAFDIEGLG 479

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            +Q++ F+K       IR PA+IFTLQ R      +++N  G+G+ S  NL+ +I ++R 
Sbjct: 480 AKQVEAFYKDG----WIREPAEIFTLQARFGAGLQQLKNREGWGEKSAQNLFQAIEEKRK 535

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           I L R IF+LGIRHVG   A   A +YL+++ F   +   +   + +W  L+ +  VG+ 
Sbjct: 536 IPLARLIFALGIRHVGESSAALFATHYLTWERFEAAMRAAVP-GSAEWQELLSIDGVGET 594

Query: 608 IAQAIVEFYQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +A ++   +       A++ L+    V P++ R      S +    +VFTGTL+++ R +
Sbjct: 595 LAASVTAAFHPGAERDAIDRLVTHLTVEPAVPRAS---DSPVAGLTVVFTGTLERMTRAE 651

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+     LGA V+  +S KTDI++ G   GSK +KA  LGV++++EE ++ L+
Sbjct: 652 AKARAEALGAKVAGSVSAKTDILVAGPGAGSKAKKAADLGVRVIDEEAWIRLI 704


>gi|260576789|ref|ZP_05844774.1| DNA ligase, NAD-dependent [Rhodobacter sp. SW2]
 gi|259021041|gb|EEW24352.1| DNA ligase, NAD-dependent [Rhodobacter sp. SW2]
          Length = 705

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 304/712 (42%), Positives = 432/712 (60%), Gaps = 18/712 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           IE L+  +A  E   L + ++  +  Y+Q   P + D+ YDA+KRR  AI   FP LA  
Sbjct: 7   IEQLTEAEAAVEWQELARAVAQANIDYHQNDAPKLTDATYDAMKRRLAAIEVLFPQLAT- 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P +K+G        KV H++  LSLE  ++  D+  F  R+ +F        + +
Sbjct: 66  ---DSPTSKVGAAPADGFAKVPHAVRMLSLENAFDDTDVTDFDDRVRKFLGHA--APLTY 120

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE G  V AA RGDG  GE+V+   R I  IP+ L+   P ++EVR
Sbjct: 121 TAEPKIDGLSLSLRYEAGVLVQAATRGDGEVGENVTDNARTISDIPQSLT-GAPAVLEVR 179

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+S  DF ALN    A G K +ANPRNAA+G LR+L+ +    R L FF +  G  S
Sbjct: 180 GEVYMSHADFAALNSRQAARGEKTFANPRNAAAGSLRQLDASITAARPLRFFAYAWGALS 239

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E  A  Q E + ++  LGF  N   R   +   +++ Y E+++ R++L YDIDG+VYKV+
Sbjct: 240 EPLAATQLEAIARLAALGFATNPLTRACTSPDDLLAVYREIEAQRASLGYDIDGVVYKVN 299

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ +LG RA +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG +
Sbjct: 300 DLALQARLGFRAATPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGGVV 359

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           + NATLHNEDYI G D+ G  +R G+DIR+GD V V RAG+VIPK+ +I + +R    + 
Sbjct: 360 VANATLHNEDYIAGRDSKGNPIRDGKDIRIGDWVQVYRAGDVIPKINNIDLEKRPKTVET 419

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F+FP+ CP C S  +R+     G  V   RCTGGL C AQ +ERLKHFVSR AF+IEGLG
Sbjct: 420 FTFPTICPQCGSDAIRE----DGDSV--RRCTGGLICPAQAVERLKHFVSRAAFDIEGLG 473

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSINKRR 546
            +Q++ FF   DP   ++ PADIFTL  R   S   K++N  G+G+ S TNL+ +I+++R
Sbjct: 474 AKQIEAFFN--DPDLPLKTPADIFTLASRDAASPLKKLKNRDGWGEKSATNLFAAIDEKR 531

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I L R IF+LGIRHVG   A  LA +Y S+ NF   + +       DW  L  +  VG 
Sbjct: 532 SIPLHRLIFALGIRHVGESSAALLANHYGSWSNFEAAMTHAEIGQGADWADLTAIDGVGA 591

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A +++  +  P    A++AL+  ++           S +  K LVFTGTL+K+ R +A
Sbjct: 592 VLATSLITTFHQPAERAAIDALVAHLTVQDA-APVATDSPVAGKTLVFTGTLEKMSRAEA 650

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S KTD++I G   GSK + A+ LGV++++E  +L L+
Sbjct: 651 KARAESLGAKVAGSVSAKTDLVIAGPGAGSKAKAAEALGVQVIDEAAWLALI 702


>gi|255264005|ref|ZP_05343347.1| DNA ligase, NAD-dependent [Thalassiobium sp. R2A62]
 gi|255106340|gb|EET49014.1| DNA ligase, NAD-dependent [Thalassiobium sp. R2A62]
          Length = 711

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 295/716 (41%), Positives = 435/716 (60%), Gaps = 24/716 (3%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I ++ L+   A  EL+ L   +   +D Y+    P + D+EYDALKRR  AI   FPDL 
Sbjct: 13  IDVDDLTRTAATDELTWLSYVLGQANDDYHGSDAPQMSDAEYDALKRRNMAIEARFPDLK 72

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R + P+   +++G        K+TH +  LSL   +  ED+ +F  R+ ++   +D  ++
Sbjct: 73  RGDSPS---DQVGAAPIDGFGKITHVVRMLSLGNAFTDEDVVEFDRRVRKYLGLED--AL 127

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  + AA RGDG  GEDV+A  R +  IP+ L  N P+++E
Sbjct: 128 AYTAEPKIDGLSLSLRYEGGVLIQAATRGDGAVGEDVTANARMVQDIPQTLK-NAPDVLE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG 244
           VRGEVY+S  DF  LN    A G K +ANPRNAA+G LR+LN  +IT  R L FF +  G
Sbjct: 187 VRGEVYMSHADFEDLNTRQEARGAKSFANPRNAAAGSLRQLN-AEITKDRPLRFFAYASG 245

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             S   A  Q   ++++  LGF  N   +  +    ++++Y  ++  R+TL YDIDG+VY
Sbjct: 246 DLSAPLADTQNAAIERLAALGFSTNPLTQLCDDPEAMIAHYRRIEEQRATLGYDIDGVVY 305

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+PV +G
Sbjct: 306 KVNDLGLQRRLGFRSTTPRWAIAHKFPAELAWTTLEAIDIQVGRTGALSPVARLKPVTVG 365

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYIKGLD+ G  +R GRDI VGD V + RAG+VIPK+ D+ + +R   
Sbjct: 366 GVVVSNATLHNEDYIKGLDSKGAPIREGRDIWVGDWVQIYRAGDVIPKICDVDLAKRLAT 425

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           AQ + FP  CP C S  VR+         A  RC GG+ C AQ +E+LKHFVSR  F+I+
Sbjct: 426 AQAYEFPETCPECGSHAVREEGD------AVRRCVGGMICPAQAVEKLKHFVSRGGFDID 479

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F         ++ PADIFTL+ R  +   +++N  G+GD S +NL+D+I+ 
Sbjct: 480 GLGAKQVEQFHSDA----WVKEPADIFTLRDRFGSGLQQLKNREGWGDKSASNLFDAIDD 535

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R I L R IF+LGIRHVG   A  +A  Y ++  F   +   +    D W +LI +  V
Sbjct: 536 KRRIGLGRLIFALGIRHVGDASANLIANRYGTWSAFEGAMTAAVIGEGDAWETLIDIDGV 595

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLK--EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           G ++A ++V   Q      +++ L+   +V  ++   +    S +  K +VFTG+L+K+ 
Sbjct: 596 GAVMAGSLVRAMQEEAERASIDRLVAHLDVQEAV---QVTSDSPVAGKTVVFTGSLEKMT 652

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA VS  +S KTD+++ G   GSK +KA  LGV+ ++E+ +L L+
Sbjct: 653 RAEAKARAESLGAKVSGSVSAKTDLLVAGPGAGSKAKKAADLGVETIDEDDWLALI 708


>gi|83951899|ref|ZP_00960631.1| DNA ligase, NAD-dependent [Roseovarius nubinhibens ISM]
 gi|83836905|gb|EAP76202.1| DNA ligase, NAD-dependent [Roseovarius nubinhibens ISM]
          Length = 748

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 299/732 (40%), Positives = 426/732 (58%), Gaps = 65/732 (8%)

Query: 34  CYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSI 93
            Y+    P I D+EYDALK+R   I   FP+L R + P+    ++G   +    KV H I
Sbjct: 32  AYHGADAPEISDAEYDALKQRNAEIEARFPELKRDDSPS---EQVGAAPSEGFGKVAHEI 88

Query: 94  PTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAAL 153
             LSL   +   D+  F  RI ++       ++ +T EPKIDG  +++RYE+GK V AA 
Sbjct: 89  RMLSLGNAFADGDVADFDERIRKYLGLGSGAALAYTAEPKIDGLSLSLRYEQGKLVQAAT 148

Query: 154 RGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPY 213
           RGDG  GE+V+A  R +  IP+ +S   PE++EVRGEVY+S  DF ALN    A G KP+
Sbjct: 149 RGDGAVGENVTANARTVEDIPQEIS-GAPEVLEVRGEVYMSHADFEALNARQEAAGAKPF 207

Query: 214 ANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGV 272
           ANPRNAA+G LR+L+P     R L FF +  G  S   A+ Q   + ++  LGFPVN   
Sbjct: 208 ANPRNAAAGSLRQLDPGVTAARPLKFFAYAWGALSAPLAETQMGAIARLGALGFPVNPLT 267

Query: 273 RQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAE 332
           R+  +   ++++Y E++  R+TL YDIDG+VYKVD+ +LQ +LG R+ +PRW I+HKF  
Sbjct: 268 RRCESVGEMIAHYREIEQGRATLGYDIDGVVYKVDDLALQARLGFRSTTPRWAIAHKFPA 327

Query: 333 KQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGG 392
           + A TRL  IDIQ+GRTG L+PVARL PV +GG +++NATLHNEDYI G DA G  +RGG
Sbjct: 328 ELAWTRLEGIDIQVGRTGALSPVARLAPVTVGGVVVSNATLHNEDYIAGRDAKGGEIRGG 387

Query: 393 RDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKL 452
           +DIRVGD V V RAG+VIPK+ D+ + +R   A+ F FP+ CP C S  +R+        
Sbjct: 388 KDIRVGDWVQVYRAGDVIPKIADVDLAKRPEGAERFDFPTRCPECGSEAIREEGD----- 442

Query: 453 VAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFT 512
            A  RC+GGL C AQ +E+LKHFVSR AF+IEGLG +Q++ F++       I+ PADIFT
Sbjct: 443 -AVRRCSGGLICPAQAVEKLKHFVSRAAFDIEGLGAKQVEQFYRD----GWIKAPADIFT 497

Query: 513 LQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAK 572
           LQ R      +++N  G+G+ S  NL+ +I ++R I L + IF+LGIRH G   AR LA 
Sbjct: 498 LQERYGAGLQQLKNREGWGEKSANNLFAAIEEKRRIPLAKLIFALGIRHAGEVAARDLAL 557

Query: 573 YYLSYQNFAQEIN-------------------------------------------NIIA 589
           +Y  +Q  A+ I+                                           ++ A
Sbjct: 558 HYRDWQAMAEAIDLARPAARAHRAADEAEEAERQAAGAEGRRARVSETRAAAVADCDVPA 617

Query: 590 HNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL---LKEVSPSIGRHEKNVSSE 646
                W  LI V  +G ++  ++ + + N +   A++ L   L  V+P          S 
Sbjct: 618 EAAAAWADLIAVDGIGAVLGLSLSDAFANDQERAAIDTLVAGLDIVAPDA----PAADSP 673

Query: 647 IENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGV 706
           +  K +VFTG+L+K+ R +A+     LGA VS  +S KTDI++ G   GSK  KA +LG+
Sbjct: 674 VAGKTVVFTGSLEKMTRAEAKARAESLGAKVSGSVSAKTDILVAGPGAGSKATKAAELGI 733

Query: 707 KIMNEEQFLFLL 718
           + ++E+ +L L+
Sbjct: 734 ETLDEDGWLALI 745


>gi|86138407|ref|ZP_01056981.1| DNA ligase, NAD-dependent [Roseobacter sp. MED193]
 gi|85824932|gb|EAQ45133.1| DNA ligase, NAD-dependent [Roseobacter sp. MED193]
          Length = 752

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 307/763 (40%), Positives = 448/763 (58%), Gaps = 65/763 (8%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           MK+ + +    LS EQA+ E   L+ +++  D  Y+Q   P + D+ YDA KRR   +A 
Sbjct: 1   MKQIEPLDPSGLSQEQAQAEFLELQTQLAAADQAYHQNDAPFLSDAAYDAAKRRYKVLAE 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP+L   +D    L+ +G  +     K+ H +P LSL   +   D+  F   I  +   
Sbjct: 61  AFPEL---KDIATQLDSVGAPVTSGFGKIQHVVPMLSLGNAFEDSDVADFDRSIRNYLGF 117

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
                + FT EPKIDG  +++RYEKG  + AA RGDG +GE+V+A  R I  IP+ LS  
Sbjct: 118 GASQPLRFTAEPKIDGLSLSLRYEKGVLIQAATRGDGATGENVTANARTIADIPQQLS-G 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNF 238
            PE++EVRGEVY+S  DF ALN      G K +ANPRNAA+G LR+L+  +ITR   L F
Sbjct: 177 APEVLEVRGEVYMSHEDFAALNARHTERGGKTFANPRNAAAGSLRQLD-AEITRLRPLRF 235

Query: 239 FVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
           F +  G  S   A+ Q   ++++  LGF  N   +   +   ++++Y ++++ R+TL YD
Sbjct: 236 FAYSWGDLSAPLAQTQTGAIERLHELGFQTNPLTQTCASVAEMIAHYRQIEAQRATLGYD 295

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD+ +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL
Sbjct: 296 IDGVVYKVDDLALQGRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARL 355

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG +++NATLHNEDYI+G D  G+ +RGG++IR+GD V V RAG+VIPKV D+ +
Sbjct: 356 TPVTVGGVVVSNATLHNEDYIRGRDNKGEEIRGGKEIRIGDWVQVYRAGDVIPKVADVDL 415

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
            +R+ D Q F FP  CP C S  VR+         A  RCTGG+ C AQ +E+LKHFVSR
Sbjct: 416 TKRNGDEQTFDFPETCPECGSPAVREEGD------AVRRCTGGIICPAQAIEKLKHFVSR 469

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+IEGLG +QL+ F+   DP   IR P DI+TL++R     TK++N  G+GD S  NL
Sbjct: 470 KAFDIEGLGAKQLEMFYN--DPDLPIRTPVDIYTLEQRDLGQFTKLKNRPGWGDQSAANL 527

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN----NIIAHNNDD 594
           + +I ++RNISL R IF+LGIRHVG   A+ LA ++ S+++ A  ++      +AH   D
Sbjct: 528 FAAITEKRNISLGRMIFALGIRHVGEVAAKDLALHFGSWEDLASAVDAARSAALAHRAAD 587

Query: 595 ---------------------------------------WLSLIRVPLVGDIIAQAIVEF 615
                                                  W  LI +  +G  +  ++ + 
Sbjct: 588 LAEDQERERASSEGRRAKIKETREAALSVLELHRTAREAWEDLIGIDGIGATVGLSLSDA 647

Query: 616 YQNPRNICAVEALLKEV---SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
             N +    ++ L+ ++   +P+    E    S +    +VFTG L+K+ R +A+     
Sbjct: 648 LANMQERAVIDDLVAQLNISAPAAPSQE----SPVAGLTVVFTGKLEKMTRDEAKARAES 703

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           LGA VS  +S+KTDI++ G   GSK +KA +LG++I++E+ +L
Sbjct: 704 LGAKVSGSVSKKTDILVAGPGAGSKEKKALELGIRILDEDGWL 746


>gi|114767408|ref|ZP_01446210.1| DNA ligase, NAD-dependent [Pelagibaca bermudensis HTCC2601]
 gi|114540493|gb|EAU43572.1| DNA ligase, NAD-dependent [Roseovarius sp. HTCC2601]
          Length = 757

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 306/758 (40%), Positives = 452/758 (59%), Gaps = 61/758 (8%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +EALS +QAR EL  L   ++  +  Y+    P I D++YDALKRR  AI   FP+L 
Sbjct: 13  IDVEALSEDQARAELERLAGLLAQANLAYHTEDAPEISDADYDALKRRNVAIEERFPELK 72

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R + P+    ++G  +     K+ H+   +SL   ++ +++R F   I R+    +D  +
Sbjct: 73  REDSPS---EQVGAALAEGFGKIRHAQRMMSLSNAFDDDEVRDFDRGIRRYLGLAEDAPL 129

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G  + AA RGDG +GE+V+A  R I  IP+ L    PE++E
Sbjct: 130 PFTAEPKIDGLSLSLRYENGALIQAATRGDGATGENVTANARTIDDIPQQLE-GAPELLE 188

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLG 244
           VRGEVY+S  DF ALN+   A G KP+ANPRNAA+G LR+L+P +ITR   L FF +  G
Sbjct: 189 VRGEVYMSHADFEALNERQEARGGKPFANPRNAAAGSLRQLDP-EITRARPLKFFAYAWG 247

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S   A+ Q + ++++  LGF  N   R  +    ++ +Y +++  R+TL YDIDG+VY
Sbjct: 248 ELSAPLAETQMDAIERLAQLGFQTNPLTRLCDGPQEMLDHYAQIEEQRATLGYDIDGVVY 307

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++ +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +G
Sbjct: 308 KVNDLALQARLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVG 367

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G DASG  +R G+DIRVGD V V RAG+VIPK+ D+ +++R   
Sbjct: 368 GVVVSNATLHNEDYIAGRDASGNPIRDGKDIRVGDWVQVYRAGDVIPKIADVDLSKRPDG 427

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P++FP  CP C S  +R+         A  RC+GGL C AQ +E++KHFVSR AF+IE
Sbjct: 428 AEPYAFPETCPECGSEAIREEGD------AVRRCSGGLICPAQAVEKMKHFVSRSAFDIE 481

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F++       I  PA+IFTL+ R  +   +++N  G+G+ S  NL+D+I++
Sbjct: 482 GLGAKQVEQFYRD----GWISEPAEIFTLRERYGSGLQQLKNREGWGEKSANNLFDAIDE 537

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-------------------AQEIN 585
           +R I L R +FSLGIRHVG  +A  LA++YLS+                      A E  
Sbjct: 538 KRKIELGRVLFSLGIRHVGEVVANDLARHYLSWSAMIAAIDAARPAAERYRRAEQAVEAE 597

Query: 586 NIIAHNND-------------------------DWLSLIRVPLVGDIIAQAIVEFYQNPR 620
            + A +                            W  L+ V  +G  +A ++V     P 
Sbjct: 598 RVAAKSEGRRARLKEIRDAAWAEDPAVSTEARAAWDDLVGVDGIGQTVAVSLVTSMGQPT 657

Query: 621 NICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
              +++ L+ ++            S +  K +VFTG+L+K+ R +A+     LGA VS  
Sbjct: 658 ERASIDRLVAQLDIQDAERPATDGSPVAGKTVVFTGSLEKMTRAEAKARAEALGAKVSGS 717

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +S+KTDI++ G   GSK  KA++LGV++M+E+ +L L+
Sbjct: 718 VSKKTDIVVAGPGAGSKEAKARELGVELMDEDAWLALI 755


>gi|259416760|ref|ZP_05740680.1| DNA ligase, NAD-dependent [Silicibacter sp. TrichCH4B]
 gi|259348199|gb|EEW59976.1| DNA ligase, NAD-dependent [Silicibacter sp. TrichCH4B]
          Length = 739

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 301/754 (39%), Positives = 437/754 (57%), Gaps = 61/754 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +++  ARKE  +L+ +I   D  Y+Q   P + D+EYD LKRR  A+A AFP+LA   + 
Sbjct: 1   MNVTDARKEFEALQTKIEAADLDYHQKDAPTLSDAEYDRLKRRYLALAEAFPELA---EE 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
              +  +G        K+ H++  +SL   +  +D+  F   + R+     D  + FT E
Sbjct: 58  GTRVESVGAPAASGFGKIAHAVRMMSLGNAFEDQDVEDFAAGLRRYLGLSSDAPLAFTAE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYE G  V AA RGDG  GE+V+   R I  IP+ ++   P ++EVRGEV
Sbjct: 118 PKIDGLSLSLRYENGTLVQAATRGDGAVGENVTENARTIEDIPQQIT-GAPAVLEVRGEV 176

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEI 249
           Y+S  DF ALN      G K +ANPRNAA+G LR+L+  +ITR   L FF +  G+ SE 
Sbjct: 177 YMSHADFEALNARHAETGGKIFANPRNAAAGSLRQLD-AEITRARPLRFFAYSWGELSEP 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A+ Q + +++ + LGF  N   R   T   ++++Y+ ++  R+ L YDIDG+VYKV++ 
Sbjct: 236 LAETQIDAIERFKSLGFQTNPLTRCCQTIAELLTHYHSIEEQRADLGYDIDGVVYKVNDL 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL+PV +GG +++
Sbjct: 296 ALQERLGFRSTTPRWAIAHKFPAELAWTRLDGIDIQVGRTGALSPVARLQPVTVGGVVVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI GLD+ G  +R G+DIRVGD V + RAG+VIPKV D+ +N R   A+ ++
Sbjct: 356 NATLHNEDYIAGLDSKGATIRDGKDIRVGDWVQIYRAGDVIPKVADVDLNRRPDGAEVYA 415

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP C S  VR+         A  RC+GGL C AQ +E+LKHFVSR AF+IEGLG +
Sbjct: 416 FPTHCPRCNSPAVREEGD------AVRRCSGGLICPAQAVEKLKHFVSRAAFDIEGLGAK 469

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++ F         I+ PADIF L+ R  +   +++N  G+GD S T L+ +I+ +R I 
Sbjct: 470 QVEQFHSDG----WIKEPADIFELKERYGSGMQQLKNREGWGDKSATALFAAIDDKRRIE 525

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN----NIIAHNNDD----------- 594
             R IF LGIRHVG   A+ LA ++ ++   A+  +      +AH   D           
Sbjct: 526 FARLIFGLGIRHVGEVAAKDLALHFRTWAVLAEAADLARPAALAHRAADEAELLERQVAQ 585

Query: 595 ----------------------------WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVE 626
                                       W  LI V  +G  +A ++ + + NP    A +
Sbjct: 586 AEERRARISEVRKAAIAACEVAPDAQAAWDDLISVDGLGPTVALSLSDAFANPEERAAFD 645

Query: 627 ALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTD 686
            L+  +   I        S +  K +VFTGTL+K+ R +A+     LGA VS  +S+KTD
Sbjct: 646 RLIAHLE-VIEPDAPTEDSPVAGKTVVFTGTLEKMTRAEAKARAEALGAKVSGSVSKKTD 704

Query: 687 IIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           I++ G   GSK  KA +LGV+ M+E+Q+L L+ Q
Sbjct: 705 ILVAGPGAGSKATKAAELGVRTMDEDQWLDLIGQ 738


>gi|260426307|ref|ZP_05780286.1| DNA ligase, NAD-dependent [Citreicella sp. SE45]
 gi|260420799|gb|EEX14050.1| DNA ligase, NAD-dependent [Citreicella sp. SE45]
          Length = 754

 Score =  538 bits (1387), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 310/760 (40%), Positives = 451/760 (59%), Gaps = 64/760 (8%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +EAL+  QAR EL+ L + ++  +  Y+    P I D++YDALK R  AI   FP+L 
Sbjct: 9   IEVEALTETQARDELARLAEVLAQANRAYHTEDAPEISDADYDALKLRNIAIEERFPELK 68

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R + P+    ++G  +     KV HS   +SL   +  +++  F   I R+    DD  +
Sbjct: 69  REDSPS---EQVGAPLAEGFAKVRHSQRMMSLANAFADDEVTDFDRGIRRYLGLADDARL 125

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I  IP  L    PE++E
Sbjct: 126 PFTAEPKIDGLSLSLRYENGELVQAATRGDGAVGENVTANARTIDDIPATLE-GAPEVLE 184

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLG 244
           VRGEVY+S  DF ALN+   A G K +ANPRNAA+G LR+L+   ITR   L FF +  G
Sbjct: 185 VRGEVYMSHEDFAALNERQEARGGKRFANPRNAAAGSLRQLDAA-ITRERPLRFFAYAWG 243

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + SE  A  Q   ++++  LGF  N   R  +    ++++Y ++++ R+TL YDIDG+VY
Sbjct: 244 EVSEPLATTQMGAIERLEALGFQTNPLTRLCDGPQEMLAHYAQIEAQRATLGYDIDGVVY 303

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD+ +LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +G
Sbjct: 304 KVDDLALQQRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVG 363

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G DASG  +R G+DIRVGD V V RAG+VIPKV D+ +++R  +
Sbjct: 364 GVVVSNATLHNEDYIAGRDASGNPIRDGKDIRVGDWVQVYRAGDVIPKVADVDLDKRPEE 423

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P++FP  CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+IE
Sbjct: 424 AEPYAFPQTCPECGSEAIREEGD------AVRRCTGGLVCPAQAVEKLKHFVSRAAFDIE 477

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F +       I  PA+IFTL+ R  +   +++N  G+G+ S  NL+D+I++
Sbjct: 478 GLGAKQVEQFHRD----GWISEPAEIFTLRTRYGSGIQQLKNREGWGEKSAQNLFDAIDE 533

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINN------------------ 586
           RR I L R IFSLGIRHVG  +A  LA++Y S+    + ++                   
Sbjct: 534 RRTIGLGRVIFSLGIRHVGEVVANDLARHYASWDKLIEAVDAARPAAERYRQAETAVEAE 593

Query: 587 --------------------------IIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPR 620
                                     + A     W  L+ +  +G  +A ++V       
Sbjct: 594 RKTAAAEGRRARLKETRDAAWEAEPPVSAGARAAWEDLVGIDGIGQTVAVSLVTSLGQTT 653

Query: 621 NICAVEALLKEVSPSIGRHEKNVS--SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678
              +V+ L+ E+  +I   E+ ++  S +  K +VFTG L+K+ R +A+     LGA VS
Sbjct: 654 ERASVDRLIAELR-TIEAPERPLTDGSPVAGKTVVFTGALEKMTRAEAKARAEALGAKVS 712

Query: 679 AILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +S+KTDI++ G   GSK  KA++LG+++M+E+ +L L+
Sbjct: 713 GSVSKKTDIVVAGPGAGSKEAKARELGIELMDEDAWLALI 752


>gi|294085891|ref|YP_003552651.1| DNA ligase (NAD+) [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665466|gb|ADE40567.1| DNA ligase (NAD+) [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 696

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 300/710 (42%), Positives = 438/710 (61%), Gaps = 32/710 (4%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S + A +EL+ L + I+YHD  Y+    P I D++YD L  R +A+  +FP+L R   P
Sbjct: 11  MSADDAAQELAYLAERIAYHDRKYHGEDAPDISDADYDMLVARNNALEASFPELIR---P 67

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++G  ++ S  K+ H+ P LSL   ++ ED+  F+TRI +F    + + I FT E
Sbjct: 68  DSPSQRVGTMVSGSFGKIRHAQPMLSLSNGFSAEDIADFVTRIRKFLSLAETDDIAFTAE 127

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYEKG  V AA RGDG  GEDV+A IR +  IP+ L   +P+I EVRGEV
Sbjct: 128 PKIDGLSLSLRYEKGHLVQAATRGDGSEGEDVTANIRTVDAIPKTLPDTVPDIFEVRGEV 187

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF 250
           Y+ + DFLALN +    G K +ANPRNAA+G LR+ + +   +R L FF + +G+ S   
Sbjct: 188 YMDRKDFLALNADQERKGGKIFANPRNAAAGSLRQKDVSITGSRNLAFFAYSMGEASAPV 247

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
           A    + L  +R  GF VN+  R   +   +++ Y+ + S R++L YDIDG+VYKVD   
Sbjct: 248 AATHTDFLAALRDFGFSVNDLSRHCLSLDDMLATYDAIGSQRASLDYDIDGVVYKVDRHD 307

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q++LG+ AR+PRW ++HKF  +QA T ++ IDIQ+GRTG LTPVARL PV +GG +++N
Sbjct: 308 YQERLGQVARAPRWALAHKFPAEQAETTIIKIDIQVGRTGALTPVARLTPVTVGGVVVSN 367

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED I             +DIR+GD V+++RAG+VIP+VV ++  +R  D Q F+F
Sbjct: 368 ATLHNEDEI-----------ARKDIRIGDHVIIQRAGDVIPQVVRVLDEKRPDDVQIFTF 416

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S  +R      G+ V   RCTGGLAC AQ +E+LKHFVSRDAF+IEGLG +Q
Sbjct: 417 PDRCPVCDSDAIR----PEGEAV--RRCTGGLACEAQLVEQLKHFVSRDAFDIEGLGARQ 470

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F +       ++ PADIF L+ R+     K+  + G+G  S+ NL+ SIN RR I L
Sbjct: 471 IEQFLE----LGWVKTPADIFRLETRRD----KLATLDGYGAKSLDNLFASINARRTIGL 522

Query: 551 ERFIFSLGIRHVGAEIARSLAKYY--LSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           ERFI++LGIR VG   +R LA +Y  L     A +  N  + +     +L+ +  +GD +
Sbjct: 523 ERFIYALGIRQVGQATSRLLALHYGDLDMMMSALDPENTESEHEIAIAALVDIDQIGDAM 582

Query: 609 AQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
           A  I  F+ +  +   V  L  E+S  +     +  S +  K +VFTGTL ++ R +A+ 
Sbjct: 583 AADICRFFGDTAHRNIVNDLASELS-ILPPERPSEDSAVSGKTVVFTGTLARMSRAEAKA 641

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
               LGA VS  +S KTD +I G + GSK  KA +LGV +++E+++  L+
Sbjct: 642 KAEALGAKVSGSVSAKTDYLIAGADAGSKARKAAELGVTVLSEDEWRALI 691


>gi|163760776|ref|ZP_02167856.1| DNA ligase, NAD-dependent [Hoeflea phototrophica DFL-43]
 gi|162282098|gb|EDQ32389.1| DNA ligase, NAD-dependent [Hoeflea phototrophica DFL-43]
          Length = 739

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 298/716 (41%), Positives = 440/716 (61%), Gaps = 25/716 (3%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PIEALS  +A+ EL  L  EI+ HD+ Y++   PI+ D+EYDA KRR  AI   FP L  
Sbjct: 43  PIEALSEAEAKAELDRLAAEIARHDEAYHRKDAPIVSDAEYDAFKRRNLAIEERFPHLRL 102

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P+    K+G  +     K+TH +  LSLE  ++ ED R F+ R+ RF      + + 
Sbjct: 103 ADSPS---LKVGAPVAEGFGKITHKVAMLSLENAFSDEDARDFVNRVKRFLNLTPFDELA 159

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIE 186
            T EPKIDG  +++RYE G  V AA RGDG +GE+V+A  R I  IP  L+  ++PE+IE
Sbjct: 160 LTAEPKIDGLSLSLRYENGTLVSAATRGDGATGENVTANARTISDIPHQLAGEDVPEVIE 219

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++K DF+ALN    A G++ Y NPRN A+G LR+L+P     R L FF +  G+
Sbjct: 220 VRGEVYMTKADFMALNARQAAAGKQTYVNPRNTAAGSLRQLDPKITAERPLRFFAYAWGE 279

Query: 246 T-SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
               +    Q EM+      GF VN  + +  +   ++++Y  +++ R+ LPYDIDG+VY
Sbjct: 280 VLPSLPYPTQSEMVAAFARWGFAVNPLMARVTSAEALIAHYRLIEAERAGLPYDIDGVVY 339

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD+  LQ++LG  +RSPRW I+HKF  ++AST L  IDIQ+GRTG LTPVARLEPV +G
Sbjct: 340 KVDDLGLQRRLGFVSRSPRWAIAHKFPAEKASTLLTAIDIQVGRTGALTPVARLEPVTVG 399

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHN + I+ L            +R+GD V ++RAG+VIP+V+ ++ +    D
Sbjct: 400 GVVVTNATLHNAEEIERL-----------GVRIGDTVQIQRAGDVIPQVLGVVSSPE--D 446

Query: 425 AQPFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           A  F+FPS CP   ++ V+R+     G      RC+G  AC  Q+ E LKHFVSR AF+I
Sbjct: 447 AVAFAFPSICPCDLKTPVIRE-ETAGGVEGVVRRCSGEFACPFQRKEHLKHFVSRKAFDI 505

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSI 542
           +GLG++Q++FF+  ED    I  PADIFTL+ R + +   +++N  G+GD S   L+D+I
Sbjct: 506 DGLGEKQIEFFY--EDKTLPINQPADIFTLKMRDEANGLQRLKNRDGYGDTSAQKLFDAI 563

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
             +R ++LER IFSLGIRHVG + A++LA+ Y  +         I   ++     +  + 
Sbjct: 564 EAKREVALERLIFSLGIRHVGEQTAKTLARAYGDWTTLHAAALAIADGDSAAVEEMDALD 623

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G  + +AI  F+    NI  V+ L+ +++  +   +    S +    +VFTG+L+K+ 
Sbjct: 624 DIGPAVVEAIGRFFGEDHNIAMVDNLVSQLT-VLDAEKPAQDSPVAGLTVVFTGSLEKMT 682

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+    +LGA V+  +S+KTDI++ G   GSKL KAQ LGV+ M+E+ +  L+
Sbjct: 683 RDEAKAMAERLGAKVAGSVSKKTDILVAGPGAGSKLTKAQGLGVRTMDEDGWFELV 738


>gi|149203841|ref|ZP_01880810.1| DNA ligase, NAD-dependent [Roseovarius sp. TM1035]
 gi|149142958|gb|EDM31000.1| DNA ligase, NAD-dependent [Roseovarius sp. TM1035]
          Length = 717

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 287/685 (41%), Positives = 420/685 (61%), Gaps = 15/685 (2%)

Query: 35  YYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIP 94
           Y+    P I D+ YDALK R  AI   FP L R +  +   +++G        KV HSI 
Sbjct: 44  YHTEDAPEITDAAYDALKARNAAIEARFPTLKRDDSAS---DQVGAAPLDGFAKVAHSIR 100

Query: 95  TLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALR 154
            LSL   +  ED+ +F +RI R+    DD  + +T EPKIDG  +++RY +G+ V AA R
Sbjct: 101 MLSLGNAFEPEDVAEFDSRIRRYLGLPDDAPLAYTAEPKIDGLSLSLRYVQGRLVQAATR 160

Query: 155 GDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYA 214
           GDG  GE+V+A  R I  IP  L+   PEI+EVRGEVY+S  DF ALN        K +A
Sbjct: 161 GDGEVGENVTANARTITDIPESLT-GAPEILEVRGEVYMSHADFAALNARQAEKSDKQFA 219

Query: 215 NPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVR 273
           NPRNAA+G LR+L+      R L FF +  G+ S   A+ Q   + +++ LGF  N    
Sbjct: 220 NPRNAAAGSLRQLDAKITAARPLRFFAYSWGEVSAPLAETQMGAIARLKALGFQTNPLTV 279

Query: 274 QANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEK 333
             +    ++ +Y  ++  R+TL YDIDG+VYKVD+  LQ +LG R+ +PRW I+HKF  +
Sbjct: 280 LCDGVEALLEHYARIEQARATLGYDIDGVVYKVDDLGLQARLGFRSTTPRWAIAHKFPAE 339

Query: 334 QASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGR 393
            A TRL  IDIQ+GRTG L+PVARL PV +GG +++NATLHNEDYI G D+ G+V+RGG+
Sbjct: 340 LAWTRLEAIDIQVGRTGALSPVARLTPVTVGGVVVSNATLHNEDYIAGRDSKGEVIRGGK 399

Query: 394 DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLV 453
           DIRVGD V V RAG+VIPKV D+ +++R   A P+ FP+ CP C S  VR+         
Sbjct: 400 DIRVGDWVQVYRAGDVIPKVADVDLSKRAEGATPYVFPATCPECGSDAVREEGD------ 453

Query: 454 AAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTL 513
           A  RC GGL C AQ +E+LKHFVSR AF+IEGLG +Q++ F++       I+ PADIF L
Sbjct: 454 AVRRCVGGLICPAQAVEKLKHFVSRAAFDIEGLGAKQVEQFYRDG----WIKEPADIFLL 509

Query: 514 QRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKY 573
           Q R  +   +++N  G+G+ S  NL+++I ++R I   R +F+LGIRHVG + +  +A+ 
Sbjct: 510 QERYGSGLQQLKNREGWGEKSAKNLFEAIEEKRKIPFGRLLFALGIRHVGEQASTLIARN 569

Query: 574 YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS 633
           Y ++  F   ++    +   +W  L+ +  VG ++A+A+V  +  P    +++ L + ++
Sbjct: 570 YGTWDEFIAAMDGAKDYEGPEWERLLGIDGVGTVMARALVGAFAEPHERGSIDRLTEYLT 629

Query: 634 PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDN 693
                  +   S +  K +VFTG+L+K+ R +A+     LGA V+  +S KTD+++ G  
Sbjct: 630 VQEAARPRTDGSPVAGKTVVFTGSLEKMTRAEAKARAEGLGAKVAGSVSAKTDLLVAGPG 689

Query: 694 PGSKLEKAQQLGVKIMNEEQFLFLL 718
            GSK +KAQ LG++ ++E+ +L L+
Sbjct: 690 AGSKAKKAQDLGIETIDEDGWLTLI 714


>gi|23013561|ref|ZP_00053441.1| COG0272: NAD-dependent DNA ligase (contains BRCT domain type II)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 696

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 295/725 (40%), Positives = 444/725 (61%), Gaps = 43/725 (5%)

Query: 4   RQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFP 63
           R  +PI+ L+  +AR E + L +++   D+ Y+    P++ D  YD  KRR   I   FP
Sbjct: 3   RPPVPIDVLTPFEARIEHAELVEKLVSWDEAYHGQDAPLVPDDVYDGAKRRLSGIEARFP 62

Query: 64  DLARSEDPNGPL-NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           +LA       P+ +K+G   +    K+ H++P LSL+  ++ ED+ +F  ++ RF    D
Sbjct: 63  ELAA----KSPIKDKVGAAPSEGFGKLVHALPMLSLDNAFSPEDVAEFDAKVRRFLGLSD 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIP--TIPRVLSLN 180
           +  + +  EPKIDG  I +RYE G FV AA RGDG  GEDV+  +   P   +PR L  +
Sbjct: 119 EAPLAYVAEPKIDGLSINLRYENGNFVSAATRGDGAEGEDVTRNLDTFPETQLPRRLGPD 178

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P +IE+RGEVY++K DFLALN    + G KP+ANPRNAA+G LR+L+P    +R L+ F
Sbjct: 179 APAVIEIRGEVYMTKADFLALNQRQESAGEKPFANPRNAAAGSLRQLDPKITASRPLSLF 238

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            + +G+ S + A   +  L++++  GF VN  +R+ +   G+++ Y  +   R+ LPYDI
Sbjct: 239 AYAMGEASSLPAASHWGYLERLKAWGFVVNPLIRRCDGVAGLLAAYGSLGEARAALPYDI 298

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD+  LQK+LG  +RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL 
Sbjct: 299 DGIVYKVDDLELQKRLGFVSRSPRWAIAHKFPAEQATTLLEAIDIQVGRTGALTPVARLT 358

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PVN+GG +++NATLHNED I             +D+RVGD V+V+RAG+VIP++V ++  
Sbjct: 359 PVNVGGVVVSNATLHNEDEI-----------ARKDVRVGDTVIVQRAGDVIPQIVGVVPG 407

Query: 420 E-RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R P   PF +P  CP+C +  VR      G+++   RCTGGL C AQ  ERLKHFVSR
Sbjct: 408 KPRGP--TPFVYPDTCPVCGAHAVR----PEGEVI--RRCTGGLTCDAQAKERLKHFVSR 459

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
           +AF+IEGLG + ++F +   D  + +R PA IFTL+   Q    K+EN  G+G  S   L
Sbjct: 460 NAFDIEGLGDKNIEFLW---DKGW-VRKPAHIFTLEAANQDRLQKLENFEGWGKRSTEKL 515

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           ++SI  R ++ LERFIF+LGIR +G   A+ LA++Y  +Q +     + +     D L+ 
Sbjct: 516 FESIRSRASMGLERFIFALGIRQIGEATAKRLARHYGGFQAW----RDAMTEEGKDELTS 571

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIG-----RHEKNVSSEIENKKLV 653
           I    +G  +A  +++F++   N  A++ L++ +    G     +  +  +S I  K +V
Sbjct: 572 IED--IGPSVAADLLDFFKEEHNRAALDDLVRAMEALGGGVQDAKRIEAFASPIAGKAVV 629

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTGTL  + R +A+     LGA V   +S+KTD ++VG + GSK  +A +LG+ I++E++
Sbjct: 630 FTGTLVTMTRPEAKARAEALGAKVVGSVSKKTDYVVVGADAGSKATEAAKLGLTILSEQE 689

Query: 714 FLFLL 718
           +L L+
Sbjct: 690 WLDLI 694


>gi|144899097|emb|CAM75961.1| NAD-dependent DNA ligase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 693

 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 295/717 (41%), Positives = 434/717 (60%), Gaps = 32/717 (4%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I I+AL+  +AR E S+L +++   D  Y+Q   P + D+ YDA K R  AI   FP+LA
Sbjct: 3   IEIDALTPFEARIEASALREKLIRWDLAYHQADAPEVDDATYDAAKLRLLAIEARFPELA 62

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
                  P  KIG        KV H +P LSL+  ++ +D+R+F  RI RF     D  I
Sbjct: 63  ----AGSPTAKIGAPAAEGFGKVRHGVPMLSLDNAFSEDDVREFEGRIRRFLALPPDQII 118

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAI---PTIPRVLSLNIPE 183
            F  EPKIDG  I++RYE G+FV AA RGDG  GEDV+A IR +     IP     + P+
Sbjct: 119 AFVAEPKIDGLSISLRYENGQFVRAATRGDGSEGEDVTANIRTLIRRGKIPERFD-DAPD 177

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHG 242
           +IEVRGE+Y++K DFLALN    A G KP+ANPRNAA+G LR+LNP    +R L+ F + 
Sbjct: 178 LIEVRGEIYMTKADFLALNQRQEAAGDKPFANPRNAAAGSLRQLNPRVTASRELSTFFYA 237

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVN-NGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
           LG+ + I     +E L ++   GFP     +   N    ++  Y  ++ +R++L +DIDG
Sbjct: 238 LGEHTTIKQNTHFEFLNQLTKWGFPCALQYISLYNNIDEMIQGYKNLQDLRASLDFDIDG 297

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
            VYKV+ F  Q++LG  +RSPRW I+HKF  +QA+T L  I+IQ+GRTG LTPVA L PV
Sbjct: 298 YVYKVNRFDWQQRLGFVSRSPRWAIAHKFPAEQATTLLERIEIQVGRTGALTPVAHLTPV 357

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
           N+GG +++ A+LHNED         +++R G  +R GD V+++RAG+VIP+VV +++++ 
Sbjct: 358 NVGGVVVSRASLHNED---------EIIRKG--VREGDTVIIQRAGDVIPQVVGVVMDKP 406

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
              A  F FP  CP+C S  VR     TG  V   RC+GGLAC AQ  ERL+HFVSR+AF
Sbjct: 407 R-GAADFLFPDTCPVCGSHAVR-----TGDEVI-RRCSGGLACKAQVKERLRHFVSRNAF 459

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG + +DF  + E     I  PADIF L+        +++N  G+G+  V  L+ +
Sbjct: 460 DIEGLGDENIDFLCEGE----WINKPADIFRLEAANAGRLQRLQNYKGWGEKKVAKLFAA 515

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I  RR I+LER I++LGIR VG   A+ LA++Y S+  + + +   +   ND +  LI +
Sbjct: 516 ITARRTIALERLIYALGIRQVGEATAKRLARHYGSFAVWRESMLAAVPRENDSYHDLISI 575

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  +A  I+ F+    N+ A++ L  +++ +  +  +  +S +  K +VFTG L  +
Sbjct: 576 EDIGPAVANDILAFFAEDHNVAALDDLAAQLTINDAQKIEAGNSPVSGKSVVFTGELVAM 635

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A+     LGA V   +S+KTD ++ G   GSKL +A++LG+ +++E+Q+L L+
Sbjct: 636 TRAEAKAKAEMLGAKVVGSVSKKTDYVVAGPGAGSKLAEAEKLGLTVLSEQQWLELI 692


>gi|304321380|ref|YP_003855023.1| NAD-dependent DNA ligase [Parvularcula bermudensis HTCC2503]
 gi|303300282|gb|ADM09881.1| NAD-dependent DNA ligase [Parvularcula bermudensis HTCC2503]
          Length = 727

 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 289/744 (38%), Positives = 430/744 (57%), Gaps = 49/744 (6%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E LS  +A  EL+ L  E++  D   Y+ + P++ D+ YDAL+RR +AI   FP L R++
Sbjct: 8   EELSEAEAADELARLAHEMAAAD-IAYENADPVMTDAAYDALRRRNEAIEARFPHLRRAD 66

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P+    ++G   +    KV H++P LSL+  +  ED+ +F+TR+ RF +  ++  +  T
Sbjct: 67  SPS---LRVGTAPSGRFAKVRHALPMLSLDNAFADEDVDEFVTRVRRFLRLGEEEPLRLT 123

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG    +RYE+GKFV    RGDG  GED++  +  I  IP  L    P I+EVRG
Sbjct: 124 AEPKIDGLSANLRYEEGKFVLGTTRGDGTVGEDITRNLATIENIPARLE-GAPSILEVRG 182

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EVY+ K  F A+ND   A G K +ANPRNAA+G LR+ +P+    R L FF +  G+ S 
Sbjct: 183 EVYLGKEAFAAMNDAFAARGEKVFANPRNAAAGSLRQKDPSITADRPLRFFAYAWGEVSS 242

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
              + Q E ++++  LGF  N  +    T    +++Y  ++++R+ L YD+DG+VYKVD 
Sbjct: 243 PLGETQTEAVKRLSDLGFCTNELMGTFATAKEAIAHYRHIETLRAALDYDVDGVVYKVDR 302

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++LG  +RSPRW I+HKF+ ++A T L  IDIQ+GRTG LTP ARL PV +GG ++
Sbjct: 303 LDWQERLGAVSRSPRWAIAHKFSAEKAETVLERIDIQVGRTGALTPTARLRPVTVGGVVV 362

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHNED I  L           D+R GD V V+RAG+VIP+++ ++  +R  +AQP+
Sbjct: 363 SNATLHNEDEIARL-----------DVREGDSVCVQRAGDVIPQILSVLTEKRPKEAQPY 411

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S  VR+LN KTG+     RCTGGL C AQ +ERLKHFVSR A +I+GLG 
Sbjct: 412 RFPTHCPVCGSEAVRELNEKTGERDVVRRCTGGLICPAQGIERLKHFVSRKAMDIDGLGA 471

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDV--------------- 533
           +Q++ F+        I  PADIFTL  R    T    +++G  D+               
Sbjct: 472 RQIEDFYGRH----MIAEPADIFTLPARYHQGTF---DVIGTSDLNSYKRLAPTATKPAR 524

Query: 534 ---------SVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI 584
                    S+ NL+ +I   R+  L R IF+LGIRH+G    R +A+   +   F +  
Sbjct: 525 WTKEITNRKSLDNLFAAIEAARSRPLGRVIFALGIRHIGEMNGRLIAQGVETLSGFCRLG 584

Query: 585 NNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS 644
           + +   +      ++ +  +GD +  A+  F+  PRN  A++ L  E+SP+         
Sbjct: 585 DRLAKGDEAARQEMLAIDGIGDTVTDALAAFFHEPRNREALDRLAAEISPAAPPKPAQ-D 643

Query: 645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQL 704
           S    K +VFTG L+++ R +A+   T LGA VS  +S KTD ++ G   GSKL KA+ L
Sbjct: 644 SRFSGKTVVFTGKLERMSRDEAKARATSLGAKVSGSISAKTDYLVAGPGAGSKLTKAKDL 703

Query: 705 GVKIMNEEQFLFLLQQYNTTLRIH 728
           GV I+ E+++L  +     ++++ 
Sbjct: 704 GVDILTEDEWLEFISDEAVSVQLE 727


>gi|170739961|ref|YP_001768616.1| DNA ligase, NAD-dependent [Methylobacterium sp. 4-46]
 gi|254781369|sp|B0UQ51|DNLJ_METS4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168194235|gb|ACA16182.1| DNA ligase, NAD-dependent [Methylobacterium sp. 4-46]
          Length = 827

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 307/840 (36%), Positives = 455/840 (54%), Gaps = 136/840 (16%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M  +   P+E ++ E+AR    +L  EI+ HD  Y+    PII D+ YD+L+RR +AI  
Sbjct: 1   MAAQTTRPVEEITAEEARAAHEALSAEIAEHDRRYHGEDAPIISDAAYDSLRRRLEAIEE 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FPDLA +   +     +G + +    KV H++P LSL   +  E++ +F+ R+ RF   
Sbjct: 61  RFPDLAGTGAASA---SVGAKASDKFAKVRHAVPMLSLGNAFADEEIEEFVERVRRFLGL 117

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSL 179
               S+  T EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  +P R+   
Sbjct: 118 PASESLAVTAEPKIDGLSLSLRYEGGRLVTAATRGDGEVGEDVTANVRTIREVPERLAGP 177

Query: 180 NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNF 238
           ++PEI EVRGEVY+S  DF A+N      G+  +ANPRNAA+G LR+L+P+   +R L F
Sbjct: 178 DVPEICEVRGEVYLSHADFAAINARQEEAGKPLFANPRNAAAGSLRQLDPSITASRPLRF 237

Query: 239 FVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
           F +  G+ S   A+ Q  ++   R  G PVN    +  +   ++++Y  +++ R+ L YD
Sbjct: 238 FAYAAGEMSTWPAETQSGLIAAFRRFGLPVNPRTTRCTSVAEMLAHYRAIETERADLGYD 297

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD F+LQ++LG  AR+PRW ++HKF  ++A T +  I+I +GRTG L P+ARL
Sbjct: 298 IDGVVYKVDSFALQRRLGFVARAPRWALAHKFPAQRAVTTIEAIEINVGRTGSLNPLARL 357

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRG------------------GRDIRVGDR 400
            PV +GG +++NATLHNEDY++G+DA G  +R                   G D+RVGD 
Sbjct: 358 RPVTVGGVVVSNATLHNEDYVRGIDADGTPIRSGINIWDGFALRTDVDLSRGSDVRVGDT 417

Query: 401 VLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTG 460
           V+V RAG+VIPKV D+++  R  DA P+ FP  CP C S  VR  NP+TGKL +  RCTG
Sbjct: 418 VVVLRAGDVIPKVADVVLERRPADAVPYRFPEICPACGSHAVRSYNPRTGKLDSVRRCTG 477

Query: 461 GLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQ------ 514
           GL C AQ  ERLKHFVSR+A +IEG G+  +   F+    A  +R PAD+F L       
Sbjct: 478 GLICPAQGQERLKHFVSRNALDIEGFGETSITTLFE----AGLVRQPADLFRLDFAPLKA 533

Query: 515 ----RRQQTSTTKIENILGFG---------------DVSVTNLYDSINKRRNISLERFIF 555
               RRQ  S    E  L  G               D ++ NL  ++  RR + L RFIF
Sbjct: 534 AIVARRQALSA---ERALASGKAPEARKTKAKASEEDKAIRNLLAAVEARRVVPLNRFIF 590

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN-NDDWLSLIRVPLVG--------- 605
           +LGI  VG   A++LAK++       + +    AH    DW+ L  +  VG         
Sbjct: 591 ALGIEQVGEATAKALAKHFPDMPALMEGVRAAAAHQPGPDWVGLAALNRVGPTTRERLLA 650

Query: 606 -------DIIA------------QAIVEFYQNPR-------------------------- 620
                  D++A            +A++E Y +P                           
Sbjct: 651 AAEAGETDLLAEGTVARLSAAQKEALLEAYGSPEGVRAAVMRACRQRPGDAYRHLADDSE 710

Query: 621 -----------------NICAVEALLKEVSPSIGRHEK----NVSSEIENKKLVFTGTLQ 659
                            N+ AVEALL +V     R E+      ++    + +VFTG+L+
Sbjct: 711 IGAVTTASLIQFFSEAHNVAAVEALLAQV-----RTERAAPPAAAAAFSGRTVVFTGSLE 765

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           ++ R +A+    +LGA VS  +S KTD+++ G   G+KL+ A++ GV++++E ++L +++
Sbjct: 766 RMTRSEAKATAERLGAKVSGSVSAKTDLVVAGPGAGTKLKDAEKHGVRVISEAEWLAMVE 825


>gi|83312957|ref|YP_423221.1| NAD-dependent DNA ligase [Magnetospirillum magneticum AMB-1]
 gi|123726860|sp|Q2W0G3|DNLJ_MAGMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|82947798|dbj|BAE52662.1| NAD-dependent DNA ligase [Magnetospirillum magneticum AMB-1]
          Length = 698

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 293/722 (40%), Positives = 440/722 (60%), Gaps = 39/722 (5%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           +IP+EAL+  +AR E + L + I+  D+ Y+    P + D  YD  KRR   I   FP+L
Sbjct: 1   MIPVEALTPFEARIEHAELVETIARWDEAYHAKDAPEVPDDVYDGAKRRLARIEGRFPEL 60

Query: 66  ARSEDPNGPL-NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           A       P+ +K+G   +    K+ H++P LSL+  +  ED+ +F  ++ RF    D+ 
Sbjct: 61  A----AKSPIRDKVGAAPSEGFGKLVHAVPMLSLDNAFAPEDVAEFDAKVRRFLGLGDEA 116

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPT--IPRVLSLNIP 182
            + +  EPKIDG  I +RYE G+FV AA RGDG  GEDV+  +   P   +PR L  + P
Sbjct: 117 PLAYVAEPKIDGLSINLRYEGGRFVSAATRGDGAEGEDVTRNLETFPATQLPRTLGPDAP 176

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVH 241
            +IE+RGEVY++K DFLALN    A G K +ANPRNAA+G LR+L+P    +R L+ F +
Sbjct: 177 AVIEIRGEVYMTKADFLALNQRQEAAGEKLFANPRNAAAGSLRQLDPKVTASRPLSLFAY 236

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
            +G+ S   A   +E L++++  GF VN  +R+ +   G++S Y  +   R+TL YDIDG
Sbjct: 237 AMGEASAPPAASHWEYLERLKAWGFVVNPLIRRCDGVAGLLSAYESLGEARATLAYDIDG 296

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD+  LQ++LG  +RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL PV
Sbjct: 297 IVYKVDDIELQRRLGFVSRSPRWAIAHKFPAEQATTLLEAIDIQVGRTGALTPVARLTPV 356

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
           N+GG +++NATLHNED I             +D+R+GD V+V+RAG+VIP++V ++  + 
Sbjct: 357 NVGGVVVSNATLHNEDEI-----------ARKDVRIGDTVIVQRAGDVIPQIVGVVPGKP 405

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
              A PF +P  CP+C +  VR      G+++   RCTGGL C AQ  ERLKHFVSR+AF
Sbjct: 406 R-GAVPFVYPETCPVCGAHAVR----PEGEVI--RRCTGGLTCEAQAKERLKHFVSRNAF 458

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTS-TTKIENILGFGDVSVTNLYD 540
           +IEGLG++ ++F ++       +R PADIF L+ R       ++EN  G+G  S   L++
Sbjct: 459 DIEGLGEKNIEFLWEKG----WVRGPADIFRLKARNDAELLQRLENFEGWGKRSTEKLFE 514

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           SI  R  + LERFIF+LGIR +G   A+ LA++Y S+  +      ++A   +    L  
Sbjct: 515 SIKTRSAMGLERFIFALGIRQIGEATAKRLARHYGSFGAWRA---AMLAGTEEARAELTS 571

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE-----KNVSSEIENKKLVFT 655
           +  +G  +A  +++F+    N+ AV+ L+  ++   G  E     ++ +S +  K +VFT
Sbjct: 572 IEDIGPSVAGDLLDFFSEEHNVQAVDDLVAAMAALDGAVEDAKVIESSASPVAGKAVVFT 631

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTL  + R +A+     LGA V   +S+KTD ++VG + GSK  +A +LG+  ++E+++L
Sbjct: 632 GTLVTMTRPEAKARAEALGAKVVGSVSKKTDYVVVGADAGSKAAEAVKLGIATLSEQEWL 691

Query: 716 FL 717
            L
Sbjct: 692 AL 693


>gi|126737638|ref|ZP_01753368.1| DNA ligase, NAD-dependent [Roseobacter sp. SK209-2-6]
 gi|126721031|gb|EBA17735.1| DNA ligase, NAD-dependent [Roseobacter sp. SK209-2-6]
          Length = 749

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 304/756 (40%), Positives = 438/756 (57%), Gaps = 64/756 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PI  LS  +A++EL+ L+  I   D  ++ +    I D  YD  KRR   +   FP L  
Sbjct: 4   PISDLSENEAQEELNELKLLIWSADRLHHTHDISEISDGAYDREKRRLKELVDTFPKLRP 63

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
             +    L+ +G        K++H+IP LSL   +   D+  F   I  +  +  D S+ 
Sbjct: 64  QAEK--ILDSVGAPAASGFGKISHAIPMLSLGNAFEDGDVADFTKGIRNYLGQSADQSLA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT EPKIDG  +++RYE G+ V+ A RGDG +GEDV+   R I  IP+VL+   PEI+EV
Sbjct: 122 FTAEPKIDGLSLSLRYENGRLVHGATRGDGSTGEDVTENARTIADIPQVLT-GAPEILEV 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGK 245
           RGEVY+S  DF  LN      G K +ANPRNAA+G LR+L+  ++TR   L FF +  G+
Sbjct: 181 RGEVYMSHADFATLNARQEEQGGKSFANPRNAAAGSLRQLD-AEVTRARPLRFFAYSWGE 239

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE  AK Q+E ++++  LGF  N       +   ++++Y  ++  R+TL YDIDG+VYK
Sbjct: 240 LSEPLAKTQFEAIERLSVLGFQTNELTALCTSVEEMIAHYRRIEEQRATLGYDIDGVVYK 299

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++ +LQ +LG RA +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 300 VNDMALQARLGFRATTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGG 359

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI+G D  G+ +RGG++IRVGD V + RAG+VIPKV D+ + +R  + 
Sbjct: 360 VVVSNATLHNEDYIQGRDNKGEEIRGGKEIRVGDWVQIYRAGDVIPKVADVDIRKRTGNE 419

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF+FP+ CP C S  VR+         A  RCTGGL C AQ +E+LKHFVSR AF+I+G
Sbjct: 420 IPFAFPTTCPECGSEAVREEGD------AVRRCTGGLICPAQAIEKLKHFVSRKAFDIDG 473

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +QL+ FF  ED    IR P DI+ L++R   +  K++N  G+G  S  NL+ +I ++
Sbjct: 474 LGAKQLEMFF--EDTDLPIRTPVDIYRLEQRDGENLAKLKNRHGWGAQSAENLFAAITQK 531

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQ-------------------NFAQEIN- 585
           R I L R IF LGIRHVG   A+ LA ++ S+                    + A+E   
Sbjct: 532 RRIPLGRMIFGLGIRHVGEVAAKDLALHFGSWADLAAAVDLAREAALAHRAADLAEEKER 591

Query: 586 -----------------------NIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNI 622
                                   + A   + W  LI +  +G  +  ++ +   N    
Sbjct: 592 QAAAAEGRRARIKETRDLEVSRLEVSASARESWEDLIGIDGIGATVGLSLSDALANVEER 651

Query: 623 CAVEALLKEV---SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSA 679
             ++AL+ E+   +P+    E    S +  K +VFTG L+K+ R +A+     LGA VS 
Sbjct: 652 SVIDALVHELEIEAPAAPAQE----SPVAGKTVVFTGKLEKMTRDEAKARAEALGAKVSG 707

Query: 680 ILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            +S+KTDI++ G   GSK +KAQ+LG++I++EE +L
Sbjct: 708 SVSKKTDILVAGPGAGSKEKKAQELGIEILDEEGWL 743


>gi|114768813|ref|ZP_01446439.1| DNA ligase [alpha proteobacterium HTCC2255]
 gi|114549730|gb|EAU52611.1| DNA ligase [alpha proteobacterium HTCC2255]
          Length = 711

 Score =  528 bits (1361), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 287/720 (39%), Positives = 440/720 (61%), Gaps = 20/720 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E L   QA KEL  L + +   +  YY    PI+ D+EYD LK+R   I   FP+L  
Sbjct: 6   PVEKLDKMQAEKELIRLNEILDRANSDYYSNDAPILSDAEYDTLKKRNLDIESRFPNLKL 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               N   +KIG + + +  K+ H++  LSL   ++ +D+  F  R+ +     +D  I 
Sbjct: 66  K---NSVSDKIGSKPSSTFKKIKHTVKMLSLANGFDEQDIIDFDQRVKKILGF-EDRVIS 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           +  EPKIDG  ++++Y  GK   A  RGDG  GE+V+     I  IP+ +  N P I+E+
Sbjct: 122 YVAEPKIDGLSLSLKYIDGKLFQATTRGDGEVGENVTENAITIQNIPKYIH-NAPSILEI 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEVY+S NDF  LN +   +  K ++NPRNAA+G LR+L+     +R L F+ +  G+ 
Sbjct: 181 RGEVYMSLNDFNELNIKQKNIDAKIFSNPRNAAAGSLRQLDSKVTASRPLKFYAYAWGEV 240

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S   +  QY  + ++R  GF  N+  ++      ++S+Y+ + + R+ L YDIDG+VYKV
Sbjct: 241 STPISDTQYNAIDRLRKFGFSTNDLTKKCYGPKELISHYDNISNKRADLGYDIDGVVYKV 300

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D  S Q +LG R+ +PRW I+HKF  + A T L  I+IQ+GRTG L+PVARL+PVN+GG 
Sbjct: 301 DNLSYQDRLGFRSTTPRWAIAHKFPAEIAQTWLESIEIQVGRTGALSPVARLKPVNVGGV 360

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYIKG D+ G ++RGG DIR GD V V RAG+VIPK+ D+ V++R   ++
Sbjct: 361 IVSNATLHNEDYIKGKDSKGNIIRGGNDIREGDWVYVYRAGDVIPKISDVDVSKRISTSK 420

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P++FPSFCP C S   R      G  VA  RC GG+ C AQ ++ L HFVSR AF+I+GL
Sbjct: 421 PYTFPSFCPECSSPSER----IEGDSVA--RCIGGITCPAQAVQGLAHFVSRGAFDIDGL 474

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F++       ++ PADIF L+ R +    ++EN  G+G  S  NL+++I  +R
Sbjct: 475 GNKQIEQFYQ----LGWVKEPADIFKLKLRYENGIKRLENRDGWGQKSANNLFNAIESKR 530

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I L + +++LGIRHVG   A  L+K+Y S+ N  + +N   +     W  L+ +  VG+
Sbjct: 531 TIPLNKMLYALGIRHVGETSATLLSKHYKSFDNLKKSMNEAKSLEGSSWSDLMSIDGVGE 590

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV--SSEIENKKLVFTGTLQKIQRH 664
           I+A+A+V+ + NP     ++ L++E+   I    +N+   S +E   +VFTG+L+ + R 
Sbjct: 591 ILAKAVVQIFNNPAQRQIIDNLVEEL--VIENEIENIVSGSPLEGMVVVFTGSLELMTRS 648

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTT 724
           +A+    + GA VS  +S+KTD+++ G   GSK +KA +LGVK+++E ++L L+   N +
Sbjct: 649 EAKISAEKFGAKVSGSVSKKTDLVVSGPGAGSKEKKAIELGVKVLSESEWLKLINLNNLS 708


>gi|254465633|ref|ZP_05079044.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium Y4I]
 gi|206686541|gb|EDZ47023.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium Y4I]
          Length = 750

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 301/755 (39%), Positives = 443/755 (58%), Gaps = 61/755 (8%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + AL+ E AR E  +LE ++   D  Y+Q   P I D+EYD+LK+R  A+A AFPDLA  
Sbjct: 9   VTALTAEDARAEFLALEDQLRAADLAYHQADAPEISDAEYDSLKQRYRALAEAFPDLA-- 66

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            D    L+ +G        K+TH++  LSL   +  ED+  F   + ++     + ++ +
Sbjct: 67  -DAATHLDAVGAPAASGFGKITHAVRMLSLGNAFAEEDVTDFDRSVRKYLGLGGEAALGY 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE+GK V AA RGDG  GE+V+A  R I  IP+ L+   PE++EVR
Sbjct: 126 TAEPKIDGLSLSLRYEQGKLVQAATRGDGSVGENVTANARTISDIPQHLT-GAPEVLEVR 184

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKT 246
           GEVY+S  DF ALN      G K +ANPRNAA+G LR+L+  +ITR   L FF +  G+ 
Sbjct: 185 GEVYMSHADFEALNARHAERGGKIFANPRNAAAGSLRQLD-AEITRARPLRFFAYSWGEL 243

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S   A+ Q E +++++ LGF  N   R   +   ++ +Y  ++  R+TL YDIDG+VYKV
Sbjct: 244 SAPLAETQMEAIERLQSLGFQTNPLTRLCTSVADMIDHYRSIEEQRATLGYDIDGVVYKV 303

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++ +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG 
Sbjct: 304 NDLALQGRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGGV 363

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNEDYI+G D+ G+ +RGG+DIR+GD V + RAG+VIPKV D+ +++R   A+
Sbjct: 364 VVSNATLHNEDYIQGRDSKGEEIRGGKDIRIGDWVQIYRAGDVIPKVADVDLSKRPQHAE 423

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C S   R+         A  RC+GGL C AQ +E+LKHFVSR AF+IEGL
Sbjct: 424 PYQFPHTCPECGSPAEREEGD------AVRRCSGGLICPAQAVEKLKHFVSRAAFDIEGL 477

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F         I+ PADIF LQ    +   +++N  G+G+ S  NL+ +I ++R
Sbjct: 478 GAKQVEQFHSD----GWIKEPADIFDLQANYGSGLQQLKNREGWGEKSADNLFAAIEEKR 533

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-------------------------- 580
            I L + IF+LGIRH G    R LA +Y  +Q                            
Sbjct: 534 TIPLAKLIFALGIRHAGEVAGRDLALHYRDWQGMAAALDAARPAALAHRAADEAEEAERQ 593

Query: 581 --AQE---------------INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNIC 623
             A+E                  + A     W  LI V  +G ++  ++ + + NP    
Sbjct: 594 SAAEEGRRARISETRAAAIAACEVPAEAASAWADLIGVDGIGAVLGLSLSDAFANPEERA 653

Query: 624 AVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
           A++ L+ +++  +        S +  K +VFTGTL+K+ R +A+     LGA VS  +S+
Sbjct: 654 AIDRLVAKLT-VVPPDAPAADSPVAGKTVVFTGTLEKMTRAEAKARAEALGAKVSGSVSK 712

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           KTDI++ G   GSK +KA +LG++ ++E+ +L L+
Sbjct: 713 KTDILVAGPGAGSKAKKAAELGIQTLDEDGWLELI 747


>gi|126729669|ref|ZP_01745482.1| DNA ligase, NAD-dependent [Sagittula stellata E-37]
 gi|126709788|gb|EBA08841.1| DNA ligase, NAD-dependent [Sagittula stellata E-37]
          Length = 714

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 295/709 (41%), Positives = 437/709 (61%), Gaps = 17/709 (2%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++ +QAR+EL +L   +   +  Y+    P + D+EYD LKRR   I   FP L  ++ P
Sbjct: 19  MTEDQAREELRALSDILGQANRAYHAEDAPELTDAEYDRLKRRNAEIEARFPQLKLADSP 78

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    ++G        KV H +  LSL   ++ +D+R F   I R+     D  + FT E
Sbjct: 79  S---EQVGAAPVDGFSKVRHEVRMLSLANAFDDDDIRDFDDSIRRYLGLGTDAPLAFTAE 135

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  + +RYE GK V AA RGDG  GEDV+A  R I  IP  L+   PE++EVRGEV
Sbjct: 136 PKIDGLSLALRYENGKLVRAATRGDGSEGEDVTANARTIDDIPTDLT-GAPEVLEVRGEV 194

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI 249
           Y+S  DF ALN+   A G K +ANPRNAA+G LR+L+   IT  R L FF +  G  S+ 
Sbjct: 195 YMSHADFEALNERQTARGGKTFANPRNAAAGSLRQLD-AKITAERPLKFFAYAWGVLSDP 253

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A+ Q   + ++  LGF  N      +    ++++Y ++++ R+TL YDIDG+VYKV++ 
Sbjct: 254 LAETQKGAIDRLNALGFQTNPLTALCDGPEEMLNHYRKVEAQRATLGYDIDGVVYKVNDL 313

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG +++
Sbjct: 314 ALQERLGFRSTTPRWAIAHKFPAELAWTRLESIDIQVGRTGALSPVARLTPVTVGGVVVS 373

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI G D+SG  +RGG+DIR+GD V V RAG+VIPKV D+ +++R  DAQP+ 
Sbjct: 374 NATLHNEDYIAGRDSSGNEIRGGKDIRIGDWVQVYRAGDVIPKVADVDLSQRPEDAQPYV 433

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP C S  +R+         A  RC+GGL C AQ +E+LKHFV R AF+IEGLG +
Sbjct: 434 FPTKCPECGSDAIREEGD------AVRRCSGGLICPAQAVEKLKHFVGRSAFDIEGLGAK 487

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++ F+        IR P DIFTL+ R  +   +++N  G+G+ S  NL+ +I++RR+I 
Sbjct: 488 QVEQFYAD----GWIREPVDIFTLRDRYGSGIQQLKNREGWGEKSALNLFSAIDERRHIP 543

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L R IF LGIRHVG   +  LA++Y ++  F   + +      + W  L+ +  VG ++A
Sbjct: 544 LGRLIFGLGIRHVGESASNLLARHYGTWAIFEAAMKDAATMEGEAWDDLLSINGVGTVLA 603

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           Q++V          +++ L+  +            S +  K +VFTG+L+++ R +A+  
Sbjct: 604 QSLVSAMNQEAERASMDRLVAHLDVEEAVRPDTDGSPVAGKIVVFTGSLERMTRAEAKAR 663

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
              +GA VS  +S+KTDI+++G   GSK +KA++LG+ +++E+ +L L+
Sbjct: 664 AEAMGAKVSGSVSKKTDIVVIGPGAGSKEKKARELGLTVLDEDAWLELI 712


>gi|163794455|ref|ZP_02188426.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
 gi|159180179|gb|EDP64702.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
          Length = 696

 Score =  525 bits (1352), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 284/714 (39%), Positives = 419/714 (58%), Gaps = 29/714 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E LS  +A+ EL  L   IS  D  Y+    P++ D+EYDAL+RR  AI   FPDL  
Sbjct: 11  PVEELSDAEAKAELRRLSDAISEADRQYHVEDAPVLTDAEYDALRRRNQAIEERFPDLKL 70

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P+    ++    +    KV H+ P LSL   +N ED+ +F  R+ RF    +++ + 
Sbjct: 71  ADSPS---ERVAPGPSEGFSKVRHARPMLSLANAFNDEDVHEFARRVRRFLSLGEEDELA 127

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
              EPKIDG    +RY  G+    A RGDG  GE+++  +  +  +P  L   +P I+EV
Sbjct: 128 LVAEPKIDGLSAALRYVDGRLEVGATRGDGTEGENITRNLETLDDVPTTLPAGVPGILEV 187

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY++K+DF+ALND     G K +ANPRNAA+G LR+L+PT    R L FF +  G+ 
Sbjct: 188 RGEVYMTKDDFVALNDRQAKAGGKIFANPRNAAAGSLRQLDPTITAARPLRFFAYSWGEI 247

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A   +E L+K+   GF  N   ++  +    ++ Y ++   R+TLPYDIDG+VYKV
Sbjct: 248 SENIADTHWEFLKKLEAWGFTTNPLSQRCESVESALAVYADIGERRTTLPYDIDGVVYKV 307

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG  +R+PRW I+HKF  +QA T L  I+IQ+GRTG LTPVARLEPV + G 
Sbjct: 308 DRLDWQQRLGMVSRAPRWAIAHKFKAEQAETVLKAIEIQVGRTGALTPVARLEPVKVAGV 367

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHNE         G++ R  +D+RVGD V+++RAG+VIP+VV +I+ +R  D+ 
Sbjct: 368 TVSNATLHNE---------GEIRR--KDVRVGDTVVIQRAGDVIPQVVRVILEKRPADSV 416

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP C S    D     G+ +   RCTGGL C AQ +ERLKHFVSRDAF+IEGL
Sbjct: 417 EYVFPETCPECGS----DAEQPEGEAI--RRCTGGLICPAQAVERLKHFVSRDAFDIEGL 470

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+D F+ +      I+ P DIF L++ +     +     G   +S  NL  +I  RR
Sbjct: 471 GSKQIDGFYSN----GLIKRPGDIFRLKQHRDVLIGE----KGTKTISTDNLLAAIEDRR 522

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I  +RFI+SLGIR VG   AR LA  Y + +     +       ++    L+ +  +G 
Sbjct: 523 SIGFDRFIYSLGIRQVGQATARLLAINYGTLEALRTAMAAAHDPESEAHADLLNIDQIGS 582

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +A+ + +F+    N   ++ L  E++ +         S I  K +VFTGTL +I R++A
Sbjct: 583 SVAKDLADFFAEDHNAEVLDDLAAELTIAPFAAPAASDSPIAGKTVVFTGTLTRIGRNEA 642

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +     LGA V+  +S+KTD +I+G + GSK  KA+ LGV  ++E+++  L+ +
Sbjct: 643 KAKAESLGAKVAGSVSKKTDYVIIGADAGSKAAKAEALGVPTLSEDEWFTLIGE 696


>gi|297717812|gb|ADI50049.1| DNA ligase [Candidatus Odyssella thessalonicensis L13]
          Length = 676

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 275/697 (39%), Positives = 416/697 (59%), Gaps = 26/697 (3%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L + I+YHD+ Y+Q   P I D+ YDAL  R   I + FPDL R + P+    ++G  ++
Sbjct: 1   LAKTIAYHDELYFQKDMPQISDAAYDALVVRNRQIENLFPDLRREDSPS---KRVGAPVS 57

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H IP LSLE  +  +D+  F  R+ RF     D       EPKIDG    + Y
Sbjct: 58  KGFKKVKHRIPMLSLENAFTSDDVINFFERVRRFLSLPSDQEFPIVAEPKIDGLSAALHY 117

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKNDFLALN 202
           ++GK   AA RGDG  GED++  +R I  +P+ L   N+PE +EVRGE+Y++++DF ALN
Sbjct: 118 QRGKLRLAATRGDGSEGEDITENVRCIIDVPQTLIGKNVPESLEVRGEIYMNRSDFFALN 177

Query: 203 DEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSEIFAKGQYEMLQKM 261
            +        +ANPRNAA+G +R+L+PT   R  L FF +     S       +E L+ +
Sbjct: 178 QQRQQESEPEFANPRNAAAGSVRQLDPTVTARRPLRFFAYYYDAISGDTTMTHHEALENL 237

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
           R  GF VN  ++   +   +  YYN + + R+ LPYDIDG+VYK+D    Q++LG   R+
Sbjct: 238 RRWGFTVNPEIQLCLSIAQLQDYYNSINARRADLPYDIDGVVYKIDALQWQRRLGSVGRT 297

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PR+ ++HKF  ++A T L DI IQ+GRTG+LTPVA L+PV +GG +++ ATLHN D I  
Sbjct: 298 PRYALAHKFEAEKAETILEDIAIQVGRTGVLTPVAHLKPVTVGGVVVSRATLHNADEI-- 355

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRV 441
                      +D+RVGD V+++RAG+VIP++V ++  +R P++Q F FP+ CP C   +
Sbjct: 356 ---------ARKDVRVGDHVIIQRAGDVIPQIVSVVKEKRLPESQSFDFPATCPACGGEI 406

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
           V       G++  A RC   L C AQ +ERLKHFVSRDAF+IEGLG + ++ F++     
Sbjct: 407 VY----VPGEV--ARRCMNRLLCPAQAVERLKHFVSRDAFDIEGLGNRNIEAFYEEG--- 457

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             I  P DIFTL  R + S T +    G+G  S  NL+++I  RR I+L+RFI++LGI  
Sbjct: 458 -LIHSPVDIFTLAARDRESLTPLRAKEGWGSQSAANLFEAIENRRTITLDRFIYALGIPQ 516

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           VG+  A+ LA++Y +  N    +        D ++ L+ +  +G  +A+ I+ F+    N
Sbjct: 517 VGSVTAKLLARHYHTLPNLLNTLQQAQDPTTDAYVDLLSLDGIGKNMAEDILSFFHEAHN 576

Query: 622 ICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL 681
           +  ++AL  E+S      E + +S +  K +VFTGTL ++ R +A+    +LGA V+  +
Sbjct: 577 LKVIDALSHELSIPAYALEMSTTSAVSGKTVVFTGTLTRMSRAEAKATAERLGAKVAGSV 636

Query: 682 SRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           S+KTD++IVG + GSK   A +LGV++++E Q++ L+
Sbjct: 637 SKKTDLVIVGADAGSKARAAAELGVQVLDENQWMALI 673


>gi|83592275|ref|YP_426027.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
 gi|123753272|sp|Q2RVV5|DNLJ_RHORT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83575189|gb|ABC21740.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
          Length = 698

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 288/718 (40%), Positives = 433/718 (60%), Gaps = 35/718 (4%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           +IP+  L+  +A +EL  L  EI+ HD  Y+Q   P I D EYDAL RR + I  AFP+L
Sbjct: 1   MIPVADLTEAEAARELERLAAEIARHDRLYHQQDAPEITDGEYDALVRRNNEIEAAFPEL 60

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R + P+     +G        KVTH++P LSL  +++ ++ R+F  RI RF     + +
Sbjct: 61  VRGDSPSA---HVGAAPAEGFAKVTHALPMLSLGNVFSDDEAREFDQRIRRFLSLDGETT 117

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN--IPE 183
           I +  EPKIDG   + RYE G +  AA RGDG +GED++A +  +  +P+ L+ +  +PE
Sbjct: 118 ISYVAEPKIDGLSFSARYENGVYRRAATRGDGTTGEDITANLATLTDLPQRLTGDGPVPE 177

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVH 241
           ++EVRGEV+++K DF ALN   I  G KP+ANPRNAA+G LR+L+P +ITR   L+ F +
Sbjct: 178 VLEVRGEVFMTKADFRALNQRQIDAGAKPFANPRNAAAGSLRQLDP-EITRSRSLSLFAY 236

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+   +  +  +  L++++  GFPVN   R       ++   + +   R+ L YDIDG
Sbjct: 237 ASGEVKGLEVESHHAFLERLKTWGFPVNPQTRPCQGVEDLIEATHALALQRAALDYDIDG 296

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD    QK+LG  +R+PRW I+ KF  ++A T +  I IQ+GRTG LTPVA LEPV
Sbjct: 297 VVYKVDRVDWQKRLGFVSRAPRWAIARKFPAERAQTTVKAIQIQVGRTGTLTPVAILEPV 356

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG ++  ATLHNED I             +D+R+GD V ++RAG+VIP+VV++++++R
Sbjct: 357 TVGGVVVGRATLHNEDEI-----------ARKDVRIGDMVTIQRAGDVIPQVVEVLLDQR 405

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
             D+ PF FP  CP+C S  VR    + G++  A RC GGL CSAQ +ERLKHFVSRDAF
Sbjct: 406 PADSAPFVFPETCPVCGSHAVR----QEGEV--ARRCAGGLICSAQAVERLKHFVSRDAF 459

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRR--QQTSTTKIENILGFGDVSVTNLY 539
           +IEGLG + ++ F         I  PADIF L+ +  +  +   + +  G+G  S  NL+
Sbjct: 460 DIEGLGGKHIETFHNEG----LITQPADIFALEAKDNEPGALQHLRSREGWGPKSAENLF 515

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
            +I  R+ I L+RFI++LGIR VG   AR LA +Y S+  + + ++      ++ +  L 
Sbjct: 516 KAITARKTIPLDRFIYALGIRQVGQATARLLAGHYASFAAWRKAMDEAQTEGSEAFADLQ 575

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLK---EVSPSIGRHEKNVSSEIENKKLVFTG 656
            +  +G  +A+ +V F+    N  A++AL+    EV     R +    S +  K +VFTG
Sbjct: 576 NIESIGPSVARDLVAFFGEEHNRAALDALIDAGVEVL-DFARPQAAGDSPLAGKTVVFTG 634

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TL  + R +A+     LGA V+  +S KTD ++VG + GSK +KA++LG+ +++E +F
Sbjct: 635 TLDTMSRGEAKARALALGAKVTGSVSAKTDYVVVGADAGSKEKKARELGLTVLSEAEF 692


>gi|258542980|ref|YP_003188413.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634058|dbj|BAI00034.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637118|dbj|BAI03087.1| DNA ligase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640170|dbj|BAI06132.1| DNA ligase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643227|dbj|BAI09182.1| DNA ligase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646282|dbj|BAI12230.1| DNA ligase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649335|dbj|BAI15276.1| DNA ligase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652321|dbj|BAI18255.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655379|dbj|BAI21306.1| DNA ligase [Acetobacter pasteurianus IFO 3283-12]
          Length = 685

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 288/709 (40%), Positives = 421/709 (59%), Gaps = 38/709 (5%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++ +QAR+EL  L  EI++H+  YY+   P I D+EYDAL+RR DAI    P+   +E  
Sbjct: 1   MTQQQAREELERLAAEIAHHNAAYYRNDAPEISDAEYDALRRRYDAIVAQHPE---AEPE 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS--IFFT 129
           N     +G   + +  K  H +P LSL+ +++ ED   FI+R  RF     D +  + F 
Sbjct: 58  NSAAQAVGAAPDTAFGKHIHLVPMLSLDNVFDREDFEGFISRATRFLGLDQDATEQLIFV 117

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  I++ YEKG+FV    RGDG  GEDV+A +R +  +P  LS + P++IE+RG
Sbjct: 118 GEPKIDGLSISLTYEKGRFVRGTTRGDGTEGEDVTANLRTLKDLPLRLSGSYPDLIEIRG 177

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EV++SK  FL LN    A  ++ +ANPRNAA+G LR+L+P     R L+ F + LG  SE
Sbjct: 178 EVFLSKKHFLELNAAQEAANKRLFANPRNAAAGSLRQLDPKITAQRPLSLFAYALGFCSE 237

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             ++  +  L++++  GFPVN   RQ        +++ E+   R+ L YDIDG+VYK+D+
Sbjct: 238 KISRSHWAYLEQLKAWGFPVNPLSRQIKGVEDAEAFFAEVSQSRAELAYDIDGVVYKIDD 297

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ++LG   R+PRW I+ KF  +QA TRL +I+IQ+GRTG LTPVA LEPVN+GG L+
Sbjct: 298 LALQERLGFAGRAPRWAIAWKFPAEQAITRLKEIEIQVGRTGALTPVAHLEPVNVGGVLV 357

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN-ERHPDAQP 427
             ATLHNED I             +D+R GD V ++RAG+VIP+V+ +  + +  P   P
Sbjct: 358 MRATLHNEDEI-----------ARKDVRPGDMVFIQRAGDVIPQVLGVAPSPDGTPRQAP 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           + FP  CP+C +  VR          A  RCTGGL C AQ +ERL HFVSR AF+IEGLG
Sbjct: 407 YHFPDHCPVCGAAAVRPEGE------AVRRCTGGLTCPAQVVERLIHFVSRQAFDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + +  F    D    I  P DIF L          IE   G+G+ SV  L  +I  RR 
Sbjct: 461 DRSIREF---HDIGL-ILTPGDIFRLHEH----AADIEKRDGWGEQSVQKLLQAIESRRT 512

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           ISL RFI++LGIR +GA  AR LA++Y +Y+N+  ++       +D  L L  +  +G  
Sbjct: 513 ISLSRFIYALGIRRIGASNARLLARHYGTYENWFSQMQAAAIIGSDARLELGSITGIGTT 572

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKIQRHK 665
            A+ +V F     N+      L ++  ++   E+  +SE  +  K +VFTGTL  + R +
Sbjct: 573 TAEDLVAFVAEEHNL----QTLADLHANLTITEETAASEGALAGKTIVFTGTLHTMTRPE 628

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           A+    ++GA VS  +S+KTD++++G+  GSK +KA +LG++ M+E ++
Sbjct: 629 AKATAERMGAKVSDSVSKKTDLVVLGEKAGSKAKKAVELGLQTMDEAEW 677


>gi|89054995|ref|YP_510446.1| DNA ligase, NAD-dependent [Jannaschia sp. CCS1]
 gi|123401112|sp|Q28PE1|DNLJ_JANSC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|88864544|gb|ABD55421.1| DNA ligase NAD-dependent [Jannaschia sp. CCS1]
          Length = 752

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 289/747 (38%), Positives = 438/747 (58%), Gaps = 58/747 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
            S + A+  L+ L + +S  +  Y+    P + D++YDALKR   AI  AFPDL R++ P
Sbjct: 15  FSADAAKTRLAELAKRLSDANTAYHAADAPDLSDADYDALKRENAAIEAAFPDLKRADSP 74

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +   +++G        K+TH+   LSL   ++  D+  F+  I R+     +  + FT E
Sbjct: 75  S---DQVGAAPAEGFSKLTHTQRMLSLANAFDAGDVPDFVAGIRRYLNLGAEADLPFTAE 131

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I  IP+ L+ + P+++EVRGEV
Sbjct: 132 PKIDGLSLSLRYEDGQLVSAATRGDGAIGENVTANARTIDDIPQTLT-DAPDVLEVRGEV 190

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEI 249
           Y+S  DF ALND     G K +ANPRNAA+G LR+L+ + ITR   L FF +  G+ S  
Sbjct: 191 YMSHADFAALNDRQAEAGAKTFANPRNAAAGSLRQLDAS-ITRSRPLRFFAYAWGEVSAP 249

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A  Q   L  ++ LGF +N+  +  ++   ++++Y  ++  R+ L YDIDG+VYK+D+ 
Sbjct: 250 LAATQSGALNTLKTLGFQINDRTKTCHSAEDMLAHYASIEQDRADLGYDIDGVVYKIDDL 309

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG +++
Sbjct: 310 DYQRRLGMRSTTPRWAIAHKFPAELAWTTLEAIDIQVGRTGALSPVARLTPVTVGGVVVS 369

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNEDYI G DA+G  +R G+DIRVGDRV V RAG+VIPKV D+ + +R  +   ++
Sbjct: 370 NATLHNEDYIAGRDANGGPIRDGKDIRVGDRVQVYRAGDVIPKVADVDLAKRPENTAKYA 429

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP CQS  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+I+GLG +
Sbjct: 430 FPDHCPQCQSEAIREEGD------AVRRCTGGLICPAQAVEKLKHFVSRAAFDIDGLGAK 483

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
           Q++ F+        I  PADIF L+        ++ N  G+G+ S T+L+++I+ +R+I+
Sbjct: 484 QVEAFYLD----GWIAEPADIFRLKENYGEGMKQLRNREGWGEKSATSLFNAIDDKRSIA 539

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII----AHNNDD----------- 594
           L R IF+LGIRHVG   A  LA+++ +++  A+ ++       AH   +           
Sbjct: 540 LHRLIFALGIRHVGEVAASDLARHFTTWKALAEIVDQAAPAAEAHRRAEDAVLAERKAAA 599

Query: 595 --------------------------WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL 628
                                     W  L  +  +G  +A ++V  +Q  R   +++ L
Sbjct: 600 DEGRRASLQPQRDKAWADTPEPAKAAWDDLTGIDGIGATVAVSLVTTFQQARERASIDRL 659

Query: 629 LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDII 688
           + E++       +   S +    +VFTG L+++ R +A+     +GA VS  +S KTDI+
Sbjct: 660 ITELTDIQPPEARATQSAVAGLTVVFTGALERMTRAEAKARAEAMGAKVSGSVSAKTDIV 719

Query: 689 IVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           + G   GSK +KA+ LG++++ EEQ+L
Sbjct: 720 VAGPGAGSKEKKAKDLGIELLTEEQWL 746


>gi|329115587|ref|ZP_08244309.1| DNA ligase [Acetobacter pomorum DM001]
 gi|326695015|gb|EGE46734.1| DNA ligase [Acetobacter pomorum DM001]
          Length = 710

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 288/710 (40%), Positives = 421/710 (59%), Gaps = 40/710 (5%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++++QAR+EL  L  EI++H+  YY+   P I D+EYDAL+RR DAI    P   ++E  
Sbjct: 26  MTLQQAREELEHLAAEIAHHNAAYYRNDAPEISDAEYDALRRRYDAIVAQHP---QAEPE 82

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFW--QKKDDNSIFFT 129
           N     +G   + +  K  H +P LSL+ +++ ED   FI+R  RF    ++    + F 
Sbjct: 83  NSAAQAVGAAPDTAFGKHIHLVPMLSLDNVFDREDFEGFISRATRFLGLDQEATEQLIFV 142

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  I++ YEKG+FV    RGDG  GEDV+A +R +  +P  LS + P++IE+RG
Sbjct: 143 GEPKIDGLSISLTYEKGRFVRGTTRGDGTEGEDVTANLRTLKDLPLRLSGSYPDLIEIRG 202

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTS 247
           EV++SK  FL LN    A  ++ +ANPRNAA+G LR+L+ + IT  R L+ F + LG  S
Sbjct: 203 EVFLSKKHFLELNAAQEAANKRLFANPRNAAAGSLRQLD-SKITAQRPLSLFAYALGFCS 261

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E  ++  +  L++++  GFPVN   RQ         ++ E+   R+ L YDIDG+VYK+D
Sbjct: 262 EKISRSHWAYLEQLKAWGFPVNPLSRQIKGVEDAEVFFAEVSQNRAELAYDIDGVVYKID 321

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ++LG   R+PRW I+ KF  +QA TRL +I+IQ+GRTG LTPVA LEPVN+GG L
Sbjct: 322 DLALQERLGFAGRAPRWAIAWKFPAEQAVTRLKEIEIQVGRTGALTPVAHLEPVNVGGVL 381

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII-VNERHPDAQ 426
           +  ATLHNED I             +D+R GD V ++RAG+VIP+V+ +    +  P   
Sbjct: 382 VMRATLHNEDEI-----------ARKDVRPGDMVFIQRAGDVIPQVLGVAPSTDSTPRQA 430

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C +  VR          A  RCTGGL C AQ +ERL HFVSR AF+IEGL
Sbjct: 431 PYHFPDHCPACGAAAVRPEGE------AVRRCTGGLTCPAQVVERLIHFVSRQAFDIEGL 484

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + +  F    D    I  P DIF L          IE   G+G+ SV  L  +I  RR
Sbjct: 485 GDRSIREF---HDIGL-ILTPGDIFRLHEH----AADIEKRDGWGEQSVQKLLQAIESRR 536

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            ISL RFI++LGIR +GA  AR LA++Y +Y+N+  ++       +D  L L  +  +G 
Sbjct: 537 TISLSRFIYALGIRRIGASNARLLARHYGTYENWFNQMQAAAIIGSDARLELGSITGIGT 596

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKIQRH 664
             A+ +V F     N+      L ++  ++   E+  +SE  +  K +VFTGTL  + R 
Sbjct: 597 TTAEDLVAFVAEEHNL----QTLADLRANLTITEETAASEGALAGKTIVFTGTLHTMTRP 652

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           +A+    ++GA VS  +S+KTD++++G+  GSK +KA +LG++ M+E ++
Sbjct: 653 EAKATAERMGAKVSDSVSKKTDLVVLGEKAGSKAKKAVELGLQTMDEAEW 702


>gi|114327083|ref|YP_744240.1| NAD-dependent DNA ligase [Granulibacter bethesdensis CGDNIH1]
 gi|122327935|sp|Q0BV35|DNLJ_GRABC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114315257|gb|ABI61317.1| NAD-dependent DNA ligase [Granulibacter bethesdensis CGDNIH1]
          Length = 700

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 284/717 (39%), Positives = 428/717 (59%), Gaps = 34/717 (4%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
            L P EALS  +AR EL  L   I+  DD YY+   P++ D++YDAL++R   I   FPD
Sbjct: 10  SLTPPEALSPAEARAELERLASRIAELDDAYYRDDAPLVTDADYDALRQRNAEIERLFPD 69

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
                  N P N++G   + +  K+ H +P LSL+ +++ E+  +F  R  RF       
Sbjct: 70  AILK---NSPANRVGTAPSSAFAKIRHRVPMLSLDNVFDTEEFAEFCARARRFLNLP--A 124

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
           S  F  EPKIDG  I++ YE G    AA RGDG  GEDV+A +R +  +P+ L    P  
Sbjct: 125 SPRFVAEPKIDGLSISLTYENGILTRAATRGDGMEGEDVTANVRTLRDVPQTLHGEAPAF 184

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGL 243
           IE+RGEV++SK  FL LN+    +G+K +ANPRNAA+G LR+L+ +    R L  F +  
Sbjct: 185 IEIRGEVFMSKAAFLELNETQARLGQKIFANPRNAAAGSLRQLDASVTANRPLALFAYAQ 244

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G++S   A+  ++ L +++  GF VN   +     +   ++   + + RSTLPYDIDG+V
Sbjct: 245 GESSAPVAETHWDYLTRLKDWGFVVNPLSQLIEDENAAAAFTTRIAAGRSTLPYDIDGVV 304

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           +K+D+ SLQ++LG   R+PRW  + KF  +QA+T L  IDIQ+GRTG LTPVA L+ VN+
Sbjct: 305 FKIDDLSLQRRLGFVGRAPRWATAWKFPAEQATTVLEKIDIQVGRTGALTPVAHLQAVNV 364

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG L+T ATLHNED I             +D+R GD V+++RAG+VIP++V +++ +R  
Sbjct: 365 GGVLVTRATLHNEDEI-----------ARKDVREGDTVILQRAGDVIPQIVSVVLEKRPD 413

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
            A+PF+    CP+C S  +R      G++V   RCTGGL C AQ +ERL H VSR AF+I
Sbjct: 414 GARPFAPLEHCPVCGSLAIR----PPGEVV--RRCTGGLTCEAQVVERLIHMVSRPAFDI 467

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +GLG++ +  F +       +  PADIF L  R+     +I    G+G +S  NL  +I 
Sbjct: 468 DGLGEKSILEFHRDG----LVSGPADIFRLPARED----EIARRDGWGSLSARNLSQAIE 519

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
            RR+I  +RF+++LGIR +G   AR LA++Y S+  +  ++       +D+ L+L  +  
Sbjct: 520 ARRSIPFDRFLYALGIRRIGETNARLLARHYGSFTEWRTQMLAARQIGSDERLALGSITG 579

Query: 604 VGDIIAQAIVEFYQNPRNICAVEAL---LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +G  IA+ +V+F+  PRNI  ++ L   L   +PS G     + S +  K +VFTGTLQ 
Sbjct: 580 IGPTIAEELVDFFAEPRNIDTLDELAGMLTITAPSGGLSSAALDSPLNGKIIVFTGTLQA 639

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           + R +A+     +GA V+  +S+KTD ++ G + GSK +KA +LG++ ++EE++L L
Sbjct: 640 MTRPEAKARAESMGAKVTDSVSKKTDFVVTGADAGSKAKKAAELGIRTLSEEEWLAL 696


>gi|84516174|ref|ZP_01003534.1| DNA ligase [Loktanella vestfoldensis SKA53]
 gi|84509870|gb|EAQ06327.1| DNA ligase [Loktanella vestfoldensis SKA53]
          Length = 722

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 291/717 (40%), Positives = 424/717 (59%), Gaps = 24/717 (3%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +  L+  +A  EL+ L Q ++  +  Y++   P I D+ YDALK+R  AI   F +L 
Sbjct: 22  IAVADLTRAEAMVELARLAQTLAQANTAYHRNDTPEISDAAYDALKQRNAAIEARFRELK 81

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P+   +++G  +     KV H++  LSL   ++ +D+  F  R+ ++     D  +
Sbjct: 82  RADSPS---DQVGAVVADGFGKVQHAVRMLSLGNAFSDDDVTDFDERLRKYLGLTADQPL 138

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  V AA RGDG  GE+V+A    I  IP+ L+   P ++E
Sbjct: 139 RYTAEPKIDGLSLSLRYEDGVLVQAATRGDGAVGENVTANACTIADIPQRLT-GAPAVLE 197

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S +DF ALN      G K +ANPRNAA+G LR+L+      R L FF +  G 
Sbjct: 198 VRGEVYMSHDDFAALNARQADKGAKTFANPRNAAAGSLRQLDAGITAARPLRFFAYAWGA 257

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q   + ++  LGF  N      ++   +++ Y+ +++ R++L YDIDG+VYK
Sbjct: 258 LSAPLAATQSGAIARLAELGFATNPLTATCDSPADLIAIYSGIEAQRASLGYDIDGVVYK 317

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+ +LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 318 VDDLALQQRLGFRSTTPRWAIAHKFPAELAWTVLDAIDIQVGRTGALSPVARLVPVTVGG 377

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI G    G+ +R GRDIRVGD V V RAG+VIPK+ D+    R   A
Sbjct: 378 VVVSNATLHNEDYIAGRGGDGQPIRQGRDIRVGDWVQVYRAGDVIPKIKDVDSARRPAGA 437

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP C S  +RD         A  RCTGG+ C AQ +ERLKHFVSR AF+IEG
Sbjct: 438 TPYIFPDTCPECGSPAIRDPGD------AVRRCTGGMICPAQAVERLKHFVSRAAFDIEG 491

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F         I  P DIFTL+ R      +++N  G+G  S  NL+ +I+ +
Sbjct: 492 LGAKQVEQFHADG----WITTPVDIFTLRARYGQGLQQLKNREGWGAKSADNLFAAIDDK 547

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I+L R I++LGIRHVG   A  LA +Y S+  FA  +          W +L  +  VG
Sbjct: 548 RAIALNRLIYALGIRHVGESSAALLANHYGSWAGFATAMQAAHIGQGPAWDALTSIDGVG 607

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEV----SPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
            ++A +++   QNP    ++ AL+ ++    +P I        S +    +VFTGTL+K+
Sbjct: 608 AVMATSLITTLQNPSEAASIAALVAQLDVQDAPKIAS-----DSPVSGLTVVFTGTLEKM 662

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A+     LGA V+  +S KTDI++ G   GSK  KA+ LG++ M+E+ +L L+
Sbjct: 663 TRAEAKARAESLGAKVAGSVSAKTDILVAGPGAGSKAAKAEALGIRTMDEDGWLALI 719


>gi|241760920|ref|ZP_04759009.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374539|gb|EER64000.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 731

 Score =  515 bits (1326), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 300/724 (41%), Positives = 445/724 (61%), Gaps = 53/724 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS EQA  EL  L   IS++D  Y+    P + DSEYDAL  R   I   FPDL R   P
Sbjct: 26  LSREQAVIELERLANLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIR---P 82

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  K+G   N  L K+ H    LSL+  +  +D+  F+ R+ RF+  K++ ++  T+E
Sbjct: 83  DSPSKKVGSRPNSRLPKIAHRAAMLSLDNGFLDQDVEDFLGRVRRFFNLKENQAVICTVE 142

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PKIDG   ++RYEKG    A  RGDG  GEDV+  +R I  IP+ L   N PEIIE+RGE
Sbjct: 143 PKIDGLSCSLRYEKGILTQAVTRGDGVIGEDVTPNVRVIDDIPKTLKGDNWPEIIEIRGE 202

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           VY++K+DF ALN       +K +ANPRNAA+G LR+L+P +IT  R L F  HG G+ + 
Sbjct: 203 VYMAKSDFAALNARQTEENKKLFANPRNAAAGSLRQLDP-NITARRSLRFLAHGWGEATS 261

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A  QY M++ +   G  V+N + +A+    ++ +Y ++++ R+ L +DIDG+VYK+D+
Sbjct: 262 LPADTQYGMMKMIESYGLSVSNLLARADNIGQMLDFYQKIEAERADLDFDIDGVVYKLDQ 321

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++ G  AR+PR+ ++HKF  ++A T LLDI+IQ+GRTG+LTPVA+LEPV +GG ++
Sbjct: 322 LDWQQRFGFSARAPRFALAHKFPAEKAQTTLLDIEIQVGRTGVLTPVAKLEPVTVGGVVV 381

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           ++ATLHN D I+ L A           R GDRVLV+RAG+VIP++V+ + ++   D   +
Sbjct: 382 SSATLHNSDEIERLGA-----------RPGDRVLVQRAGDVIPQIVENLTSD--VDRPIW 428

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S   R+     G++  A RCTGGL C AQ++ERL HFVSR AF IEGLGK
Sbjct: 429 HFPHRCPVCDSVARRE----EGEV--AWRCTGGLICPAQRVERLCHFVSRTAFEIEGLGK 482

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++ FF  +     I  PADIF L +++Q    +     G+G++SV NL  +I+KRR +
Sbjct: 483 SHIESFFADK----LIETPADIFRLFQKRQLLIER----EGWGELSVDNLISAIDKRRKV 534

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAHNND--------- 593
             +RF+F+LGIRHVGA  AR LAK Y ++ NF      A  +  I+  +++         
Sbjct: 535 PFDRFLFALGIRHVGAVTARDLAKSYQTWDNFKAAIDEAAHLRTILQPSSEESEEKYQKR 594

Query: 594 ---DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
              + +S   +P +G  I +++++F+    N   V  LL+EV       E   SS +  K
Sbjct: 595 VDKELISFFHIPNMGGKIIRSLLDFFAETHNSDVVSDLLQEVQIEPLYFEL-ASSPLSGK 653

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+LQKI R +A+     LGA V++ +S+KT++++ G+  GSKL KA++L + I++
Sbjct: 654 IIVFTGSLQKITRDEAKRQAENLGAKVASSVSKKTNLVVAGEAAGSKLSKAKELDISIID 713

Query: 711 EEQF 714
           E+++
Sbjct: 714 EDRW 717


>gi|114570616|ref|YP_757296.1| DNA ligase [Maricaulis maris MCS10]
 gi|122315591|sp|Q0AMX9|DNLJ_MARMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114341078|gb|ABI66358.1| DNA ligase, NAD-dependent [Maricaulis maris MCS10]
          Length = 701

 Score =  514 bits (1325), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 286/716 (39%), Positives = 432/716 (60%), Gaps = 29/716 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ L+  +AR E + L +EI+ HD  YYQ   P I D+ YDAL+R+ +AI   FP     
Sbjct: 7   VDQLTEAEARAEHARLAREIAGHDKAYYQSDAPKISDAAYDALRRKLEAIEVRFPQFI-- 64

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            D   P  ++G   +    ++ H++P LSL   +N ED+  F+ RI RF    + + +  
Sbjct: 65  -DLLSPTQRVGAVPSGKFGEIRHAVPMLSLGNAFNDEDVADFVGRIRRFLGLAESDVVAV 123

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEV 187
           T EPKIDG   ++RY  GK V+ A RGDG +GEDV+  +  +  IP  L   + P+++EV
Sbjct: 124 TAEPKIDGLSASLRYVGGKLVHGATRGDGQTGEDVTQNLLTLDDIPDTLPPGDWPDVVEV 183

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKT 246
           RGEVY+S  DF ALN+  I  G+  Y NPRNAA+G LR+++P   + R L FF +  G+ 
Sbjct: 184 RGEVYMSHADFAALNERQIEAGKDAYKNPRNAAAGSLRQIDPKMTSQRPLRFFAYAWGEV 243

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  +  Q   + +   +GFPVN+ + +  T   +++ Y ++++ R+ L YDIDG+VYK 
Sbjct: 244 SEPLSDTQMGAVARFGEMGFPVNDLMARCETVEALLAVYRDIEARRAGLGYDIDGVVYKA 303

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG  AR+PRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL PV +GG 
Sbjct: 304 DRLDWQERLGFVARAPRWAIAHKFPAEQATTILEAIDIQVGRTGALTPVARLTPVTVGGV 363

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHN+D I+            +DIRVGD V+++RAG+VIP+VV ++  +R    +
Sbjct: 364 VVTNATLHNQDEIE-----------RKDIRVGDTVVIQRAGDVIPQVVRVVDPDRPGRGE 412

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            F FP+ CP+C S+ +R+ + KTGKL    RCTGGL C AQ  ERLKHFVSR AF+IEGL
Sbjct: 413 AFDFPTECPVCGSQALREHDAKTGKLDVVRRCTGGLICGAQLKERLKHFVSRKAFDIEGL 472

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTK--IENILGFGDVSVTNLYDSINK 544
           G +Q++ F +       I  PA IFTL+ R +    K  ++   GFG+ S+ NL+ SI  
Sbjct: 473 GIKQIEAFQEEG----LITEPAHIFTLKARNEAGEIKPPLQEREGFGETSIRNLFTSIED 528

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWL--SLIRVP 602
           RR I+L RF+ +LGIRHVG   +   A+ Y S+  F     N+    +D+ +   ++ + 
Sbjct: 529 RRTITLARFLNALGIRHVGENTSALFARTYGSWAAFHAAAANL----SDEAVRAEMLGID 584

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+   +A+ +++    N   ++ L+ +++        N  S +  K +VFTG L+++ 
Sbjct: 585 GIGNAAVEALEQYFTEAHNRDLLDRLVAQLTIEDAEAIAN-DSPVAGKTVVFTGALERMT 643

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA V+  +S KTD ++ G   GSK +KA +LGV+ + E+++  L+
Sbjct: 644 RDEAKAKAQALGAKVAGSVSGKTDYLVAGPGAGSKAKKAAELGVETLTEDEWFDLI 699


>gi|91205008|ref|YP_537363.1| NAD-dependent DNA ligase LigA [Rickettsia bellii RML369-C]
 gi|122990942|sp|Q1RK40|DNLJ_RICBR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91068552|gb|ABE04274.1| DNA ligase, NAD-dependent [Rickettsia bellii RML369-C]
          Length = 689

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 285/715 (39%), Positives = 432/715 (60%), Gaps = 35/715 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           IE ++ E+A+K L  L  +I+ ++  YY   KP++ D+EYD L      +   FP L   
Sbjct: 4   IEKINEEEAKKLLIELADKIAQYNHAYYIEDKPLVSDAEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  KIG ++     KVTH +P LSL  +++ ED++ F+ RI  F +    + IF 
Sbjct: 64  ---NSPSKKIGAKVENKFAKVTHQVPMLSLSNVFDEEDVKDFLDRIKSFLRLDQFSPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG      Y+ G     A RGDG+ GED++A I+ I   P  ++ N PE++EVR
Sbjct: 120 -CEPKIDGLSFAATYKNGILTTGATRGDGYIGEDITANIKTIKDFPHKIN-NAPELLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI KNDF +LN E    G+  +ANPRNAA+G LR+L+P+    R L +FV+ +G   
Sbjct: 178 GEIYIEKNDFTSLNQEQEQQGKDKFANPRNAAAGSLRQLDPSVTAKRPLKYFVYAIGSAK 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E  A  Q ++L K + LGF VN   + AN+   I S+Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 EELANSQDQLLAKFKELGFNVNEIGKLANSEEEIFSFYEYLKTNRKNLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG +
Sbjct: 298 DFALQDRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVI 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+RVGD V ++RAG+VIP++  + + +R  DA  
Sbjct: 358 VSRATLHNYQEI-----------ARKDVRVGDYVFLQRAGDVIPQITGVDLAKRSADATT 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F  P FCP C S+   V  D+           RC  GL C AQ  ER++HFVS++A +IE
Sbjct: 407 FDPPLFCPSCNSKLHYVPEDI---------IIRCDNGLNCPAQNYERIRHFVSKNAMDIE 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++F     D    I  P DIF L+ + + S TK+EN+ G+G  SV NL+++I K
Sbjct: 458 GLGRKQVEFLI---DKGL-ISNPYDIFFLKEKNEASLTKLENMDGWGKKSVENLFNNIEK 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            +N+SL RFI++LGIRH+G + A+ L + + SY+NF  ++  +  ++ + +  L  +  +
Sbjct: 514 SKNVSLPRFIYALGIRHIGEQNAKLLTREFGSYENFIAQMELLKENDPEIYQKLNNLDGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           GD +   I++F+    NI  ++  L EV       E    S +  K +VFTG++  + R 
Sbjct: 574 GDKMLVDIIDFFDVKENIELIKN-LSEVLNIEDYKETREQSSLTGKIVVFTGSMPTLSRA 632

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +A+    +LGA V+A +S  TD++I G++ GSKL+KA++LG+KI++E ++L L++
Sbjct: 633 EAKATAEKLGAKVAASVSSNTDLVIAGEDAGSKLKKAKELGIKIIDEAEWLTLVR 687


>gi|157827661|ref|YP_001496725.1| NAD-dependent DNA ligase LigA [Rickettsia bellii OSU 85-389]
 gi|166216232|sp|A8GXT8|DNLJ_RICB8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157802965|gb|ABV79688.1| NAD-dependent DNA ligase LigA [Rickettsia bellii OSU 85-389]
          Length = 689

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 285/715 (39%), Positives = 432/715 (60%), Gaps = 35/715 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           IE ++ E+A+K L  L  +I+ ++  YY   KP++ D+EYD L      +   FP L   
Sbjct: 4   IEKINEEEAKKLLIELADKIAQYNHAYYIEDKPLVSDAEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  KIG ++     KVTH +P LSL  +++ ED++ F+ RI  F +    + IF 
Sbjct: 64  ---NSPSKKIGAKVENKFAKVTHQVPMLSLSNVFDEEDVKDFLDRIKSFLRLDQFSPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG      Y+ G     A RGDG+ GED++A I+ I   P  ++ N PE++EVR
Sbjct: 120 -CEPKIDGLSFAATYKNGILTTGATRGDGYIGEDITANIKTIKDFPHKIN-NAPELLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI KNDF +LN E    G+  +ANPRNAA+G LR+L+P+    R L +FV+ +G   
Sbjct: 178 GEIYIEKNDFTSLNQEQEQQGKDKFANPRNAAAGSLRQLDPSVTAKRPLKYFVYAIGSAK 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E  A  Q ++L K + LGF VN   + AN+   I S+Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 EELANSQDQLLAKFKELGFNVNEIGKLANSEEEIFSFYEYLKTNRKNLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG +
Sbjct: 298 DFALQDRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVI 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+RVGD V ++RAG+VIP++  + + +R  DA  
Sbjct: 358 VSRATLHNYQEI-----------ARKDVRVGDYVFLQRAGDVIPQITGVDLAKRSADATT 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F  P FCP C S+   V  D+           RC  GL C AQ  ER++HFVS++A +IE
Sbjct: 407 FDPPLFCPSCNSKLHYVPEDI---------IIRCDNGLNCPAQNYERIRHFVSKNAMDIE 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++F     D    I  P DIF L+ + + S TK+EN+ G+G  SV NL+++I K
Sbjct: 458 GLGRKQVEFLI---DKGL-ISNPYDIFFLKEKNEASLTKLENMDGWGKKSVENLFNNIEK 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            +N+SL RFI++LGIRH+G +  + LA+ + SY+NF  ++  +  ++ + +  L  +  +
Sbjct: 514 SKNVSLPRFIYALGIRHIGEQNVKLLAREFGSYENFIAQMELLKENDPEIYQKLNNLDGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           GD +   I++F+    NI  ++  L EV       E    S +  K +VFTG++  + R 
Sbjct: 574 GDKMLVDIIDFFDVKENIELIKN-LSEVLNIEDYKETREQSSLTGKIVVFTGSMPTLSRA 632

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +A+    +LGA V+A +S  TD++I G++ GSKL+KA++LG+KI++E ++L L++
Sbjct: 633 EAKATAEKLGAKVAASVSSNTDLVIAGEDAGSKLKKAKELGIKIIDEAEWLTLVR 687


>gi|56551260|ref|YP_162099.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59802648|sp|P28719|DNLJ_ZYMMO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56542834|gb|AAV88988.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 731

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 299/724 (41%), Positives = 445/724 (61%), Gaps = 53/724 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS EQA  EL  L + IS++D  Y+    P + DSEYDAL  R   I   FPDL R   P
Sbjct: 26  LSREQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIR---P 82

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  K+G   N  L K+ H    LSL+  +  +D+  F+ R+ RF+  K++ ++  T+E
Sbjct: 83  DSPSKKVGSRPNSRLPKIAHRAAMLSLDNGFLDQDVEDFLGRVRRFFNLKENQAVICTVE 142

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PKIDG   ++RYEKG    A  RGDG  GEDV+  +R I  IP+ L   N PEIIE+RGE
Sbjct: 143 PKIDGLSCSLRYEKGILTQAVTRGDGVIGEDVTPNVRVIDDIPKTLKGDNWPEIIEIRGE 202

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           VY++K+DF ALN       +K +ANPRNAA+G LR+L+P +IT  R L F  HG G+ + 
Sbjct: 203 VYMAKSDFAALNARQTEENKKLFANPRNAAAGSLRQLDP-NITARRSLRFLAHGWGEATS 261

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A  QY M++ +   G  V+N + +A+    ++ +Y ++++ R+ L +DIDG+VYK+D+
Sbjct: 262 LPADTQYGMMKVIESYGLSVSNLLARADDIGQMLDFYQKIEAERADLDFDIDGVVYKLDQ 321

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++ G  AR+PR+ ++HKF  ++A T LLDI+IQ+GRTG+LTPVA+LEPV +GG ++
Sbjct: 322 LDWQQRFGFSARAPRFALAHKFPAEKAQTTLLDIEIQVGRTGVLTPVAKLEPVTVGGVVV 381

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           ++ATLHN D I+ L            +R GDRVLV+RAG+VIP++V+ +  +   D   +
Sbjct: 382 SSATLHNSDEIERL-----------GVRPGDRVLVQRAGDVIPQIVENLTPD--VDRPIW 428

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S   R+     G++  A RCTGGL C AQ++ERL HFVSR AF IEGLGK
Sbjct: 429 RFPHRCPVCDSVARRE----EGEV--AWRCTGGLICPAQRVERLCHFVSRTAFEIEGLGK 482

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++ FF  +     I  PADIF L +++Q    +     G+G++SV NL  +I+KRR +
Sbjct: 483 SHIESFFADK----LIETPADIFRLFQKRQLLIER----EGWGELSVDNLISAIDKRRKV 534

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAHNND--------- 593
             +RF+F+LGIRHVGA  AR LAK Y ++ NF      A  +  I+  +++         
Sbjct: 535 PFDRFLFALGIRHVGAVTARDLAKSYQTWDNFKAAIDEAAHLRTILQPSSEESEEKYQKR 594

Query: 594 ---DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
              + +S   +P +G  I +++++F+    N   V  LL+EV       E   SS +  K
Sbjct: 595 VDKELISFFHIPNMGGKIIRSLLDFFAETHNSDVVSDLLQEVQIEPLYFEL-ASSPLSGK 653

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+LQKI R +A+     LGA V++ +S+KT++++ G+  GSKL KA++L + I++
Sbjct: 654 IIVFTGSLQKITRDEAKRQAENLGAKVASSVSKKTNLVVAGEAAGSKLSKAKELDISIID 713

Query: 711 EEQF 714
           E+++
Sbjct: 714 EDRW 717


>gi|114797923|ref|YP_759116.1| DNA ligase, NAD-dependent [Hyphomonas neptunium ATCC 15444]
 gi|122942770|sp|Q0C577|DNLJ_HYPNA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114738097|gb|ABI76222.1| DNA ligase, NAD-dependent [Hyphomonas neptunium ATCC 15444]
          Length = 701

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 285/697 (40%), Positives = 414/697 (59%), Gaps = 40/697 (5%)

Query: 35  YYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIP 94
           YYQ   P + D++YDAL++R  AI   FP L R + P    +++G E      K  HS P
Sbjct: 33  YYQNDAPELTDADYDALRQRNLAIEARFPALKREDSPT---DRVGAEAGDGFAKARHSAP 89

Query: 95  TLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALR 154
            LSL+  +  ED+  F  RI RF     + ++ FT EPKIDG  +++ YE GK + AA R
Sbjct: 90  MLSLDNAFTDEDVADFAVRIRRFLGLAPEETLAFTAEPKIDGLSLSLTYENGKLMRAATR 149

Query: 155 GDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPY 213
           GDG +GEDV+A  R +  IP ++     PE IEVRGEVY++K+ F  LN      GRK +
Sbjct: 150 GDGQTGEDVTANARTLGDIPVKLKGKGWPERIEVRGEVYMAKSAFADLNAREAEAGRKVF 209

Query: 214 ANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNG 271
           ANPRNAA+G LR+L+  +IT  R L FF +     SE FA+ Q+E ++     GF  N+ 
Sbjct: 210 ANPRNAAAGSLRQLD-VEITKSRPLRFFAYAWAAASEPFAQTQFEAVKAFADWGFVTNSR 268

Query: 272 VRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFA 331
           + +  T   ++SYY E+++ R++L YDIDG+VYKVD    Q++LG  +R+PRW I+HKF 
Sbjct: 269 MIRIKTVEEVLSYYQEIEAERASLEYDIDGVVYKVDRLDWQQRLGFVSRAPRWAIAHKFP 328

Query: 332 EKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRG 391
            ++A T LL IDIQ+GRTG LTPVARLEPV +GG +++NATLHNED I  L         
Sbjct: 329 AEKAVTTLLGIDIQVGRTGSLTPVARLEPVTVGGVVVSNATLHNEDEIARL--------- 379

Query: 392 GRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGK 451
              ++ GD+V ++RAG+VIP+V+ ++         P++ P  CP+C S  VR+++   G+
Sbjct: 380 --GVKPGDKVEIQRAGDVIPQVLRVV---EPGQGAPWAMPDTCPVCGSAAVREID-DAGR 433

Query: 452 LVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIF 511
                RCTGGL C AQ +ERLKHFVSR A +I+GLG++Q+  F +      +++ P DIF
Sbjct: 434 ADVRRRCTGGLICPAQAVERLKHFVSRKALDIDGLGEKQVLLFHEKG----AVKAPQDIF 489

Query: 512 TLQRR-QQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSL 570
            L++  +      +E   GFG  S   LY +I+ RR +   RF+  LGIR+VG   +   
Sbjct: 490 RLKKNIEAAGLPPLEEWEGFGAQSARKLYSAIDARRKVPFARFLNGLGIRYVGQTTSAQF 549

Query: 571 AKYYLSYQNF-----AQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN--IC 623
           A+ +LS+Q+F     A E   I    ++ +  LI +  +G   A++++ F   P N  + 
Sbjct: 550 ARSFLSWQSFWAAVKAAEEGGI---ESEAYNELIGIDGIGQAAARSLMAFEGEPHNREML 606

Query: 624 AVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
           A      EV   I        S +  K +VFTGTL+K+ R +A+   + LGA V+  +S 
Sbjct: 607 AALLEEVEVEDEI---PAETGSPVTGKTVVFTGTLEKMTRDEAKARASALGAKVAGTVSA 663

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           KTDI+I G   GSKL KA+QLG+ +M E+++L L+ +
Sbjct: 664 KTDIVIAGPGAGSKLVKAEQLGLAVMTEDEWLALIGE 700


>gi|254453419|ref|ZP_05066856.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 238]
 gi|198267825|gb|EDY92095.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 238]
          Length = 661

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 280/668 (41%), Positives = 399/668 (59%), Gaps = 54/668 (8%)

Query: 96  LSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRG 155
           LSL   +  +D+ +F   + +F    +  ++ FT EPKIDG  +++RYE GK V AA RG
Sbjct: 2   LSLGNAFTDDDVSEFDKSVRKF-LGLETGALAFTAEPKIDGLSLSLRYEFGKLVQAATRG 60

Query: 156 DGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYAN 215
           DG  GE+V+A  R I  +P++L  + P+I+EVRGEVY+S  DF ALN      G K +AN
Sbjct: 61  DGAVGENVTANARTIHDVPQLLD-DAPDILEVRGEVYMSHADFEALNARQSKAGAKTFAN 119

Query: 216 PRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQ 274
           PRNAA+G LR+L+     +R L FF +  G+ S   A  Q   + +++ LGF  N   + 
Sbjct: 120 PRNAAAGSLRQLDVSVTKSRPLKFFAYAWGEVSAPLADTQSGAIARLKTLGFQTNPLTQI 179

Query: 275 ANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQ 334
                 ++++Y +++S R+TL YDIDG+VYKVDE +LQ +LG R+ +PRW I+HKF  + 
Sbjct: 180 CTGPSDMIAHYRDIESQRATLGYDIDGVVYKVDELALQARLGFRSTTPRWAIAHKFPAEL 239

Query: 335 ASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRD 394
           A T L  IDIQ+GRTG L+PVARL PV +GG +++NATLHNEDYI G    G  +RGG+D
Sbjct: 240 AWTTLDAIDIQVGRTGALSPVARLSPVTVGGVVVSNATLHNEDYIAGRGNKGDDIRGGKD 299

Query: 395 IRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVA 454
           IRVGD V + RAG+VIPKV D+ + +R  +A PF FP+ CP C S  VR+     G +V 
Sbjct: 300 IRVGDWVQIYRAGDVIPKVADVDLTKRPVEATPFDFPTTCPKCGSDAVRE----EGDVV- 354

Query: 455 AHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQ 514
             RCTGGL C AQ +E+LKHFVSR AF+I+GLG +Q++ F+   D   +I+ PADIFTLQ
Sbjct: 355 -RRCTGGLICPAQAVEKLKHFVSRAAFDIDGLGAKQVEAFYN--DDQLAIKEPADIFTLQ 411

Query: 515 RRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYY 574
            R   S TK+ N  G+GD SV  L+ +I+++R ISL R IF+LGIRHVG   A+ LA++Y
Sbjct: 412 ARDLDSFTKLANRDGWGDTSVKKLWQAIDEKREISLARLIFALGIRHVGEVTAQDLARHY 471

Query: 575 LSYQNFAQEIN----NIIAHNNDD------------------------------------ 594
            +++  A+ +       IAH   D                                    
Sbjct: 472 GTWEVLAENVKLGRPAAIAHRAADEAEADERFIADRDGRRPRVSEARKLAIANAGLSRTA 531

Query: 595 ---WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
              W  LI    +G  +A +  +   N     A+EAL++++   I    +  +S +  K 
Sbjct: 532 TKAWAFLIDADGIGATVALSFSDALSNAEESKAIEALIQQLDTIIAPQTQASNSPVAGKT 591

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTGTL+K+ R +A+     LGA VS  +S KTD++I G   GSK +KA   G++ ++E
Sbjct: 592 VVFTGTLEKMTRAEAKARAESLGAKVSGSVSAKTDLLIAGLGAGSKAKKAADFGIETLSE 651

Query: 712 EQFLFLLQ 719
           + +L L +
Sbjct: 652 DGWLALTK 659


>gi|11095423|gb|AAG29863.1|AF313764_6 DNA ligase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|49284|emb|CAA77966.1| DNA ligase [Zymomonas mobilis subsp. mobilis CP4]
 gi|382210|prf||1819268B DNA ligase
          Length = 731

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 297/724 (41%), Positives = 444/724 (61%), Gaps = 53/724 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS EQA  EL  L + IS++D  Y+    P + DSEYDAL  R   I   FPDL R   P
Sbjct: 26  LSREQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIR---P 82

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  K+G   N  L K+ H    LSL+  +  +D+  F+ R+ RF+  K++ ++  T+E
Sbjct: 83  DSPSKKVGSRPNSRLPKIAHRAAMLSLDNGFLDQDVEDFLGRVRRFFNLKENQAVICTVE 142

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PKIDG   ++RYEKG    A  RGDG  GEDV+  +R I  IP+ L   N PEIIE+RGE
Sbjct: 143 PKIDGLSCSLRYEKGILTQAVTRGDGVIGEDVTPNVRVIDDIPKTLKGDNWPEIIEIRGE 202

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           VY++K+DF ALN       +K +ANPRNAA+G LR+L+P +IT  R L F  HG G+ + 
Sbjct: 203 VYMAKSDFTALNARQTEENKKLFANPRNAAAGSLRQLDP-NITARRSLRFLAHGWGEATS 261

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A  QY M++ +   G  V+N + +A+    ++ +Y ++++ R+ L +DIDG+VYK+D+
Sbjct: 262 LPADTQYGMMKMIESYGLSVSNLLARADDIGQMLDFYQKIEAERADLDFDIDGVVYKLDQ 321

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++ G  AR+PR+ ++HKF  ++A T LLDI+IQ+GRTG+LTPVA+LEPV +GG ++
Sbjct: 322 LDWQQRFGFSARAPRFALAHKFPAEKAQTTLLDIEIQVGRTGVLTPVAKLEPVTVGGVVV 381

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           ++ATLHN D I+ L            +R GDRVLV+RAG+VIP++V+ +  +   D   +
Sbjct: 382 SSATLHNSDEIERL-----------GVRPGDRVLVQRAGDVIPQIVENLTPD--VDRPIW 428

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S   R+     G++  A RCTGGL C AQ++E L HFVSR AF I+GLGK
Sbjct: 429 HFPHRCPVCDSVARRE----EGEV--AWRCTGGLICPAQRVEALCHFVSRTAFEIDGLGK 482

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++ FF  +     I  PADIF L +++Q    +     G+G++SV NL  +I+KRR +
Sbjct: 483 SHIESFFADK----LIETPADIFRLFQKRQLLIER----EGWGELSVDNLISAIDKRRKV 534

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAHNND--------- 593
             +RF+F+LGIRHVGA  AR LAK Y ++ NF      A  +  I+  +++         
Sbjct: 535 PFDRFLFALGIRHVGAVTARDLAKSYQTWDNFKAAIDEAAHLRTILQPSSEESEEKYQKR 594

Query: 594 ---DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
              + +S   +P +G  I +++++F+    N   V  LL+EV       E   SS +  K
Sbjct: 595 VDKELISFFHIPNMGGKIIRSLLDFFAETHNSDVVSDLLQEVQIEPLYFEL-ASSPLSGK 653

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+LQKI R +A+     LGA V++ +S+KT++++ G+  GSKL KA++L + I++
Sbjct: 654 IIVFTGSLQKITRDEAKRQAENLGAKVASSVSKKTNLVVAGEAAGSKLSKAKELDISIID 713

Query: 711 EEQF 714
           E+++
Sbjct: 714 EDRW 717


>gi|260753112|ref|YP_003226005.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552475|gb|ACV75421.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 731

 Score =  508 bits (1309), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 297/724 (41%), Positives = 443/724 (61%), Gaps = 53/724 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS EQA  EL  L   IS++D  Y+    P + DSEYDAL  R   I   FPDL R   P
Sbjct: 26  LSREQAVIELERLANLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIR---P 82

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  K+G   N  L K+ H    LSL+  +  +D+  F+ R+ RF+  K++ ++  T+E
Sbjct: 83  DSPSKKVGSRPNSRLPKIAHRAAMLSLDNGFLDQDVEDFLGRVRRFFNLKENQAVICTVE 142

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PKIDG   ++RYEKG    A  RGDG  GEDV+  +R I  IP+ L   N PEIIE+RGE
Sbjct: 143 PKIDGLSCSLRYEKGILTQAVTRGDGVIGEDVTPNVRVIDDIPKTLKGDNWPEIIEIRGE 202

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           VY++K+DF ALN       +K +ANPRNAA+G LR+L+P +IT  R L F  HG G+ + 
Sbjct: 203 VYMAKSDFAALNARQTEENKKLFANPRNAAAGSLRQLDP-NITARRSLRFLAHGWGEATS 261

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A  QY M++ +   G  V+N + +A+    ++ +Y ++++ R+ L +DIDG+VYK+D+
Sbjct: 262 LPADTQYGMMKVIESYGLSVSNLLARADNIGQMLDFYQKIEAERADLDFDIDGVVYKLDQ 321

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++ G  AR+PR+ ++HKF  ++A T LLDI+IQ+GRTG+LTPVA+LEPV +GG ++
Sbjct: 322 LDWQQRFGFSARAPRFALAHKFPAEKAQTTLLDIEIQVGRTGVLTPVAKLEPVTVGGVVV 381

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           ++ATLHN D I+ L            +R  DRVLV+RAG+VIP++V+ +  +   D   +
Sbjct: 382 SSATLHNSDEIERL-----------GVRPEDRVLVQRAGDVIPQIVENLTPD--VDRPIW 428

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S   R+     G++  A RCTGGL C AQ++ERL HFVSR AF I+GLGK
Sbjct: 429 HFPHRCPVCDSVARRE----EGEV--AWRCTGGLICPAQRVERLCHFVSRTAFEIDGLGK 482

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++ FF  +     I  PADIF L +++Q    +     G+G++SV NL  +I+KRR +
Sbjct: 483 SHIESFFADK----LIETPADIFRLFQKRQLLIER----EGWGELSVDNLISAIDKRRKV 534

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNF------AQEINNIIAHNND--------- 593
             +RF+F+LGIRHVGA  AR LAK Y ++ NF      A  +  I+  +++         
Sbjct: 535 PFDRFLFALGIRHVGAVTARDLAKSYQTWDNFKAAIDEAAHLRTILQPSSEESEEKYQKR 594

Query: 594 ---DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
              + +S   +P +G  I +++++F+    N   V  LL+EV       E   SS +  K
Sbjct: 595 VDKELISFFHIPNMGGKIIRSLLDFFAETHNSDVVSDLLQEVQIEPLYFEL-ASSPLSGK 653

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+LQKI R +A+     LGA V++ +S+KT++++ G+  GSKL KA++L + I++
Sbjct: 654 IIVFTGSLQKITRDEAKRQAENLGAKVASSVSKKTNLVVAGEAAGSKLSKAKELDISIID 713

Query: 711 EEQF 714
           E+++
Sbjct: 714 EDRW 717


>gi|220920535|ref|YP_002495836.1| DNA ligase, NAD-dependent [Methylobacterium nodulans ORS 2060]
 gi|254781366|sp|B8ICE5|DNLJ_METNO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219945141|gb|ACL55533.1| DNA ligase, NAD-dependent [Methylobacterium nodulans ORS 2060]
          Length = 829

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 272/644 (42%), Positives = 379/644 (58%), Gaps = 56/644 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E ++  QAR+   SL  EI+ HD  Y+    PII D+EYDAL+RR +AI   FP+LA 
Sbjct: 10  PVEEMTAAQAREAHESLSAEIAEHDRRYHGEDAPIISDAEYDALRRRLEAIEERFPELAG 69

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +         +G + +    KV H++P LSL   +  E++ +F+ R+ RF        + 
Sbjct: 70  T---GAASVSVGAKASDKFAKVRHAVPMLSLGNAFAEEEITEFVERVRRFLGLPASEPLA 126

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           FT EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  IP  L+ + +PEI E
Sbjct: 127 FTAEPKIDGLSLSLRYEGGRLVTAATRGDGEVGEDVTANVRTIREIPHELAGDDVPEICE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK 245
           VRGEVY+S  DF A+N      GR  +ANPRNAA+G LR+L+P    +R L FF +  G+
Sbjct: 187 VRGEVYLSHADFAAINARQEEAGRPLFANPRNAAAGSLRQLDPGITASRPLRFFAYAAGE 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A+ Q  ++   R  G PVN   ++  +   ++++Y  +++ R+ L YDIDG+VYK
Sbjct: 247 MSSWPAETQSGLIGAFRRFGLPVNPRTKRCTSVAEMLAHYRAIETERAELGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VDEF+LQ++LG  AR+PRW ++HKF  ++A T +  I+I +GRTG L P+ARL+PV +GG
Sbjct: 307 VDEFALQRRLGFVARAPRWALAHKFPAQRAVTVIEAIEINVGRTGSLNPLARLKPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRG------------------GRDIRVGDRVLVKRAG 407
            +++NATLHNEDYI+G+DA G  +R                   G D+RVGD V+V RAG
Sbjct: 367 VVVSNATLHNEDYIRGIDADGNTIRSGINIWDGFRLREDVDLRQGSDVRVGDTVVVLRAG 426

Query: 408 EVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQ 467
           +VIPKV D+++  R  DA P++FP  CP C S  VR  NP+TGKL +  RCTGGL C AQ
Sbjct: 427 DVIPKVADVVLERRPADAVPYAFPETCPACGSHAVRAYNPRTGKLDSVRRCTGGLICPAQ 486

Query: 468 QLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQ 517
             ERL+HFVSR+AF+IEG G+  +   F+    A  +R PAD+F L           RRQ
Sbjct: 487 GQERLRHFVSRNAFDIEGFGETYIATLFE----AGLVRQPADLFRLDFEPLKAAIVARRQ 542

Query: 518 QTSTTKIENILGFG---------------DVSVTNLYDSINKRRNISLERFIFSLGIRHV 562
             S    E  L  G               D ++ NL  ++  RR I L RFIF+LGI  V
Sbjct: 543 ALSA---ERALAAGKTPEAKKAKPKANEEDKAIHNLLAAVEARRTIPLNRFIFALGIEQV 599

Query: 563 GAEIARSLAKYYLSYQNFAQEINNIIA-HNNDDWLSLIRVPLVG 605
           G   A++LAK++       + +    A     DW+ L  +P VG
Sbjct: 600 GEATAKALAKHFPDMPALMEGVRAAAACRPGPDWIELASLPRVG 643



 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 76/120 (63%), Gaps = 9/120 (7%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKN----VSSEIENKKLVFTGTLQ 659
           +G +   +++EF+    N+ AVEALL+EV     R E+      ++    + +VFTG+L+
Sbjct: 713 IGAVTTASLIEFFSEAHNVEAVEALLREV-----RTERAGTPAAAAVFSGQTVVFTGSLE 767

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           ++ R +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GV++++E ++L +++
Sbjct: 768 RMTRSEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKHGVRVISEAEWLAMVE 827


>gi|162148970|ref|YP_001603431.1| DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|190359260|sp|A9H0L6|DNLJ_GLUDA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161787547|emb|CAP57143.1| putative DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 695

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 284/709 (40%), Positives = 420/709 (59%), Gaps = 36/709 (5%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+  QA  EL  L Q+I   D  YY+   P + D+EYDAL++R  AI   FPDL R++ P
Sbjct: 6   LTEPQAMVELERLAQQIRALDRAYYEDDAPTVTDAEYDALRQRNLAIEARFPDLRRADSP 65

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS--IFFT 129
           +     + G  + +  +  H +P LSL+ ++  ED   F+TR  RF    DD +  + F 
Sbjct: 66  S---LHVSGAPSAAFGRHRHLVPMLSLDNVFGREDFESFVTRAARFLGLNDDQARALRFV 122

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  I++ YE G+FV    RGDG  GEDV+A +R +  +P  L    P +IE+RG
Sbjct: 123 AEPKIDGLSISLTYEHGRFVRGTTRGDGTEGEDVTANLRTLRDVPLRLKGPAPALIEIRG 182

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTS 247
           EV++SK  FL++N      G+KP+ANPRNAA+G LR+L+P +IT  R L+ F +  G +S
Sbjct: 183 EVFLSKPAFLSINAAQAEAGQKPFANPRNAAAGSLRQLDP-NITARRPLSLFAYAQGFSS 241

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A   ++ L+++R  GF VN       +     ++ + +   RS L YDIDG+VYKVD
Sbjct: 242 DRVADTHWDYLERLRQWGFTVNPLSCVVESAEAAEAFMDRIARERSGLEYDIDGVVYKVD 301

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ +LG   R+PRW I+ KF  +QA TRL  IDIQ+GRTG LTPVA LEPVN+GG +
Sbjct: 302 DLALQDRLGFVGRAPRWAIAWKFPAEQAITRLTRIDIQVGRTGALTPVAILEPVNVGGVI 361

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV--NERHPDA 425
           +T ATLHNED I             +D+RVGD V ++RAG+VIP+++ ++    +  P  
Sbjct: 362 VTRATLHNEDEI-----------ARKDVRVGDLVQIQRAGDVIPQILGVVPPGADAPPRG 410

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + F FP  CPIC +R  R      G++V   RCTGGL C AQ +ERL HFVSRDAF+I+G
Sbjct: 411 EAFIFPHTCPICGARAER----PPGEVV--WRCTGGLTCPAQVVERLIHFVSRDAFDIDG 464

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++ +  F         ++ PADIF L   +    T+     G+G VS  NL  S+  R
Sbjct: 465 LGERTITEFHADG----LLKTPADIFRLPDHEADIATR----EGWGTVSARNLTASVRAR 516

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           + I L RFI++LGIR +G   AR LA++Y SY ++ +++       +D+ L+L  +  +G
Sbjct: 517 QTIPLARFIYALGIRRIGTSNARLLARHYGSYTHWREQMLRATTIGSDERLALGSITGIG 576

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             IA  +  F+    N+  ++ L   ++ +I   +      +  K +VFTGTL  + R +
Sbjct: 577 GAIADELAAFFMEAHNLETLDDLTAMLT-AIEDEDLPAQGHLSGKTVVFTGTLTTMTRPE 635

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           A+    +LGA V+  +S+KTD++++G + GSK  KA +LG+  ++EE +
Sbjct: 636 AKAIAERLGARVTDSVSKKTDLVVLGADAGSKARKAAELGIDTLDEEGW 684


>gi|99081239|ref|YP_613393.1| DNA ligase, NAD-dependent [Ruegeria sp. TM1040]
 gi|122984289|sp|Q1GGT5|DNLJ_SILST RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|99037519|gb|ABF64131.1| DNA ligase NAD-dependent [Ruegeria sp. TM1040]
          Length = 739

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 294/749 (39%), Positives = 428/749 (57%), Gaps = 61/749 (8%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
           AR E  +L+ +I   D  Y+Q   P + D++YD LKRR  A+A AFP LA+       + 
Sbjct: 6   ARAEFEALQTKIEKADHDYHQKDAPTLSDADYDRLKRRYLALADAFPILAKD---GTRVA 62

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDG 136
            +G        KVTH+   +SL   +  +D+  F   + R+     +  + FT EPKIDG
Sbjct: 63  SVGAPAASGFGKVTHAQRMMSLGNAFEDQDVEDFAVGLRRYLGLSSEAPLAFTAEPKIDG 122

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKN 196
             +++RYE GK V AA RGDG  GE+V+   R I  IP+ +S   PE++EVRGEVY+S  
Sbjct: 123 LSLSLRYEAGKLVQAATRGDGAVGENVTENARTISDIPQEIS-GAPEVLEVRGEVYMSHA 181

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKGQ 254
           DF ALN      G K +ANPRNAA+G LR+L+  +ITR   L FF +  G+ SE  A+ Q
Sbjct: 182 DFEALNARHAETGGKIFANPRNAAAGSLRQLD-AEITRARPLRFFAYSWGELSEPLAETQ 240

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
            + ++++  LGF  N   R       ++++Y+ ++  R+ L YDIDG+VYKV++ SLQ++
Sbjct: 241 IDAIERLASLGFQTNPLTRCCEQISELLAHYHAIEEQRADLGYDIDGVVYKVNDLSLQER 300

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG +++NATLH
Sbjct: 301 LGFRSTTPRWAIAHKFPAELAWTHLEGIDIQVGRTGALSPVARLHPVTVGGVVVSNATLH 360

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NEDYI GLD+ G  +RGG+DIRVGD V + RAG+VIPKV D+ ++ R    + ++FP+ C
Sbjct: 361 NEDYIAGLDSKGAPIRGGKDIRVGDWVQIYRAGDVIPKVADVDLSRRPEGTERYAFPTRC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P C S  VR+         A  RC+GGL C AQ +E+LKHFVSR AF+IEGLG +Q++ F
Sbjct: 421 PRCDSPAVREEGD------AVRRCSGGLICPAQAVEKLKHFVSRAAFDIEGLGAKQVEQF 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
                    ++ PADIF LQ+R  +   +++N  G+G+ S + L+ +I  +R I   R I
Sbjct: 475 HSDG----WVKEPADIFELQQRYGSGLQQLKNREGWGEKSASALFAAIEDKRRIEFARLI 530

Query: 555 FSLGIRHVGAEIARSLAKYYLSY------------------------------------- 577
           F LGIRHVG   A+ LA ++ ++                                     
Sbjct: 531 FGLGIRHVGEVAAKDLALHFRTWSALAEAADLARAAALAHRAADEAEIVERQEAQASARR 590

Query: 578 ------QNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE 631
                 +N A     +   +   W  LI V  +G  +A ++ + + NP    A + L+  
Sbjct: 591 AKISEARNAAVATCAVAPDSQAAWDDLISVDGLGPTVALSLSDAFANPEERAAFDRLIAH 650

Query: 632 VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVG 691
           +   I        S +  K +VFTGTL+K+ R +A+     LGA VS  +S+KTDI++ G
Sbjct: 651 LE-IIEPDAPADDSPVAGKTVVFTGTLEKMTRAEAKARAEALGAKVSGSVSKKTDILVAG 709

Query: 692 DNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
              GSK  KA +LG++ ++E+ +L L+ Q
Sbjct: 710 PGAGSKAAKAAELGIQTLDEDGWLDLIGQ 738


>gi|87199755|ref|YP_497012.1| DNA ligase, NAD-dependent [Novosphingobium aromaticivorans DSM
           12444]
 gi|123763512|sp|Q2G7J5|DNLJ_NOVAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|87135436|gb|ABD26178.1| DNA ligase, NAD-dependent [Novosphingobium aromaticivorans DSM
           12444]
          Length = 721

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 291/746 (39%), Positives = 425/746 (56%), Gaps = 67/746 (8%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           AL+  +A  EL  L ++I+ H+  Y+    P I D+EYDAL RR   +  AFP L R   
Sbjct: 5   ALTEAEAANELMRLARQIAKHNRLYHAEDSPEITDAEYDALVRRNAELEAAFPHLIR--- 61

Query: 71  PNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
           P+ P  +IG E+  S L KV H +  +SL+  +  E++ +F+ R+ RF    +D  +  T
Sbjct: 62  PDSPSAQIGHEIAASPLGKVQHEVRMMSLDNAFTDEEVEEFVARVRRFLALPEDAEVVMT 121

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS----LNIPEII 185
            E KIDG   ++RYE G+ V AA RGDG  GEDV+A +  IP IP+ L      +IP + 
Sbjct: 122 AEDKIDGLSCSLRYENGRLVRAATRGDGQVGEDVTANVAHIPDIPQELKAAGLFDIPAVF 181

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           E+RGEVY++K+DFLALN      G K +ANPRN A+G LR+ + +   +R L F  HG G
Sbjct: 182 EIRGEVYMAKDDFLALNARQAEAGEKIFANPRNGAAGSLRQKDASVTASRPLRFLAHGWG 241

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             SE+ A  Q+EM++K+   G PV+  + + ++   +V++Y ++   R++LPYDIDG+VY
Sbjct: 242 AASEVPAATQFEMMRKIADWGVPVSPLLVRCSSAAEMVAHYRDIGEKRASLPYDIDGVVY 301

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q +LG  A++PRW I+HKF  ++A T L  IDIQ+GRTG LTPV RL+PV +G
Sbjct: 302 KVDRLDWQDRLGFVAKAPRWGIAHKFPAERAETTLDAIDIQVGRTGKLTPVGRLKPVLVG 361

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G  +TN TLHN D I           G   +RVGDR++++RAG+VIP+VV+ +  E   D
Sbjct: 362 GVTVTNVTLHNRDEI-----------GRLGLRVGDRIVLQRAGDVIPQVVENLTREEPRD 410

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
             P+ FP  CP C S  V +     G++    RCTGGL C AQ++ERLKHFVSR A +IE
Sbjct: 411 --PYHFPDHCPECGSEAVAE----EGEVDV--RCTGGLICPAQRVERLKHFVSRAALDIE 462

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++ +  FF+       +  PADIF L++R+    ++I    G+ D SV NL  +I  
Sbjct: 463 GLGEKTIIEFFQ----LGWLESPADIFRLRKRR----SEIVGREGWKDKSVDNLLAAIEA 514

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQ---------------------- 582
           +R     R +F LGIRHVGA  AR L K +++     +                      
Sbjct: 515 KRQPDAARLLFGLGIRHVGAVTARDLMKRFVTLPALREAARQASSAAREGEPANADGAYD 574

Query: 583 --------EINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSP 634
                   +     A  +D    L+ +  VG ++ +A+ +F+  P NI   E LL EVSP
Sbjct: 575 PATVTPDSDTAGAEAGRSDALADLLSIDGVGPVVVEALGDFFHEPHNIAVWEDLLSEVSP 634

Query: 635 SIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNP 694
                E    S +  K +VFTG L+ + R +A+     LGA  +  +S KTD+++ G   
Sbjct: 635 PPYVVETK-DSAVAGKTIVFTGKLETMSRDEAKAQAEALGARTAGSVSAKTDLVVAGPGA 693

Query: 695 GSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           GSKL++A  LG+ +++E  +  +++Q
Sbjct: 694 GSKLKQAAALGIDVIDEAAWAEIVRQ 719


>gi|209545276|ref|YP_002277505.1| NAD-dependent DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532953|gb|ACI52890.1| DNA ligase, NAD-dependent [Gluconacetobacter diazotrophicus PAl 5]
          Length = 708

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 286/716 (39%), Positives = 424/716 (59%), Gaps = 37/716 (5%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
           +L P E L+  QA  EL  L Q+I   D  YY+   P + D+EYDAL++R  AI   FPD
Sbjct: 13  RLDPSE-LTEPQAMVELERLAQQIRALDRAYYEDDAPTVTDAEYDALRQRNLAIEARFPD 71

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           L R++ P+     + G  + +  +  H +P LSL+ ++  ED   F+TR  RF    DD 
Sbjct: 72  LRRADSPS---LHVSGAPSAAFGRHRHLVPMLSLDNVFGREDFESFVTRAARFLGLNDDQ 128

Query: 125 S--IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           +  + F  EPKIDG  I++ YE G+FV    RGDG  GEDV+A +R +  +P  L    P
Sbjct: 129 ARALRFVAEPKIDGLSISLTYEHGRFVRGTTRGDGTEGEDVTANLRTLRDVPLRLKGPAP 188

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFV 240
            +IE+RGEV++SK  FL++N      G+KP+ANPRNAA+G LR+L+P +IT  R L+ F 
Sbjct: 189 ALIEIRGEVFLSKPAFLSINAAQAEAGQKPFANPRNAAAGSLRQLDP-NITARRPLSLFA 247

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           +  G +S+  A   ++ L+++R  GF VN       +     ++ + +   RS L YDID
Sbjct: 248 YAQGFSSDRVADTHWDYLERLRQWGFTVNPLSCVVESAEAAEAFMDRIARERSGLEYDID 307

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKVD+ +LQ +LG   R+PRW I+ KF  +QA TRL  I+IQ+GRTG LTPVA LEP
Sbjct: 308 GVVYKVDDLALQDRLGFVGRAPRWAIAWKFPAEQAITRLTRINIQVGRTGALTPVAILEP 367

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV-- 418
           VN+GG ++T ATLHNED I             +D+RVGD V ++RAG+VIP+++ ++   
Sbjct: 368 VNVGGVIVTRATLHNEDEI-----------ARKDVRVGDLVQIQRAGDVIPQILGVVPPG 416

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
            +  P  + F FP  CPIC +R  R      G++V   RCTGGL C AQ +ERL HFVSR
Sbjct: 417 ADAPPRGEAFIFPHTCPICGARAER----PPGEVV--WRCTGGLTCPAQVVERLIHFVSR 470

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
           DAF+I+GLG++ +  F         ++ PADIF L   +    T+     G+G VS  NL
Sbjct: 471 DAFDIDGLGERTITEFHADG----LLKTPADIFRLPDHEADIATR----EGWGTVSARNL 522

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
             S+  R+ I L RFI++LGIR +G   AR LA++Y SY ++ +++       +D+ L+L
Sbjct: 523 TASVRARQTIPLARFIYALGIRRIGTSNARLLARHYGSYTHWREQMLRATTIGSDERLAL 582

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +G  IA  +  F+    N+  ++ L   ++ +I   +      +  K +VFTGTL
Sbjct: 583 GSITGIGGAIADELAAFFMEAHNLETLDDLTAMLT-AIEDEDLPAQGHLSGKTVVFTGTL 641

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
             + R +A+    +LGA V+  +S+KTD++++G + GSK  KA +LG+  ++EE +
Sbjct: 642 TTMTRPEAKAIAERLGARVTDSVSKKTDLVVLGADAGSKARKAAELGIDTLDEEGW 697


>gi|163854038|ref|YP_001642081.1| DNA ligase, NAD-dependent [Methylobacterium extorquens PA1]
 gi|254781364|sp|A9VWA4|DNLJ_METEP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163665643|gb|ABY33010.1| DNA ligase, NAD-dependent [Methylobacterium extorquens PA1]
          Length = 814

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 260/621 (41%), Positives = 378/621 (60%), Gaps = 31/621 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +EALS + A+   + L + I   +  YY    P + D+EYDAL++  +AI   FP L  +
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPALTGT 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            + +     +G + +    KV H++P LSL   +  ED+ +F+ R+ RF     + S+ F
Sbjct: 70  TEASA---GVGAKPSEKFAKVRHAVPMLSLGNAFADEDVDEFVARVRRFLNLPAEESVAF 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEV 187
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A    +  IP  LS  NIPE++EV
Sbjct: 127 TAEPKIDGLSLSLRYEAGRLVTAATRGDGEVGENVTANALTVDDIPETLSGENIPEVLEV 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ 
Sbjct: 187 RGEVYLSHEDFAAINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGEV 246

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE F   Q  +L++ R  G PVN   +   +   ++++Y  +++ R+ L YDIDG+VYKV
Sbjct: 247 SEPFTDTQSAVLERFRGWGLPVNPRTKLCRSAEEMIAHYRTIEAERAGLGYDIDGVVYKV 306

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+   Q++LG  +R+PRW ++HKFA ++A T LL IDI +GRTG L P+ARL+PV +GG 
Sbjct: 307 DDLGFQRRLGFVSRAPRWALAHKFAAQEAITELLAIDINVGRTGSLNPLARLKPVTVGGV 366

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNE Y++G+ A G+ +R GRDIRVGD V+V RAG+VIPKV D+++ +R  DA 
Sbjct: 367 VVSNATLHNEGYVQGVGADGEPIREGRDIRVGDTVIVVRAGDVIPKVRDVVIEKRPADAV 426

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C SR VR+LNP+T KL A  RCTGGL C AQ +ERLKHFVSR+ F++EG 
Sbjct: 427 PYVFPDTCPACGSRAVRELNPRTKKLDAIRRCTGGLICPAQGVERLKHFVSRNGFDLEGF 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQQTSTTK-----------IE 525
           G+  ++  F+    A  ++ PAD+F L+          RR+  S  +            +
Sbjct: 487 GQTYIEVLFE----AGLVKQPADLFRLEFEPLKAAIVARRETLSAQRRSEGEPAPKKPTK 542

Query: 526 NILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN 585
                 D ++ NL  S++ RR I L RF+F+LGI  +G   A++LAK +    +    + 
Sbjct: 543 KKGEEEDKAIKNLLASLDARRTIPLNRFLFALGIPQIGESTAKALAKRFPDMPSLMAALE 602

Query: 586 NII-AHNNDDWLSLIRVPLVG 605
                    DWL L  +P +G
Sbjct: 603 AATREQAGRDWLELSALPRIG 623



 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G +   ++++F+  P N  AV ALL+EV  +        ++    K +VFTG+L+K+ R
Sbjct: 698 IGPVATDSLIQFFSEPHNDAAVRALLEEVG-TEPLATTTSAAAFAGKTVVFTGSLEKMTR 756

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GVK+++E+ +L +L +
Sbjct: 757 SEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKHGVKVVSEDDWLAMLAE 813


>gi|90424785|ref|YP_533155.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB18]
 gi|123275077|sp|Q211V0|DNLJ_RHOPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|90106799|gb|ABD88836.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB18]
          Length = 795

 Score =  504 bits (1298), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 292/799 (36%), Positives = 427/799 (53%), Gaps = 115/799 (14%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           ++ LS  +A+ EL  L  EI  H++ YYQ   P I D+EYDAL+ R +AI   FP+L  S
Sbjct: 12  LDTLSKAKAKVELKRLSLEIERHNNAYYQDDAPKISDAEYDALRHRVEAIEAKFPELVSS 71

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + P     K+G        KV H++P LSL   ++ +++ +F+TR+ RF +   +     
Sbjct: 72  DSPT---QKVGAAPARGFAKVQHAVPMLSLGNAFSDDEVAEFLTRVRRFLKLDAEQIPAI 128

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEV 187
             EPKIDG  +++RYE GK V AA RGDG +GEDV+A +R I  IP  L++   P   E+
Sbjct: 129 VAEPKIDGLSLSLRYEHGKLVRAATRGDGFTGEDVTANVRTIKDIPHALAVAEPPAACEL 188

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVY+ K+DFLALN      G  P+ANPRN+A+G LR+ +     +R L FF +  G+ 
Sbjct: 189 RGEVYMLKSDFLALNQRQETAGEPPFANPRNSAAGSLRQKDVAITASRPLKFFAYAWGEF 248

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S++    QY ML  ++  GF VN  +    +    +++Y ++   R+TLPYDIDG+VYKV
Sbjct: 249 SDLPEATQYGMLGWLKRAGFTVNPLITLCKSVDDALAFYRKIGEERATLPYDIDGVVYKV 308

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG   R+PRW I+HKFA +QA+T L  I+IQ+GRTG LTPVARL PV +GG 
Sbjct: 309 DRLDWQERLGFAGRAPRWAIAHKFAAEQATTILNGIEIQVGRTGALTPVARLAPVTVGGV 368

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHNEDYIK L           DI +GD V+V+RAG+VIP++V ++ ++R  DA+
Sbjct: 369 VVQNATLHNEDYIKSL-----------DIHIGDTVVVQRAGDVIPQIVSVVRDKRPEDAE 417

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP FCP C S  VRD +       A  RCTGGL C AQ +ERL+HFVSR AF+I G 
Sbjct: 418 PYEFPKFCPACGSHAVRDEDEGE----AVRRCTGGLICPAQAIERLRHFVSRGAFDIAGF 473

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ-----------RRQQTSTTKIENILGFGDVS- 534
           G+  ++  ++       +R PADIF L            R++++  T+ E   G    S 
Sbjct: 474 GETYVELLYEEG----LVRNPADIFALHSKVDELKAALFRKRESLATQREEKTGKKRKSS 529

Query: 535 ----------VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI 584
                     V NL  +I+ RR ++  RFIF LGIRHVG   +++L +++   + F   +
Sbjct: 530 LSEEKRQYTDVENLLAAIDARRTVAFNRFIFGLGIRHVGEVTSKALVRHFADVKAFLDGV 589

Query: 585 N-NIIAHNNDDWLSLIRVPLVGDIIAQAIVEF--------------------------YQ 617
           +   +A     WL L  V  +G+I  + ++E                           Y 
Sbjct: 590 DAAALARPGPAWLDLKNVRYIGEITLERLLEIQGGADTNEERQGFQPDARQRASLLSHYG 649

Query: 618 NPRNICAVEALLKEVSPSIGRHEKNVSSEI--------------ENKKLVFTGTLQKIQ- 662
           N   I       +  +P     +    SEI               N + V T  + ++Q 
Sbjct: 650 NEEKIAGALQAARSEAPGPAFQQLANDSEIGEVATQSLIDFFEETNNRQVVTALMDQVQV 709

Query: 663 ---------------------------RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG 695
                                      R +A+    +LGA V++ +S KTD+++ G + G
Sbjct: 710 ERPAAASAKSPISGKIVVFTGALERTTRDEAKAIAERLGAKVASSVSSKTDLVVAGPSAG 769

Query: 696 SKLEKAQQLGVKIMNEEQF 714
           SKL  AQ+ GVK++ EE++
Sbjct: 770 SKLRDAQKFGVKVLTEEEW 788


>gi|84500836|ref|ZP_00999071.1| DNA ligase, NAD-dependent [Oceanicola batsensis HTCC2597]
 gi|84390903|gb|EAQ03321.1| DNA ligase, NAD-dependent [Oceanicola batsensis HTCC2597]
          Length = 626

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 270/637 (42%), Positives = 395/637 (62%), Gaps = 15/637 (2%)

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
           +   K+TH++  +SL   ++  D+ +F  RI  +     D  + +T EPKIDG  +++RY
Sbjct: 1   MGFGKITHAVRMMSLANAFDDADVAEFDARIRSYLNLAADAPLAYTAEPKIDGLSLSLRY 60

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E G+ V AA RGDG  GE+V+A  R I  IP V     PE++EVRGEVY+S  DF ALN 
Sbjct: 61  ENGRLVQAATRGDGEVGENVTANARTIDDIP-VEVTGAPEVMEVRGEVYMSHADFAALNA 119

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKGQYEMLQKM 261
                G K +ANPRNAA+G LR+L+   ITR   L FF +  G  S   A  Q + ++++
Sbjct: 120 RQAERGGKTFANPRNAAAGSLRQLD-AQITRARPLRFFAYSWGDLSAPLAATQTQAIERL 178

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
           R LGF  N   R+ +    ++ +Y  ++  R+TL YDIDG+VYKVD+ +LQ +LG R+ +
Sbjct: 179 RRLGFRTNPLTRRCDGPQDMLDHYRSIEEQRATLGYDIDGVVYKVDDLALQNRLGSRSTT 238

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PRW ++HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG +++NATLHNEDYI G
Sbjct: 239 PRWALAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGGVVVSNATLHNEDYIAG 298

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRV 441
            D+ G+ +RGG+DIR+GD V V RAG+VIPKV D+ +++R  DA+P+ FP+ CP C S  
Sbjct: 299 RDSRGEEIRGGKDIRIGDWVQVYRAGDVIPKVADVDLSKRPDDAEPYVFPTKCPECGSDA 358

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
           +R+         A  RCTGG+ C AQ +E+LKHFVSR AF+IEGLG +Q++ F+      
Sbjct: 359 LREPGD------AVRRCTGGVVCPAQAVEKLKHFVSRAAFDIEGLGARQVEAFYTD---- 408

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             I  PA+IFTL+ R       ++N  G+G+ S TNL+ +I+++R I L R +F+LGIRH
Sbjct: 409 GWITEPAEIFTLEERYGRGLRALKNREGWGEKSATNLFRAIDEKRRIPLSRLLFALGIRH 468

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           VG   +  +A +Y ++    +E     A        L  +  VG+++A ++   + NP  
Sbjct: 469 VGESASALIANHYGTWDAL-EEAMVAAAEPGQAREDLTGIDGVGEVMATSLTSAFANPAE 527

Query: 622 ICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL 681
             +++ L+  +     R      S +  K +VFTGTL+K+ R +A+     LGA VS  +
Sbjct: 528 RASMDRLVAHLDVQESRRAVAADSPVAGKTVVFTGTLEKMTRAEAKARAESLGAKVSGSV 587

Query: 682 SRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           S KTD+++ G   GSK +KA +LGV+ M+E+ +L L+
Sbjct: 588 SAKTDLLVAGPGAGSKAKKAAELGVETMDEDGWLALI 624


>gi|326387612|ref|ZP_08209218.1| DNA ligase, NAD-dependent [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207658|gb|EGD58469.1| DNA ligase, NAD-dependent [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 687

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 285/710 (40%), Positives = 417/710 (58%), Gaps = 33/710 (4%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           + I+A++   A  EL  L ++I+YHD  Y+    P I D+EYDAL RR   I  AFP L 
Sbjct: 1   MTIDAMTEADAANELMRLARQIAYHDRLYHTLDTPEIADAEYDALVRRNAEIEAAFPHLI 60

Query: 67  RSEDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R++ P+    K+G ++  S L KVTH +  +SL+  +  E++ +F  R+ RF     +  
Sbjct: 61  RADSPS---RKVGHDVAASPLSKVTHEVRMMSLDNAFTDEEVEEFAARVRRFLALPAEAE 117

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           +  T E KIDG   ++RYE G+ V AA RGDG  GEDV+A +  IP IP+ LS ++PE+ 
Sbjct: 118 VAMTAEDKIDGLSCSLRYEHGRLVRAATRGDGQVGEDVTANVAFIPDIPQHLSGDVPEVF 177

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           E+RGEVY++K DF ALN      G K +ANPRNAA+G LR+ + +   +R L F  HG G
Sbjct: 178 EIRGEVYMAKADFAALNVAQEEKGEKRFANPRNAAAGSLRQKDASVTASRPLRFLAHGWG 237

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             S + A+ QY+++Q +   G PV+  + +  T   ++++Y  +++ R  LPYDIDG+VY
Sbjct: 238 AHSGLPAQTQYDVMQVIAGWGVPVSPLLVRCATTADMLAHYRAIQAQRPDLPYDIDGVVY 297

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  A++PRW ++HKF  ++A T +  ID+Q+GRTG LTPV RL PV +G
Sbjct: 298 KVDRLDWQERLGFVAKAPRWGMAHKFPAERAETVVEAIDVQVGRTGKLTPVGRLRPVLVG 357

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G  +TN TLHN D I  L            +RVGDRV+++RAG+VIP+VVD +  E   +
Sbjct: 358 GVTVTNVTLHNRDEIARL-----------GVRVGDRVVLQRAGDVIPQVVDNLTREEARE 406

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A  + FP  CP C S  V     + G++    RCTGGL C AQ+ ERLKHFVSR A +I+
Sbjct: 407 A--YVFPDHCPECGSEAV----AEEGEVDV--RCTGGLICPAQRTERLKHFVSRAALDID 458

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++ +  FF        +  PADIF L+ R+      I    G+ D SV NL  +I  
Sbjct: 459 GLGEKTIVEFFA----LGWLESPADIFRLKNRR----ADILGREGWKDKSVENLLMAIEA 510

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR     R +F+LGIRHVG   AR L K +++  +         A + D    L+ +  V
Sbjct: 511 RRAPDAARLLFALGIRHVGQVTARDLMKRFVTLPDLRAVAERAHAGDEDARAELLGIDGV 570

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++ +A+ EF+  P N    + LL E+SP     E   +S +  K +VFTG L+ + R 
Sbjct: 571 GPVVVEALGEFFHEPHNRAVWDDLLSELSPPPYIVETR-ASVVAGKTVVFTGKLETMSRD 629

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           +A+     LGA  +  +S KTD+++ G   GSKL++A  LG+++++E  +
Sbjct: 630 EAKAQAEALGARAAGSVSAKTDLVVAGPGAGSKLKQAAALGIEVIDEAAW 679


>gi|240141492|ref|YP_002965972.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
 gi|240011469|gb|ACS42695.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
          Length = 814

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 259/621 (41%), Positives = 378/621 (60%), Gaps = 31/621 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +EALS + A+   + L + I   +  YY    P + D+EYDAL++  +AI   FP L  +
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPALTGT 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            + +     +G + +    KV H++P LSL   +  ED+ +F+ R+ RF     + ++ F
Sbjct: 70  TEASA---GVGAKPSEKFAKVRHAVPMLSLGNAFADEDVDEFVARVRRFLNLPAEEAVAF 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEV 187
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A    +  IP  LS  NIPE++EV
Sbjct: 127 TAEPKIDGLSLSLRYEAGRLVTAATRGDGEVGENVTANALTVDDIPETLSGENIPEVLEV 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ 
Sbjct: 187 RGEVYLSHEDFAAINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGEV 246

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE F   Q  +L++ R  G PVN   +   +   ++++Y  +++ R+ L YDIDG+VYKV
Sbjct: 247 SEPFTDTQSAVLERFRGWGLPVNPRTKLCRSAEEMIAHYRTIEAERAGLGYDIDGVVYKV 306

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+   Q++LG  +R+PRW ++HKFA ++A T LL IDI +GRTG L P+ARL+PV +GG 
Sbjct: 307 DDLGFQRRLGFVSRAPRWALAHKFAAQEAITELLAIDINVGRTGSLNPLARLKPVTVGGV 366

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNE Y++G+ A G+ +R GRDIRVGD V+V RAG+VIPKV D+++++R  DA 
Sbjct: 367 VVSNATLHNEGYVQGVGADGEPIREGRDIRVGDTVIVVRAGDVIPKVRDVVIDKRPADAV 426

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C SR VR+LNP+T KL A  RCTGGL C AQ +ERLKHFVSR+ F++EG 
Sbjct: 427 PYVFPDTCPACGSRAVRELNPRTKKLDAIRRCTGGLICPAQGVERLKHFVSRNGFDLEGF 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQQTSTTK-----------IE 525
           G+  ++  F+    A  ++ PAD+F L+          RR+  S  +            +
Sbjct: 487 GQTYIEVLFE----AGLVKQPADLFRLEFEPLKAAIVARREALSAQRRAEGEPAPKKPTK 542

Query: 526 NILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN 585
                 D ++ NL  S++ RR I L RF+F+LGI  +G   A++LAK +         + 
Sbjct: 543 KKGEEEDKAIKNLLASLDARRTIPLNRFLFALGIPQIGESTAKALAKRFPDMPALMAALA 602

Query: 586 NII-AHNNDDWLSLIRVPLVG 605
                    DWL L  +P +G
Sbjct: 603 AATREQAGQDWLELSALPRIG 623



 Score = 82.0 bits (201), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G +   ++++F+  P N  AV ALL+EV  +        ++    K +VFTG+L+K+ R
Sbjct: 698 IGPVATDSLIQFFSEPHNDAAVRALLEEVG-TEPLATTTSAAAFAGKTVVFTGSLEKMTR 756

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GVK+++E+ +L +L +
Sbjct: 757 SEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKHGVKVVSEDDWLAMLAE 813


>gi|254564006|ref|YP_003071101.1| DNA ligase [Methylobacterium extorquens DM4]
 gi|254271284|emb|CAX27296.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens DM4]
          Length = 814

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 257/621 (41%), Positives = 378/621 (60%), Gaps = 31/621 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +EALS + A+   + L + I   +  YY    P + D+EYDAL++  +AI   FP L  +
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPALTGT 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            + +     +G + +    KV H++P LSL   +  ED+ +F+ R+ RF     + ++ F
Sbjct: 70  TEASA---GVGAKPSEKFAKVRHAVPMLSLGNAFADEDVDEFVARVRRFLNLPAEEAVAF 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEV 187
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A    +  IP  LS   IPE++EV
Sbjct: 127 TAEPKIDGLSLSLRYEAGRLVTAATRGDGEVGENVTANALTVDDIPETLSGEGIPEVLEV 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGE+Y+S +DF A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ 
Sbjct: 187 RGEIYLSHDDFAAINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGEV 246

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE F   Q  +L++ R  G PVN   +   +   ++++Y  +++ R+ L YDIDG+VYKV
Sbjct: 247 SEPFNDTQSAVLERFRGWGLPVNPRTKLCRSAEEMIAHYRAIEAERAGLGYDIDGVVYKV 306

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+   Q++LG  +R+PRW ++HKFA ++A T LL IDI +GRTG L P+ARL+PV +GG 
Sbjct: 307 DDLGFQRRLGFVSRAPRWALAHKFAAQEAITELLAIDINVGRTGSLNPLARLKPVTVGGV 366

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNE Y++G+ A G+ +R GRDIRVGD V+V RAG+VIPKV D+++++R  DA 
Sbjct: 367 VVSNATLHNEGYVQGVGADGEPIREGRDIRVGDTVIVVRAGDVIPKVRDVVLDKRPADAV 426

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C SR VR+LNP+T KL A  RCTGGL C AQ +ERLKHFVSR+ F++EG 
Sbjct: 427 PYVFPDTCPACGSRAVRELNPRTKKLDAIRRCTGGLICPAQGVERLKHFVSRNGFDLEGF 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQQTSTTK-----------IE 525
           G+  ++  F+    A  ++ PAD+F L+          RR+  S  +            +
Sbjct: 487 GQTYIEVLFE----AGLVKQPADLFRLEFEPLKAAIVARREALSAQRRTEGEPAPKKPTK 542

Query: 526 NILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN 585
                 D ++ NL  S+  RR I L RF+F+LGI  +G   A++LAK +         ++
Sbjct: 543 KKGEEEDKAIKNLLASLEARRKIPLNRFLFALGIPQIGESTAKALAKRFPDMPALMAALS 602

Query: 586 NIIAHN-NDDWLSLIRVPLVG 605
                    DWL L  +P +G
Sbjct: 603 AATQEQAGQDWLELSALPRIG 623



 Score = 84.0 bits (206), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%), Gaps = 5/117 (4%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKI 661
           +G +   ++++F+  P N  AV ALL+EV   P +       ++    K +VFTG+L+K+
Sbjct: 698 IGPVATDSLIQFFSEPHNDAAVRALLEEVGTEPLVA---TTSAAAFAGKTVVFTGSLEKM 754

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GVK+++E+ +L +L
Sbjct: 755 TRSEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKHGVKVVSEDDWLAML 811


>gi|197105771|ref|YP_002131148.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
 gi|254781386|sp|B4RFE9|DNLJ_PHEZH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|196479191|gb|ACG78719.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
          Length = 692

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 287/713 (40%), Positives = 422/713 (59%), Gaps = 29/713 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E+L+  +A +EL+ L  EI+ HD  YY+   P I D+ YDAL+RR D +  AFP L R 
Sbjct: 4   VESLTEAEAAEELTRLADEIAAHDIRYYREDAPTISDAAYDALRRRNDELEAAFPHLIRE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  +IG         V H +P LSL+  ++  D  +F  R+ RF +   D  + +
Sbjct: 64  ---NSPSLRIGAARAEQFAPVEHGVPMLSLDNAFSDADALEFDARVKRFLRL--DEEVAY 118

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEV 187
           T EPKIDG   +IRYE G+ V AA RGDG  GEDV+A +R I  IP+ L     PE+IE+
Sbjct: 119 TAEPKIDGLSCSIRYENGRLVRAATRGDGRVGEDVTANVRTIGEIPQKLHGQAWPEVIEI 178

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+   +F ALN+   + G+K YANPRNAA+G LR+++P     R L FF +  G  
Sbjct: 179 RGEVYLGHAEFAALNEAAASAGQKTYANPRNAAAGSLRQIDPKITAQRPLRFFAYAWGFV 238

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S  FA+ Q+E LQ ++  GF      R      G++  Y EM++ R  L +DIDG+VYKV
Sbjct: 239 SAPFAQTQWEALQALKAWGFRTTPQSRCVKGAEGLMEAYREMEAERPHLGFDIDGVVYKV 298

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG  +R+PRW I+ KF  +QA T L  IDIQ+GRTG LTPVARL PV +GG 
Sbjct: 299 DRLEWQQRLGFVSRAPRWGIARKFPAEQARTVLEAIDIQVGRTGALTPVARLTPVTVGGV 358

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHN D I  L           D+RVGD V+++RAG+VIP+++ +I  ER  D+ 
Sbjct: 359 VVTNATLHNADEIARL-----------DVRVGDTVVLQRAGDVIPQILRVIPEERPKDSV 407

Query: 427 PFSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           P+ FP  CP   ++ VVR+    +G      RC+G  AC  Q++  L HFVSR AF+IEG
Sbjct: 408 PYDFPHVCPCPLRTEVVRETT-ASGAETVVRRCSGEFACPFQRINHLLHFVSRRAFDIEG 466

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++QL  FF+       I+ PADIF L  ++     ++  +   G+ SV NL  +I  R
Sbjct: 467 LGEKQLTAFFERG----WIKAPADIFRLHEKRD----ELLAMERMGETSVGNLLANIEAR 518

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L+RFI+ LGIRH+G   A  +A+ Y +  +F + ++ + A + +    L  +  +G
Sbjct: 519 RTIGLDRFIYGLGIRHIGETTATVMARGYGTAAHFLEAMDKVAARDPEAVEELDALDQIG 578

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             + +A   F+    N   VE L  +++  +   +    + +  K +VFTG L+++ R +
Sbjct: 579 GAVIEAAAAFFGEDHNRAMVEDLAGQLT-ILDAEKPKTDTAVAGKTVVFTGALERMTRDE 637

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+    +LGA VS  +S+KTDI++ G   GSKL+ A +LG++++ E+++L ++
Sbjct: 638 AKAQAERLGAKVSGSVSKKTDIVVAGPGAGSKLKTAAELGIQVLTEDEWLEMV 690


>gi|148557620|ref|YP_001265202.1| DNA ligase, NAD-dependent [Sphingomonas wittichii RW1]
 gi|190359290|sp|A5VFJ8|DNLJ_SPHWW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148502810|gb|ABQ71064.1| DNA ligase, NAD-dependent [Sphingomonas wittichii RW1]
          Length = 708

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 288/728 (39%), Positives = 422/728 (57%), Gaps = 62/728 (8%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           QA + L+ L  EI+ H+  Y+    P I D++YDAL R   A+   +P L R++ P+   
Sbjct: 6   QAAERLAFLAAEIARHNALYHGEDAPEISDADYDALMRENAALEAEYPHLVRADSPS--- 62

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
             +G   +  L KV H+ P LSL+  +  ED+  F+ R+ R+     +  +  T EPKID
Sbjct: 63  KLVGAAPSGHLAKVAHAQPMLSLDNAFADEDVVDFVGRVRRYLSLGAEEPVALTAEPKID 122

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-----LNIPEIIEVRGE 190
           G   ++RYEKG  V AA RGDG +GEDV+A +R I  IP  L       + P++ E+RGE
Sbjct: 123 GLSCSLRYEKGVLVLAATRGDGTTGEDVTANVRTIDDIPERLRGGDLLSSPPDVFEIRGE 182

Query: 191 VYISKNDFLALNDEMIAVGRKP-----YANPRNAASGILRRLNP-TDITRYLNFFVHGLG 244
           VY++K DF ALN  ++A    P     +ANPRNAA+G LR+ +P    +R L F  HG G
Sbjct: 183 VYMAKADFAALNARLLAEAEDPAKARQFANPRNAAAGSLRQKDPGVTASRPLRFLAHGWG 242

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S + A  Q  ++  +   G PV++   + +     +S+Y  +++ R+ LP+DIDG+VY
Sbjct: 243 EVSALPADTQKGVMDAIAAWGLPVSDDFVRVDGAAQALSHYRAIEAKRADLPFDIDGVVY 302

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    QK+LG  AR+PRW I+HKF  ++A T L DIDIQ+GRTG LTPVARLEPV +G
Sbjct: 303 KVDRLDWQKRLGFVARAPRWAIAHKFPAEKAQTLLKDIDIQVGRTGKLTPVARLEPVTVG 362

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHN D I           G  D+  GDRV+V+RAG+VIP++V+ +  +   D
Sbjct: 363 GVVVTNATLHNADEI-----------GRLDVHPGDRVVVQRAGDVIPQIVENLSRDETRD 411

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
             P+ FP  CP C S   R+     G++   +RCTGGL C AQ++ERL+HFVSR A +IE
Sbjct: 412 --PWPFPQTCPECGSAAERE----PGEV--DYRCTGGLICPAQRVERLRHFVSRHALDIE 463

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG   ++ FF+       ++ PADIF L +    +  +      + +VS  NL  +I+ 
Sbjct: 464 GLGLTHIESFFRD----GLVQSPADIFRLTKDILLTRER------WAEVSAGNLIAAIDA 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII---------------- 588
           +R+  L+RF+F+LGIRHVG   AR LA+ Y S++     I+  I                
Sbjct: 514 KRHPPLDRFLFALGIRHVGEVTARDLARRYRSWEGLKAMIDRTIEARDAAVQAIGETDEK 573

Query: 589 --AHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE 646
             A    +  +++  P VG  +A A+V+F+  P N  AV  LL ++ P+   HE   +SE
Sbjct: 574 FAARTAKELAAIVETPGVGPEVALALVDFFAEPHNADAVADLLSQLQPADVIHETR-ASE 632

Query: 647 IENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGV 706
           +  K +VFTGTL+ + R +A+     LGA V+  +S KTD+++ G   GSKL+KA  LG+
Sbjct: 633 VSGKTVVFTGTLETMSRDEAKAQAEALGAKVAGSVSAKTDLVVAGPGAGSKLKKASDLGI 692

Query: 707 KIMNEEQF 714
            + +E  +
Sbjct: 693 AVTDEAGW 700


>gi|332188479|ref|ZP_08390201.1| DNA ligase, NAD-dependent [Sphingomonas sp. S17]
 gi|332011491|gb|EGI53574.1| DNA ligase, NAD-dependent [Sphingomonas sp. S17]
          Length = 712

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 295/719 (41%), Positives = 420/719 (58%), Gaps = 58/719 (8%)

Query: 26  QEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLS 85
           +EI++H+  Y+    P I D++YDAL RR  AI  AFP L RS+ PN    ++G      
Sbjct: 23  REIAHHNRLYHTEDAPEISDADYDALIRRNMAIEAAFPHLIRSDSPN---RQVGAAPAAH 79

Query: 86  LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEK 145
           L KV H+ P  SL+  ++ E++ +FI R+ R+ +  DD  +  T EPKIDG   ++RY  
Sbjct: 80  LAKVAHARPMTSLDNAFSDEEVEEFIGRVRRYLKLPDDEPVTLTAEPKIDGLSCSLRYVD 139

Query: 146 GKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALN--- 202
           G+ V A  RGDG  GEDV+  +R I  IP+ L    P + EVRGEVY+SK DF ALN   
Sbjct: 140 GRLVQALTRGDGTIGEDVTENVRTIADIPQSLPAPAPTVFEVRGEVYMSKVDFTALNARL 199

Query: 203 -DEMIAVGR--KPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAKGQYEM 257
             E    G+  + +ANPRNAA+G LR+ NP  IT  R L F  HG G+ SE+ A+ Q++M
Sbjct: 200 AQEAAETGKEARQFANPRNAAAGSLRQKNPA-ITAGRPLRFLAHGWGEASEVPAETQFDM 258

Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317
           ++  R  GFP+     +       ++ Y  +++ R+ LP+DIDG+VYKVD    Q +LG 
Sbjct: 259 VETWRRWGFPIAEAFARVPDAAAALAVYRTIEAQRADLPFDIDGVVYKVDRLDWQARLGI 318

Query: 318 RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED 377
             R+PRW I+HKF  ++A T L  IDIQ+GRTG LTPVARLE V +GG ++TNATLHN D
Sbjct: 319 VGRTPRWAIAHKFPAERAQTTLERIDIQVGRTGALTPVARLEAVTVGGVVVTNATLHNAD 378

Query: 378 YIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPIC 437
            I+ L            +R GDRV+++RAG+VIP++V+ +   RH   +PF FP  CP C
Sbjct: 379 EIERL-----------GVRPGDRVVLQRAGDVIPQIVENLT--RHVAREPFVFPDHCPEC 425

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
            S   R      G++V   RCTGGL C AQ++ERL HFVSR AF+I GLG  +++ FF+ 
Sbjct: 426 GSLATR----GEGEVVI--RCTGGLICPAQRVERLIHFVSRHAFDITGLGLVRVEEFFRD 479

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
                 I  PADIF L + ++    +        ++ V  L  +I+ RR+ISL+RF+F+L
Sbjct: 480 G----LIASPADIFRLAQHREALIQRER----MSELVVDKLLAAIDARRDISLDRFLFAL 531

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL------------------I 599
           GIRHVG   AR LA+ ++S   F   I+  +    +   +L                  I
Sbjct: 532 GIRHVGEITARDLARRFVSMAGFRAMIDAALQVRAETVPALGEPERKFELRRQRAIVAAI 591

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
             P +G  +A A+++F+    N   V+ LL EV+P+   H+    S++  K LVFTGTL+
Sbjct: 592 DTPQIGPEVADALLDFFAEEHNRDVVDDLLSEVTPADVVHQTR-ESDVSGKTLVFTGTLE 650

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            + R +A+     LGA VS  +S KTD++I G   GSKL+KAQ LG+ +++E  +  L+
Sbjct: 651 TLSRDEAKAQAEALGARVSGSVSAKTDLVIAGPGAGSKLKKAQDLGIPVIDEAAWNALV 709


>gi|188584367|ref|YP_001927812.1| DNA ligase, NAD-dependent [Methylobacterium populi BJ001]
 gi|254781367|sp|B1Z9P1|DNLJ_METPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|179347865|gb|ACB83277.1| DNA ligase, NAD-dependent [Methylobacterium populi BJ001]
          Length = 814

 Score =  499 bits (1284), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 256/621 (41%), Positives = 377/621 (60%), Gaps = 31/621 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E+LS + A+   + L + I   +  YY    P + D+EYDAL++  +AI   FP L  +
Sbjct: 10  VESLSEDAAQARHAELSRAIERANHLYYNEDAPELTDAEYDALRQELEAIEARFPALTGT 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            + +     +G + +    KV H++P LSL   +  ED+ +F+ R+ RF     +  + F
Sbjct: 70  TEASA---GVGAKPSEKFAKVRHAVPMLSLGNAFADEDVDEFVARVRRFLNLTAEEPVAF 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEV 187
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A    +  IP  LS  +IPE++EV
Sbjct: 127 TAEPKIDGLSLSLRYEAGRLVTAATRGDGEVGENVTANALTVEDIPATLSGKDIPEVLEV 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+S  DF  +N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ 
Sbjct: 187 RGEVYLSHEDFAGINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGEV 246

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE F   Q  +L++ R  G PVN   +   +   ++++Y  +++ R+ L YDIDG+VYKV
Sbjct: 247 SEPFTDTQSAVLERFRGWGLPVNPRTKLCRSAEEMIAHYRAIEAERAGLGYDIDGVVYKV 306

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+   Q++LG  +R+PRW ++HKFA ++A T LL IDI +GRTG L P+ARL+PV +GG 
Sbjct: 307 DDLGFQRRLGFVSRAPRWALAHKFAAQEAITELLAIDINVGRTGSLNPLARLKPVTVGGV 366

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNE Y++G+ A G+ +R GRDIRVGD V+V RAG+VIPKV+D+++++R  DA 
Sbjct: 367 VVSNATLHNEGYVQGVGADGEPIREGRDIRVGDTVIVVRAGDVIPKVMDVVLDKRPADAV 426

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C SR VR+LNP+T KL A  RCTGGL C AQ +ERLKHFVSR+ F++EG 
Sbjct: 427 PYVFPETCPACGSRAVRELNPRTKKLDAIRRCTGGLICPAQGVERLKHFVSRNGFDLEGF 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQQTSTTK-----------IE 525
           G+  ++  F+    A  ++ PAD+F L+          RR+  S  +            +
Sbjct: 487 GQTYIEVLFE----AGLVKQPADLFRLEFEPLKAAIVARREALSAQRRAEGEPAPKKPTK 542

Query: 526 NILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN 585
                 D ++ NL  S+  RR I+L RF+F+LGI  +G   A++LAK +         + 
Sbjct: 543 KKGEEEDKAIKNLLASLEARRKIALNRFLFALGIPQIGESTAKALAKRFPDMPALMAALE 602

Query: 586 NII-AHNNDDWLSLIRVPLVG 605
                    DWL L  +P +G
Sbjct: 603 AATREQAGRDWLELSALPRIG 623



 Score = 83.2 bits (204), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G +   ++++F+  P N  AV ALL+EV  +        ++    K +VFTGTL+K+ R
Sbjct: 698 IGPVATDSLIQFFSEPHNDAAVRALLEEVG-TEPLAATTSAAAFAGKTVVFTGTLEKMTR 756

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GVK+++E+ +L +L +
Sbjct: 757 SEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAERHGVKVVSEDDWLAMLAE 813


>gi|89069525|ref|ZP_01156869.1| DNA ligase, NAD-dependent [Oceanicola granulosus HTCC2516]
 gi|89044860|gb|EAR50950.1| DNA ligase, NAD-dependent [Oceanicola granulosus HTCC2516]
          Length = 739

 Score =  498 bits (1283), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 290/726 (39%), Positives = 422/726 (58%), Gaps = 66/726 (9%)

Query: 41  PIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEK 100
           PI+ D+ YDALKRR  A+   FP+L R++ P G   ++G        KVTH +  LSL  
Sbjct: 30  PIMDDAAYDALKRRNAALEARFPELMRADSPTG---QVGAAPAAGFGKVTHRVRMLSLLN 86

Query: 101 IWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSG 160
            +   D+R F   + R+     D  + +T EPKIDG  +++RYE G+ V AA RGDG +G
Sbjct: 87  AFEEADIRDFDDGVRRYLGLAADAPLRYTAEPKIDGLSLSLRYEDGRLVQAATRGDGTTG 146

Query: 161 EDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAA 220
           E+V+   R I  IP  L    P+++EVRGEVY+S  DF ALN        K +ANPRNAA
Sbjct: 147 ENVTDNARTIDDIPDRLE-GAPDVLEVRGEVYMSHADFAALNARQSEAAGKTFANPRNAA 205

Query: 221 SGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTF 278
           +G LR+L+P +ITR   L FF +  G+ S   A+ Q   ++++  LGF VN   R  +  
Sbjct: 206 AGSLRQLDP-EITRARPLRFFAYAWGELSAPLAETQMGAIERLGALGFQVNPLTRLCDGP 264

Query: 279 HGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTR 338
             ++++Y  +++ R+TL YDIDG+VYKVD+ +LQ +LG R+ +PRW  +HKF  + A TR
Sbjct: 265 DKMIAHYRAIEAQRATLGYDIDGVVYKVDDLALQSRLGFRSTTPRWATAHKFPAELAWTR 324

Query: 339 LLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVG 398
           L  I+IQ+GRTG L+PVARL PV +GG +++NATLHNEDYI G  ASG  +RGG+DIR G
Sbjct: 325 LERIEIQVGRTGALSPVARLTPVTVGGVVVSNATLHNEDYIAGRAASGDEIRGGKDIREG 384

Query: 399 DRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRC 458
           D V V RAG+VIPKV D+ + +R  DA P+ FP  CP C S  VR+         A  RC
Sbjct: 385 DWVQVYRAGDVIPKVADVDLAQRPADAAPYVFPETCPECGSEAVREEGD------AVRRC 438

Query: 459 TGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ 518
           TGGL C AQ +E+LKHFVSR AF+IEGLG +Q++ F+  E     I  PADIFTL+ R  
Sbjct: 439 TGGLVCPAQAVEKLKHFVSRAAFDIEGLGAKQVEQFYHDE----WITEPADIFTLRDRYG 494

Query: 519 TST-TKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSY 577
               T+++N  G+G+ S  NL+D+I +RR I+L R +F+LGIRHVG   A  LA+++ ++
Sbjct: 495 PGKLTQLKNREGWGEKSAENLFDAIEERRTIALARLVFALGIRHVGEVAASDLARHFSTW 554

Query: 578 QNFAQEINNI-----------------------------IAHNND--------------D 594
           +     ++                               +A   D               
Sbjct: 555 EALVATVDAAAPAAHRVQAAEAALLAERAAARDEGRRARLAEVRDRVWAEPPLPEGARAA 614

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLK--EVSPSIGRHEKNVSSEIENKKL 652
           W  ++ +  +G  +A+++V          +++ L     + P+    +    S +  K +
Sbjct: 615 WDEIVGIEGIGATVARSLVLTMAQEAERASIDRLAAGLTIEPA---EQVATDSPVAGKTI 671

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L+K+ R +A+     LGA VS  +S KTD+++ G   GSK +KA +LG++ ++E+
Sbjct: 672 VFTGSLEKMTRAEAKARAEALGAKVSGSVSAKTDLVVAGPGAGSKGKKAAELGIETIDED 731

Query: 713 QFLFLL 718
            +L L+
Sbjct: 732 AWLALI 737


>gi|118581474|ref|YP_902724.1| DNA ligase, NAD-dependent [Pelobacter propionicus DSM 2379]
 gi|166216225|sp|A1ATJ6|DNLJ_PELPD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|118504184|gb|ABL00667.1| DNA ligase, NAD-dependent [Pelobacter propionicus DSM 2379]
          Length = 704

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 277/715 (38%), Positives = 422/715 (59%), Gaps = 44/715 (6%)

Query: 21  LSSLEQEISYHDDCYYQYSKP--IILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           +  L Q I++++  YY+   P   I D EYD L +    +   FP+    +  + P   +
Sbjct: 18  IQELRQLIAHNNRLYYENIPPRREIHDYEYDELFKELQELESRFPEF---QSADSPTQIV 74

Query: 79  GGEMNLSLFKVTHSIPTLSLEK---IWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
           GG ++    KV HS+P LS+E       + ++R  I  +     K D  SI    EPKID
Sbjct: 75  GGSVSEGFKKVQHSVPMLSIENKPVTKMLSEVRSIIKEL-----KDDAISIDIVAEPKID 129

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G   +IRYEK + V AA RGDG  GED++  + +I  IP++L L+ PE+IE+RGEVY+S 
Sbjct: 130 GLSCSIRYEKHQLVRAATRGDGLEGEDITVNVHSISEIPKILPLDAPEVIEIRGEVYMSN 189

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQ 254
           +DF     +   +G KP  NPRNAA+G LR+L+P+   +R L FF +  G+ S  FAK Q
Sbjct: 190 SDFKQYTAQQNKIGEKPPENPRNAAAGSLRQLDPSVTASRPLRFFAYAWGEISNSFAKSQ 249

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           ++ LQ +R  GF V + +R   +   + SY+ EM+  RS L + IDG+VYK++  SLQ++
Sbjct: 250 WDALQTLRGWGFKVCDDIRLLYSSDELNSYFEEMQERRSELDFTIDGIVYKLNSLSLQER 309

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           +G+  R+PRW  + KF  ++  T L +I I +GR+G LTPVA L PV + G  ++NATLH
Sbjct: 310 VGQTNRAPRWAAAQKFPPEKRETLLQNITISVGRSGALTPVAELLPVRLLGTTVSNATLH 369

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N+D ++            +D R+ D ++V+RAG+VIP+VV +++ +R   + PF FPS C
Sbjct: 370 NQDEVEC-----------KDFRIDDTIVVQRAGDVIPQVVSVVIEKRLSGSIPFVFPSAC 418

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S+ VR+  P+     A  +CTGGL C AQ LERLKHFVSRDAFNI+GLG++ ++ F
Sbjct: 419 PVCGSKAVRE--PRE----AVWKCTGGLTCPAQSLERLKHFVSRDAFNIDGLGEKNIELF 472

Query: 495 FKSEDPAFSIRIPADIFTLQR--------RQQTSTTK-IENILGFGDVSVTNLYDSINKR 545
           +        +  P DIF L+         +Q+ S  K ++   G+G++S  NL+ +I  +
Sbjct: 473 YNKG----LLASPVDIFRLEEILSPPLLWQQKPSEFKPLQEWDGWGELSANNLFRAIRTK 528

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           + I+L RFI++LGI  VG   A+ LA  Y+S  N+   +       ++ +  LI +  +G
Sbjct: 529 QKITLYRFIYALGIPKVGEVTAKILADNYVSLDNWQSSMLKAAERESECYQHLISIDGIG 588

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++A  IV F+    NI  +++L   +S         +SS I  K +VFTG L+K  R  
Sbjct: 589 SVVADEIVSFFAEAHNIQVLDSLKNYLSVEDFTKPAIISSNISGKIVVFTGELEKRSRKA 648

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+    + GA V+  +SRKTDI+I G +PGSKL KAQ+LG+KI++E+++  L+ +
Sbjct: 649 AKIEAEKFGAKVATDVSRKTDIVIAGTDPGSKLRKAQELGIKILSEDEWEHLINE 703


>gi|218532981|ref|YP_002423797.1| DNA ligase, NAD-dependent [Methylobacterium chloromethanicum CM4]
 gi|254781363|sp|B7KU78|DNLJ_METC4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218525284|gb|ACK85869.1| DNA ligase, NAD-dependent [Methylobacterium chloromethanicum CM4]
          Length = 814

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 256/621 (41%), Positives = 375/621 (60%), Gaps = 31/621 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +EALS + A+   + L + I   +  YY    P + D+EYDAL++  +AI   FP L  +
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPALTGT 69

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            + +     +G + +    KV H++P LSL   +  ED+ +F+ R+ RF     + ++ F
Sbjct: 70  TEASA---GVGAKPSEKFAKVRHAVPMLSLGNAFADEDVDEFVARVRRFLNLPAEEAVAF 126

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEV 187
           T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A    +  IP  LS   IPE++EV
Sbjct: 127 TAEPKIDGLSLSLRYEAGRLVTAATRGDGEVGENVTANALTVDDIPETLSGEGIPEVLEV 186

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGE+Y+S  DF A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ 
Sbjct: 187 RGEIYLSHEDFAAINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGEV 246

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE F   Q  +L++ R  G PVN   +   +   ++++Y  +++ R+ L YDIDG+VYKV
Sbjct: 247 SEPFTDTQSAVLERFRGWGLPVNPRTKLCRSAEEMIAHYRAIEAERAGLGYDIDGVVYKV 306

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+   Q++LG  +R+PRW ++HKFA ++A T LL IDI +GRTG L P+ARL+PV +GG 
Sbjct: 307 DDLGFQRRLGFVSRAPRWALAHKFAAQEAITELLAIDINVGRTGSLNPLARLKPVTVGGV 366

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNE Y++G+ A G+ +R GRDIRVGD V+V RAG+VIPKV D+++ +R  DA 
Sbjct: 367 VVSNATLHNEGYVQGVGADGEPIREGRDIRVGDTVIVVRAGDVIPKVRDVVIEKRPADAV 426

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP C SR VR+LNP+T KL A  RCTGGL C AQ +ERLKHFVSR+  ++EG 
Sbjct: 427 PYVFPDTCPACGSRAVRELNPRTKKLDAIRRCTGGLICPAQGVERLKHFVSRNGLDLEGF 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQ----------RRQQTSTTK-----------IE 525
           G+  ++  F+    A  ++ PAD+F L+          RR+  S  +            +
Sbjct: 487 GQTYIEVLFE----AGLVKQPADLFRLEFEPLKAAIVARREALSAQRRTEGEPAPKKPTK 542

Query: 526 NILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN 585
                 D ++ NL  S++ RR I L RF+F+LGI  +G   A++LAK +         + 
Sbjct: 543 KKGEEEDKAIKNLLASLDARRTIPLNRFLFALGIPQIGESTAKALAKRFPDMPALMAALA 602

Query: 586 NII-AHNNDDWLSLIRVPLVG 605
                    DWL L  +P +G
Sbjct: 603 AATREQAGRDWLELSALPRIG 623



 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G +   ++++F+  P N  AV ALL+EV  +        ++    K +VFTG+L+K+ R
Sbjct: 698 IGPVATDSLIQFFSEPHNDAAVRALLEEVG-TEPLAATTSAAAFAGKTVVFTGSLEKMTR 756

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +A+    +LGA VS  +S KTD+++ G   GSKL+ A++ GVK+++E+ +L +L +
Sbjct: 757 SEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKHGVKVVSEDDWLAMLAE 813


>gi|315498681|ref|YP_004087485.1| DNA ligase, nad-dependent [Asticcacaulis excentricus CB 48]
 gi|315416693|gb|ADU13334.1| DNA ligase, NAD-dependent [Asticcacaulis excentricus CB 48]
          Length = 697

 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 290/708 (40%), Positives = 416/708 (58%), Gaps = 24/708 (3%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           + A+   + L  EI +H D YY    P + D+EYDAL++   A+   +PDL   + P   
Sbjct: 7   DTAQTRHAQLSTEIKHHRDLYYNQEAPELTDAEYDALEQELRALEAQYPDLHTVDSPT-- 64

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G E++     V H +P LSL+  +  ED+  F   I RF +   +  + F +EPKI
Sbjct: 65  -EQVGAEISSKFAPVQHGVPMLSLDNAFAPEDVADFEKSIRRFLRLPPEEELAFAVEPKI 123

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVRGEVYI 193
           DG   ++ Y  GK V AA RGDG +GED++  +R I  +P VLS  + PE IE+RGEVY 
Sbjct: 124 DGLSCSLLYVNGKLVRAATRGDGRTGEDITENVRTIKDVPHVLSGRDHPERIEIRGEVYY 183

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI-FA 251
              DF A+N +    G K +ANPRNAASG LR+L+ T   +R L FF +  G+ S+  F 
Sbjct: 184 PLADFAAMNAKSAEEGGKVFANPRNAASGALRQLDATITASRPLRFFAYTWGEVSDPRFV 243

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
             Q E L K    GF VN          G++  Y  ++  RS+L YDIDG+VYKVD    
Sbjct: 244 TTQTEALAKFHEWGFQVNPRSATTENSDGLLKIYEAIQRDRSSLGYDIDGVVYKVDRLDY 303

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q++LG  +RSPRW I+HKF  +QA T L  IDIQ+GR G LTPVARLEPVN+GG +++N 
Sbjct: 304 QRRLGFVSRSPRWAIAHKFPAEQALTHLKAIDIQVGRIGTLTPVARLEPVNVGGVVVSNV 363

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D I             +DIR+GD V V+RAG+VIP++V + ++ER    +P+ FP
Sbjct: 364 TLHNADEI-----------ARKDIRIGDLVRVQRAGDVIPQIVGVELSERQEGTEPYVFP 412

Query: 432 SFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           + CP   ++ V R+LN K G+   A RC+G  AC  Q++E LK+ VSR   +IEGLG++Q
Sbjct: 413 TVCPCPLKTAVARELNLK-GEEGVARRCSGEHACPHQRVEYLKYVVSRKVLDIEGLGEKQ 471

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           L  F  SE+    IR PADIFTL+ R +TS T + N  G G+ S  NL+ +I  RR + L
Sbjct: 472 LQKF--SEEGL--IREPADIFTLEARDKTSLTPLRNREGMGETSARNLFKAIEDRRQLPL 527

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           +RFI +LG++ VG   AR LA+ Y S   F   +  + A + +   +L  +  VG  +  
Sbjct: 528 DRFIAALGVKGVGETTARLLARAYHSESTFRDAMIALAAGDEEVKAALDNMDQVGPSLVA 587

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           A++EF+ N  N+      + ++S           S +  K +VFTGTL+K+ R +A+   
Sbjct: 588 ALIEFFSNDHNVGIYMRFVAQLSVQDAEAVAG-DSAVSGKTVVFTGTLEKMTRDEAKAQA 646

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +LGA V+  +S KT I++ G   GSKL+KA +LGV++M E+++L  +
Sbjct: 647 ERLGAKVAGSVSAKTHIVVAGPGAGSKLKKAAELGVQVMTEDEWLAFI 694


>gi|56696562|ref|YP_166919.1| DNA ligase, NAD-dependent [Ruegeria pomeroyi DSS-3]
 gi|81349987|sp|Q5LST6|DNLJ_SILPO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56678299|gb|AAV94965.1| DNA ligase, NAD-dependent [Ruegeria pomeroyi DSS-3]
          Length = 739

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 291/749 (38%), Positives = 431/749 (57%), Gaps = 61/749 (8%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           +A +EL+ L   ++  +  Y+    P I D++YDALK+R   I   FP L R   P+ P 
Sbjct: 5   EAAQELARLAGLLAQANLAYHTLDAPEISDADYDALKQRNAEIEARFPHLKR---PDSPS 61

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++G        KV+H++  +SL   ++  D+  F   I ++     + ++ +T EPKID
Sbjct: 62  EQVGARPGEGFSKVSHAVRMMSLGNAFDDADVADFDRSIRKYLGLDVETALAYTAEPKID 121

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G  +++RYE+G  V AA RGDG  GE+V+A  R I  IP  +    PE++EVRGEVY+S 
Sbjct: 122 GLSLSLRYEQGVLVQAATRGDGEVGENVTANARTIADIPARIE-GAPEVLEVRGEVYMSH 180

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKG 253
            DF ALN    A G K +ANPRNAA+G LR+L+   ITR   L FF +  G+ SE  A+ 
Sbjct: 181 ADFAALNTRQEAEGGKLFANPRNAAAGSLRQLDAA-ITRARPLRFFAYSWGELSEPLAET 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
           Q + ++++  LGF  N   R+      ++++Y ++++ R+TL YDIDG+VYK+D+  LQ 
Sbjct: 240 QMQAIERLAGLGFQTNPLTRRCADLDAMIAHYRDIEAQRATLGYDIDGVVYKLDDLGLQA 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG +++NATL
Sbjct: 300 RLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGGVVVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HNEDYI G D+ G+ +R G+DIRVGD V V RAG+VIPK+ D+ +N+R   A PF FP  
Sbjct: 360 HNEDYIAGRDSRGQEIRDGKDIRVGDWVQVYRAGDVIPKIADVDLNKRPEGANPFEFPEQ 419

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C S  +R+         A  RCTGG+ C AQ +E+LKHFVSR AF+IEGLG +Q++ 
Sbjct: 420 CPECGSPAIREEGD------AVRRCTGGVICPAQAVEKLKHFVSRAAFDIEGLGAKQVEQ 473

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
           F         IR PADIF L+ R      +++N  G+G+ S TNL+ +I+ +R I L R 
Sbjct: 474 FHAD----GWIREPADIFELRSRYGEGLQQLKNREGWGEKSATNLFQAIDDKRRIPLARL 529

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINN--------------------------- 586
           IF+LGIRHVG   A+ L+ +Y  +   A  ++                            
Sbjct: 530 IFALGIRHVGEVGAKDLSLHYRDWDAMAAALDTARLAALAHRAADTAEEQERQQAQAEGR 589

Query: 587 ----------IIAHNN------DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLK 630
                     +IA           W  LI V  +G  +  ++ + + N     A + L  
Sbjct: 590 RARISDTRAAVIAAQEVPPEAAAAWADLIGVDGIGATLGLSLSDAFANGDERAAFDRLSA 649

Query: 631 EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIV 690
            ++  I        S +  K +VFTG+L+K+ R +A+     LGA V+  +S+KTD+++ 
Sbjct: 650 HLT-VIPPDAPARDSPVAGKTVVFTGSLEKMTRAEAKARAEALGAKVAGSVSKKTDLLVA 708

Query: 691 GDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           G   GSKL+ A+ LG++ ++E+ +L L++
Sbjct: 709 GPGAGSKLKTAESLGIETLDEDGWLKLIE 737


>gi|85708859|ref|ZP_01039925.1| DNA ligase [Erythrobacter sp. NAP1]
 gi|85690393|gb|EAQ30396.1| DNA ligase [Erythrobacter sp. NAP1]
          Length = 698

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 274/707 (38%), Positives = 407/707 (57%), Gaps = 35/707 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+  +S   A  EL  L ++I++HD  Y+    P I D EYDAL RR   +  AFP L R
Sbjct: 13  PVSQMSEADAANELMRLAKQIAHHDRLYHADDDPEISDQEYDALVRRNRELEEAFPQLVR 72

Query: 68  SEDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
            + P+    ++G  +  S L KVTH +  +SL+  +N E++  +  RI R+     D  +
Sbjct: 73  EDSPS---KRVGHAVAASPLSKVTHEVRMMSLDNAFNREEVEDWTARIRRYLNLDADEEV 129

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T E KIDG   ++RYE GK + AA RGDG  GEDV+  +  I  IP+ L   +PE+ E
Sbjct: 130 AITAEDKIDGLSCSLRYENGKLMRAATRGDGQVGEDVTPNVGYISDIPQELPDGVPEVFE 189

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S+ DF ALN      G K +ANPRNAA+G LR+ + +    R L F+ +G G 
Sbjct: 190 VRGEVYMSRADFAALNTAQEEAGGKLFANPRNAAAGSLRQKDASVTAKRPLKFWAYGWGA 249

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++  + Q +M++ +   GFP++  + +  +   ++++Y E+   R  L Y+IDG+VYK
Sbjct: 250 ASDVPCESQNDMMRMIESWGFPLSPFLTRTMSVDEMIAHYEEIGRQRPDLGYEIDGVVYK 309

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q++LG  A++PRW ++HKF  ++A T L  IDIQ+GRTG LTPV RL PV +GG
Sbjct: 310 VDRLDWQQRLGFVAKAPRWALAHKFPAEKAQTTLEAIDIQVGRTGKLTPVGRLAPVLVGG 369

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             +TN TLHN D I+ L            +R GDR++++RAG+VIP+VV+ +   R  + 
Sbjct: 370 VTVTNVTLHNRDEIERL-----------GVRPGDRIVIQRAGDVIPQVVENLT--RDEER 416

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +PF FP  CP C S  V     + G++    RCTGGL C AQ+ +RL+HFVSR A +I+G
Sbjct: 417 EPFVFPDHCPECDSEAV----AEEGEVDV--RCTGGLICPAQRTQRLEHFVSRKALDIDG 470

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
            G + +  FF        +  PADIF L+ R++     I  + G+ D SV NL  S+  R
Sbjct: 471 FGSKTIAQFFA----LGWLESPADIFRLKDRRE----DILALEGWQDKSVDNLLASVENR 522

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R     R +F LGIRHVG   AR L K+               A + D    L  +  +G
Sbjct: 523 REPDAARLLFGLGIRHVGEVTARDLLKHVHELPALRTIAEKARAGDEDAASELTAIDGIG 582

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE-KNVSSEIENKKLVFTGTLQKIQRH 664
             + +A+ +F+  P N+   E +L EV+P   R+E + + S +  K +VFTG L+ + R 
Sbjct: 583 PSVVEALGDFFHEPHNVAVWEDILSEVTPP--RYEVETLDSPVAGKTVVFTGKLETMSRD 640

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +A+    +LGA  +  +S KTD+++ G   GSKL+KA+QLG+++++E
Sbjct: 641 EAKAQAERLGAKAAGSVSAKTDLLVAGPGAGSKLKKAEQLGIEVVDE 687


>gi|296116447|ref|ZP_06835061.1| putative DNA ligase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977040|gb|EFG83804.1| putative DNA ligase [Gluconacetobacter hansenii ATCC 23769]
          Length = 709

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 280/704 (39%), Positives = 414/704 (58%), Gaps = 35/704 (4%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S  QA  EL+ L   I+  D  Y+Q   PI+ D+ YDAL+RR   +  A P   R + P
Sbjct: 24  MSASQAASELALLADVIAQLDRAYHQDDAPIVTDAVYDALRRRNSELEQAHPRERRDDSP 83

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS--IFFT 129
           +    ++G   + +  +  H  P LSL+ +++ E+   FI+R  RF    D  +  + F 
Sbjct: 84  D---TRVGAAPSGAFRRHRHLTPMLSLDNVFSREEFEGFISRAARFLGLDDAQATQLDFV 140

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  I++ YE   FV    RGDG  GEDV+A +R +  +P+ L    P++IE+RG
Sbjct: 141 AEPKIDGLSISLTYENRHFVRGTTRGDGTEGEDVTANLRTLRNMPQQLHGPAPDLIEIRG 200

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTS 247
           EV+++K+DFL LN   +A G+KP+ANPRNAA+G LR+L+  +ITR   L+ F + +G  S
Sbjct: 201 EVFLAKSDFLTLNAAQVAAGQKPFANPRNAAAGSLRQLD-AEITRQRPLSLFAYAVGYCS 259

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
              A      L+++   GF V+    +        ++   +   RS L YDIDG+VYK++
Sbjct: 260 APVADTHDLYLRQLGEWGFAVSPLCTRVANEAEAEAFMERIARERSALDYDIDGVVYKIN 319

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           E +LQ++LG   R+PRW ++ KFA +QA TRL  IDIQ+GRTG LTPVA LEPVN+GG +
Sbjct: 320 ERALQERLGFAGRAPRWAVAWKFAAEQAITRLTKIDIQVGRTGALTPVAILEPVNVGGVI 379

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +T A+LHNED         +++R  +D++ GD V ++RAG+VIP+V+D+++   H    P
Sbjct: 380 VTRASLHNED---------EIVR--KDVQEGDLVRIQRAGDVIPQVLDVVLPRDH-SPHP 427

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C +   R      G++V   RC+GGL C AQ +ERL HFVSRDAF+IEGLG
Sbjct: 428 FVFPHVCPVCHAHAER----PEGEVV--WRCSGGLTCPAQLVERLIHFVSRDAFDIEGLG 481

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + +  F         +  PADIF L   ++    +     G+G +S  NL ++I  RR 
Sbjct: 482 DRTIAEFHADG----LLGTPADIFHLPTHEEAIAVRP----GWGTLSARNLMNAIAARRT 533

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           ISL RFI++LGIR +G   AR LA++Y SY N+ Q++       +D+ L L  +  +G  
Sbjct: 534 ISLSRFIYALGIRRIGINTARLLARHYGSYDNWHQQMLRATTVGSDERLELGSITGIGTA 593

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           IA  +V F+    N   +E  L  V  +I   E   + E+  K +VFTGTL  + R +A+
Sbjct: 594 IADELVAFFIEAHNRQTLED-LTHVLEAITDEEMLAAGELSGKVIVFTGTLTTMSRPEAR 652

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
               ++GA VS  +SRKTDI+++G+  GSK  KA +L +  ++E
Sbjct: 653 AIAERMGARVSDSVSRKTDIVVLGEKAGSKARKAAELNLHTVDE 696


>gi|149184723|ref|ZP_01863041.1| DNA ligase [Erythrobacter sp. SD-21]
 gi|148832043|gb|EDL50476.1| DNA ligase [Erythrobacter sp. SD-21]
          Length = 690

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 276/707 (39%), Positives = 405/707 (57%), Gaps = 33/707 (4%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           +A  EL  L + I+ H+  Y+    P I D E+DAL RR   +   FP L R + P+   
Sbjct: 13  EAANELMRLARAIAKHNKLYHAEDAPEITDQEFDALVRRNAELEEQFPHLVREDSPS--- 69

Query: 76  NKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             +G E+  S L KVTH +  +SL+  ++ E++ +++ R+ RF    +   +  T E KI
Sbjct: 70  KVVGHEIAASPLSKVTHEVRMMSLDNAFSGEEVAEWVARVRRFLSLDESEEVAITAEDKI 129

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG   ++RYEKG+ V AA RGDG  GEDV+  I  I  IP+ LS ++PE+ E+RGEVY++
Sbjct: 130 DGLSCSLRYEKGRLVRAATRGDGQVGEDVTPNIAHIADIPQQLSGDVPEVFEIRGEVYMA 189

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
           K DF ALN      G K +ANPRNAA+G LR+ + +    R L F+ HG G  S +    
Sbjct: 190 KADFSALNAAQEDAGGKLFANPRNAAAGSLRQKDASVTAKRPLRFWAHGWGAASAVPGAT 249

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
           Q E+++++   G PV+    + +    ++++Y ++   R  LPY+IDG+VYKVD    Q+
Sbjct: 250 QEEVVRQIENWGVPVSPLFTRVHDVEAMLAHYAKIAKERPDLPYEIDGVVYKVDRLDYQQ 309

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  A++PRW ++HKF  +QA T L  IDIQ+GRTG LTPV RL PV +GG  +TN TL
Sbjct: 310 RLGFVAKAPRWALAHKFPAEQAETTLEAIDIQVGRTGKLTPVGRLAPVLVGGVTVTNVTL 369

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I  L            +R GDRV+V+RAG+VIP++VD +   R    +PF+FP  
Sbjct: 370 HNRDEIARL-----------GVRPGDRVVVQRAGDVIPQLVDNLT--RETSREPFAFPDH 416

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C S  V +     G++    RCTGGL C AQ+ ERLKHFVSR A +I+GLG++ +D 
Sbjct: 417 CPECGSEAVAE----EGEVDV--RCTGGLICPAQRTERLKHFVSRGALDIDGLGEKTIDQ 470

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
           FF        +  PADIF L +R+      I  + G+ + SV  L DSI  RR     R 
Sbjct: 471 FFA----LGWLESPADIFHLHQRRDA----ILALEGWQERSVDKLVDSIEARRAPDAARL 522

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +F LGIRHVGA  AR L K++       +      A + +   SL  +  +G  + +A+ 
Sbjct: 523 LFGLGIRHVGAVTARDLMKHFHELPALREAAEAAHAGDEEAAASLTSIDGIGGAVVEALG 582

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           +F+    N    + ++ EV+P     E    S +  K +VFTG L+ + R +A+    +L
Sbjct: 583 DFFHEDHNKAVWDDIISEVTPPPYIVETK-ESPVSGKTVVFTGKLETMSRDEAKAQAERL 641

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           GA  S  +S KTD+++ G   GSKL+KA  LG+K+++E  +  ++ +
Sbjct: 642 GAKASGSVSAKTDLLVAGPGAGSKLKKAADLGIKVIDEAGWAKIVAE 688


>gi|34581289|ref|ZP_00142769.1| DNA ligase [Rickettsia sibirica 246]
 gi|28262674|gb|EAA26178.1| DNA ligase [Rickettsia sibirica 246]
          Length = 689

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 276/712 (38%), Positives = 424/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S E+A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQVPMLSLSNAFDEQDVRDFVDRIKIFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGLSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDSSITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D + 
Sbjct: 358 VSRATLHNFQEI-----------ARKDLRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTET 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S++     P+   +    RC  GL C AQ  ER++HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSKL--HYTPEDIII----RCDNGLNCPAQNYERIRHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I  P DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++  L E+       E    S + +K +VFTG+L  + R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKK-LGEILNIEDYKETREQSSLMDKIVVFTGSLPTMSRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+  +S  TD+++VG + GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVAVGVSSNTDLVVVGVDAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|170746461|ref|YP_001752721.1| DNA ligase, NAD-dependent [Methylobacterium radiotolerans JCM 2831]
 gi|254781368|sp|B1M575|DNLJ_METRJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|170652983|gb|ACB22038.1| DNA ligase, NAD-dependent [Methylobacterium radiotolerans JCM 2831]
          Length = 810

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 258/620 (41%), Positives = 369/620 (59%), Gaps = 33/620 (5%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+ E+AR E + L   I   D  YYQ   P I D+EYD L+RR + I   FPDLA +   
Sbjct: 13  LTAEEARAEYARLSDAILEADRLYYQEDAPEISDAEYDRLRRRLEDIEARFPDLAGT--- 69

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
                 +G + +    KV H++P LSL   ++  ++ +F+ R+ RF    DD  + FT E
Sbjct: 70  GAASTSVGAKPSEKFAKVRHAVPMLSLGNAFDDAEVAEFVARVRRFLGWSDDTPLAFTAE 129

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVRGE 190
           PKIDG  +++RY  G+   AA RGDG  GE+V+A  R +  IP VL+    PEI EVRGE
Sbjct: 130 PKIDGLSLSLRYVNGRLDTAATRGDGEVGENVTANARTVQDIPAVLAGAGWPEICEVRGE 189

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
           VY+S  DF A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  G+ S  
Sbjct: 190 VYLSHADFAAINARQEAAGKPLFANPRNAAAGSLRQLDPAITASRPLRFFAYAWGELSAP 249

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A+ Q  +L++    G PVN           ++++Y  +++ R+ L YDIDG+VYKVD+ 
Sbjct: 250 IAETQTGVLEQFATWGLPVNPRTETFTDTAAMLAHYRRIEADRAGLGYDIDGVVYKVDDL 309

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQK+LG  +RSPRW ++HKFA ++A+T + DI I +GRTG L P+A+L PV +GG +++
Sbjct: 310 ALQKRLGFVSRSPRWALAHKFAAQEATTVVEDIVINVGRTGSLNPLAKLRPVTVGGVVVS 369

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNE Y+KG+ A G+ +R GRDIRVGD V V RAG+VIPKV+D+ + +R  D++P++
Sbjct: 370 NATLHNEGYVKGVGADGEPIRDGRDIRVGDTVTVVRAGDVIPKVMDVDLTKRPADSRPYA 429

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP C SR VR +NP+TG+  A  RCTGGL C AQ +ER+KHFVSR+ F+IEG G+ 
Sbjct: 430 FPESCPACGSRAVRAINPRTGRPDAVRRCTGGLICPAQGVERMKHFVSRNGFDIEGFGET 489

Query: 490 QLDFFFKSEDPAFSIRIPADIFTL------------------QRRQQTSTTKIENILGFG 531
            ++  F+    A  +R PAD+F L                  +RR ++ T +        
Sbjct: 490 YIEVLFE----AGLVRQPADLFRLDFEELKAAIVARREALSAERRAESGTAEPPKKAAKK 545

Query: 532 -----DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-AQEIN 585
                D ++ NL  ++  RR + + R +F+LGI  +G   A++LAK +       A    
Sbjct: 546 KGDEDDKAIKNLLAAVEARRAVPMNRLLFALGIPQIGEATAKALAKRFADMPTLIAAIRE 605

Query: 586 NIIAHNNDDWLSLIRVPLVG 605
              A    DW+ L  VP VG
Sbjct: 606 AAAAQPGPDWVELTAVPRVG 625



 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G +   A++ F+  P N  AV ALL  V+          +S    K +VFTG L+K+ R
Sbjct: 694 IGPVATDALLLFFSEPHNADAVTALLDAVAVQP-MERAAAASTFAGKTVVFTGALEKMTR 752

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           ++A+    +LGA VS  +S KTD+++ G   GSKL+ AQ+ GV++++E+ +L ++ Q
Sbjct: 753 NEAKAVAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAQKHGVRVVSEDDWLAMVAQ 809


>gi|67458584|ref|YP_246208.1| NAD-dependent DNA ligase LigA [Rickettsia felis URRWXCal2]
 gi|67004117|gb|AAY61043.1| DNA ligase, NAD-dependent [Rickettsia felis URRWXCal2]
          Length = 706

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 275/694 (39%), Positives = 412/694 (59%), Gaps = 29/694 (4%)

Query: 27  EISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSL 86
           +I+ ++  YY    P++ DSEYD L      +   FP L      N P  KIG ++    
Sbjct: 39  KIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLVLE---NSPSKKIGAKITNKF 95

Query: 87  FKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKG 146
            K+TH IP LSL   ++ +D+R F+ RI  F +  +   IF   EPKIDG   +  Y+ G
Sbjct: 96  AKITHQIPMLSLSNAFDEQDVRDFVDRIKNFLRLDEFAPIF--CEPKIDGLSFSAIYKNG 153

Query: 147 KFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMI 206
                A RGDG+ GED++A I+ I   P  +  N PE +EVRGE+YI K DFL LN E  
Sbjct: 154 LLTTGATRGDGYVGEDITANIKTIKNFPHKID-NAPEFLEVRGEIYIEKQDFLNLNKEQE 212

Query: 207 AVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLG 265
             GR  +ANPRNAA+G LR+L+ +    R L +FV+  G T +  A  Q ++L K++  G
Sbjct: 213 EQGRDKFANPRNAAAGSLRQLDASITAQRSLKYFVYSGGVTEQNLASSQEQLLIKLKEFG 272

Query: 266 FPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWM 325
           F VN   +  N+   I ++Y  +K+ R  LPY+IDG+VYK+++F+LQ ++G  ARSPR+ 
Sbjct: 273 FSVNEISKLTNSEEEIFTFYEYLKTNRENLPYEIDGVVYKLNDFALQNRMGFIARSPRFA 332

Query: 326 ISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDAS 385
            +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  ++ ATLHN          
Sbjct: 333 TAHKFPAIIGRTKLLSITVQVGRTGTLTPVAELEPIEIGGVTVSRATLHN---------F 383

Query: 386 GKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDL 445
            ++MR  +D+R+ D V ++RAG+VIPK+  + + +R  D   F  P FCP C S+    L
Sbjct: 384 QEIMR--KDVRIDDYVFLQRAGDVIPKITGVDIGKRPNDTIAFDTPLFCPSCNSK----L 437

Query: 446 NPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIR 505
           +     ++   RC  GL C AQ  ER++HFVS++A +IEGLG++Q++F     D    I 
Sbjct: 438 HYAPEDIII--RCDNGLNCPAQNYERIRHFVSKNAMDIEGLGRKQVEFLI---DKGL-IS 491

Query: 506 IPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE 565
            P DIF L+ +  +S TK+EN+ G+G  SV NL+ +I + +N+SL RFI++LGIRH+G +
Sbjct: 492 NPLDIFFLKEKNDSSLTKLENMDGWGKKSVENLFKNIEQSKNVSLPRFIYALGIRHIGEQ 551

Query: 566 IARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAV 625
            A+ LA+ + SY NF  ++  +  ++ D +  L  +  +GD I   I++F+    N   +
Sbjct: 552 NAKLLAREFGSYANFIAQMELLSKNDLDIYQKLNDLEGIGDKILVDIIDFFDVKENTTLI 611

Query: 626 EALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKT 685
           +  L EV       E    S +  K +VFTG+L  I R +A+    +LGA V+A +S  T
Sbjct: 612 KK-LGEVLNIEDYKETREQSSLTGKIIVFTGSLPTISRAEAKATAEKLGAKVAASVSSNT 670

Query: 686 DIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           D+++ G + GSKL+KA++L +KI+ EE++L L++
Sbjct: 671 DLVVAGVDAGSKLKKAKELNIKIIGEEEWLTLIK 704


>gi|134034096|sp|Q4UN15|DNLJ_RICFE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 689

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 275/694 (39%), Positives = 412/694 (59%), Gaps = 29/694 (4%)

Query: 27  EISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSL 86
           +I+ ++  YY    P++ DSEYD L      +   FP L      N P  KIG ++    
Sbjct: 22  KIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLVLE---NSPSKKIGAKITNKF 78

Query: 87  FKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKG 146
            K+TH IP LSL   ++ +D+R F+ RI  F +  +   IF   EPKIDG   +  Y+ G
Sbjct: 79  AKITHQIPMLSLSNAFDEQDVRDFVDRIKNFLRLDEFAPIF--CEPKIDGLSFSAIYKNG 136

Query: 147 KFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMI 206
                A RGDG+ GED++A I+ I   P  +  N PE +EVRGE+YI K DFL LN E  
Sbjct: 137 LLTTGATRGDGYVGEDITANIKTIKNFPHKID-NAPEFLEVRGEIYIEKQDFLNLNKEQE 195

Query: 207 AVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLG 265
             GR  +ANPRNAA+G LR+L+ +    R L +FV+  G T +  A  Q ++L K++  G
Sbjct: 196 EQGRDKFANPRNAAAGSLRQLDASITAQRSLKYFVYSGGVTEQNLASSQEQLLIKLKEFG 255

Query: 266 FPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWM 325
           F VN   +  N+   I ++Y  +K+ R  LPY+IDG+VYK+++F+LQ ++G  ARSPR+ 
Sbjct: 256 FSVNEISKLTNSEEEIFTFYEYLKTNRENLPYEIDGVVYKLNDFALQNRMGFIARSPRFA 315

Query: 326 ISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDAS 385
            +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  ++ ATLHN          
Sbjct: 316 TAHKFPAIIGRTKLLSITVQVGRTGTLTPVAELEPIEIGGVTVSRATLHN---------F 366

Query: 386 GKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDL 445
            ++MR  +D+R+ D V ++RAG+VIPK+  + + +R  D   F  P FCP C S+    L
Sbjct: 367 QEIMR--KDVRIDDYVFLQRAGDVIPKITGVDIGKRPNDTIAFDTPLFCPSCNSK----L 420

Query: 446 NPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIR 505
           +     ++   RC  GL C AQ  ER++HFVS++A +IEGLG++Q++F     D    I 
Sbjct: 421 HYAPEDIII--RCDNGLNCPAQNYERIRHFVSKNAMDIEGLGRKQVEFLI---DKGL-IS 474

Query: 506 IPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE 565
            P DIF L+ +  +S TK+EN+ G+G  SV NL+ +I + +N+SL RFI++LGIRH+G +
Sbjct: 475 NPLDIFFLKEKNDSSLTKLENMDGWGKKSVENLFKNIEQSKNVSLPRFIYALGIRHIGEQ 534

Query: 566 IARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAV 625
            A+ LA+ + SY NF  ++  +  ++ D +  L  +  +GD I   I++F+    N   +
Sbjct: 535 NAKLLAREFGSYANFIAQMELLSKNDLDIYQKLNDLEGIGDKILVDIIDFFDVKENTTLI 594

Query: 626 EALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKT 685
           +  L EV       E    S +  K +VFTG+L  I R +A+    +LGA V+A +S  T
Sbjct: 595 KK-LGEVLNIEDYKETREQSSLTGKIIVFTGSLPTISRAEAKATAEKLGAKVAASVSSNT 653

Query: 686 DIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           D+++ G + GSKL+KA++L +KI+ EE++L L++
Sbjct: 654 DLVVAGVDAGSKLKKAKELNIKIIGEEEWLTLIK 687


>gi|157828943|ref|YP_001495185.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933668|ref|YP_001650457.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. Iowa]
 gi|166216235|sp|A8GTF2|DNLJ_RICRS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359278|sp|B0BUZ1|DNLJ_RICRO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157801424|gb|ABV76677.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908755|gb|ABY73051.1| NAD-dependent DNA ligase [Rickettsia rickettsii str. Iowa]
          Length = 689

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 275/712 (38%), Positives = 423/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S E+A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQVPMLSLSNAFDEQDVRDFVDRIKIFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGVSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDSSITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  AR+PR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARNPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D + 
Sbjct: 358 VSRATLHNFQEI-----------ARKDLRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTET 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S++     P+   +    RC  GL C AQ  ER++HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSKL--HYTPEDIII----RCDNGLNCPAQNYERIRHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I  P DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++  L E+       E    S + +K +VFTG+L  I R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKK-LGEILNIEDYKETREQSSLTDKIVVFTGSLPTISRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+  +S  TD+++ G + GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVAVGVSSNTDLVVAGVDAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|94497003|ref|ZP_01303577.1| DNA ligase, NAD-dependent [Sphingomonas sp. SKA58]
 gi|94423679|gb|EAT08706.1| DNA ligase, NAD-dependent [Sphingomonas sp. SKA58]
          Length = 703

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 285/720 (39%), Positives = 423/720 (58%), Gaps = 48/720 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L+  +A   L  L +E++ H+  Y+    P I D++YDAL R  +A+  AFP L R++ P
Sbjct: 7   LTEAEAANRLMRLAKEVAKHNRLYHDQDAPEISDADYDALIRENNALEAAFPHLIRADSP 66

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           N    ++G     +L KV H++  +SL+  ++ ED+  F+ RI RF    DD  +  T E
Sbjct: 67  NA---QVGAASTTALKKVPHAVRMMSLDNGFSDEDIADFLARIRRFLALPDDAPVALTAE 123

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGE 190
           PKIDG   ++RYEKG+ V AA RGDG +GEDV+A +  I  IP R+    IP++ E+RGE
Sbjct: 124 PKIDGLSCSLRYEKGELVLAATRGDGTTGEDVTANVHTIADIPQRLTGEAIPDLFEIRGE 183

Query: 191 VYISKNDFLALNDEMIAVGRKP-----YANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           VY++K DF+ALN  ++A    P     +ANPRNAA+G LR+ + T   +R L F  HG G
Sbjct: 184 VYMAKGDFVALNARLLAEAENPEKARQFANPRNAAAGSLRQKDATVTASRPLRFLAHGWG 243

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             S + A  Q  ++Q +   G PV++ +   ++   ++++Y  +++ R+ LP+DIDG+VY
Sbjct: 244 AHSALPADTQLGVMQAIAGWGLPVSDMLACVDSLDALIAHYRTIEAGRADLPFDIDGVVY 303

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  A++PRW I+HKF  ++A T L  IDIQ+GRTG LTPV RL PV +G
Sbjct: 304 KVDRLDWQQRLGFVAKAPRWAIAHKFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPVTVG 363

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++N TLHN D I  L            +R GDR++V+RAG+VIP+VVD +   R   
Sbjct: 364 GVVVSNVTLHNADEIARL-----------GVRPGDRIIVQRAGDVIPQVVDNLT--RDEA 410

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +PF FP+ CP+C S  VR+     G++    RCTGGL C AQ+ ERL+HFVSR A +IE
Sbjct: 411 REPFPFPTHCPVCGSEAVRE----EGEVDV--RCTGGLICPAQRFERLRHFVSRAALDIE 464

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++ +  F    D  + I  PADIF L++ +      +    G+ + SV NL  +I  
Sbjct: 465 GLGEKTIQEFL---DLGW-IAEPADIFRLKKHR----ADLLGREGWKEKSVDNLLMAIEA 516

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSY---QNFAQEINNIIAHNNDDWLSL--- 598
           +R     R +F LGIRHVGA  AR L K Y +    +  AQ+I  +    +D    +   
Sbjct: 517 KRQPDAARLLFGLGIRHVGAVTARDLLKRYATLPAIRALAQDIMALRDQPHDSQAKMDKA 576

Query: 599 ----IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVF 654
               I V  VG  +  A+  F+  P N+ A + LL EVSP     E  VS+ +  K +VF
Sbjct: 577 IAEHIGVDNVGVAVGHALAHFFHEPHNVEAWDDLLSEVSPPPYVVETTVSA-VTGKTVVF 635

Query: 655 TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TG L+ + R +A+    ++GA  +  +S KTD+++ G   GSKL++A  LG++++ E+ +
Sbjct: 636 TGKLETMSRDEAKAQAERMGAKAAGSVSAKTDLVVAGPGAGSKLKQATVLGIEVITEQAW 695


>gi|51473890|ref|YP_067647.1| NAD-dependent DNA ligase LigA [Rickettsia typhi str. Wilmington]
 gi|81389976|sp|Q68W27|DNLJ_RICTY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|51460202|gb|AAU04165.1| DNA joinase [Rickettsia typhi str. Wilmington]
          Length = 693

 Score =  488 bits (1257), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 274/717 (38%), Positives = 427/717 (59%), Gaps = 39/717 (5%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S ++A+K L  L  +I+ ++  YY    P++ DSEYD L      + + FP L  S
Sbjct: 4   IDLISEKEAKKLLEELADKIAMYNHAYYIEDNPLVSDSEYDQLFNLNLKLENTFPHLVLS 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  KIG ++     KV H  P LSL   ++ ED+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKIGAKITNKFAKVIHQAPMLSLSNAFDEEDIRDFLERIKNFLRINEFTPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G F+  A RGDG+ GED++  I+ I   P  +  N PE +EVR
Sbjct: 120 -CEPKIDGLSFSAIYKHGLFITGATRGDGYVGEDITINIKTIKNFPHKID-NAPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GE+YI K DF+ LN E  A  R  +ANPRNAA+G +R+L+      R L +F++  G T 
Sbjct: 178 GEIYIEKQDFVNLNKEQEAQNRGKFANPRNAAAGSIRQLDVAITAQRPLKYFIYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++ L F VN   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 KNLASTQEQLLAKLKALSFSVNEISKLASSEEEIFAFYEYLKTNRHNLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
            F++Q ++G  ARSPR+ I+HKF      T+LL I +Q+GRTG+LTPVA L+P+ IGG +
Sbjct: 298 NFAMQNRMGFIARSPRFAIAHKFPAIIGQTKLLSITVQVGRTGMLTPVAELDPLEIGGVV 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIP++  + +++R  D   
Sbjct: 358 VSRATLHNFQDI-----------ARKDVRIKDYVFLQRAGDVIPQITGVDISKRSNDTVK 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F  P FCP C S+   V  D+           RC  GL C AQ  ER+ HFVS++A +I 
Sbjct: 407 FDTPVFCPSCNSKLRYVSEDI---------IIRCDNGLNCPAQNYERICHFVSKNAMDIA 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q+ F          I  P DIF L+++ +T+  ++EN+ G+G  SV NL+ +I K
Sbjct: 458 GLGRKQVAFLIDKR----LISNPLDIFFLKKKNETNLIRLENMDGWGKKSVANLWQNIEK 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            + ISL+RFI++LGIRH+G + A+ LA+ ++SY NF  ++  +  +++D +  L  +  +
Sbjct: 514 SQKISLQRFIYALGIRHIGEQNAKLLAREFVSYNNFIAQMELLSKNDSDVYQKLNDLEGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEAL--LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           GD +   I++F+    NI  ++ L  +  +       E+N+   +  K LVFTG+L+ I 
Sbjct: 574 GDKMLVDIIDFFYVKENIQLIKKLGAVLNIEDYKETREQNI---LTGKILVFTGSLKTIS 630

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           R +A+E   +LGA V++ +S  TD++IVG N GSKL+KA++L +KI++E ++L  ++
Sbjct: 631 RVEAKEIAEKLGAKVASSVSSNTDLLIVGVNGGSKLKKAKELNIKIIDEAEWLAFIK 687


>gi|307293327|ref|ZP_07573173.1| DNA ligase, NAD-dependent [Sphingobium chlorophenolicum L-1]
 gi|306881393|gb|EFN12609.1| DNA ligase, NAD-dependent [Sphingobium chlorophenolicum L-1]
          Length = 711

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 287/724 (39%), Positives = 421/724 (58%), Gaps = 56/724 (7%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           +A   L  L +EI+ H+  Y+   +P I D+ YDAL R  +A+  AFP L RS+ PN   
Sbjct: 11  EAANRLMRLAREIARHNRLYHDQDQPEITDAAYDALIRENNALEAAFPHLIRSDSPNA-- 68

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++G     +L KV H++  +SL+  +  ED+ +FI R+ RF    +D  +  T EPKID
Sbjct: 69  -QVGAAPTSALKKVQHAVRMMSLDNGFADEDIAEFIARVRRFLALPEDAPVALTAEPKID 127

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYIS 194
           G   ++RYEKG+ V AA RGDG +GEDV+A +R I  IP R+    +P++ EVRGEVY++
Sbjct: 128 GLSCSLRYEKGELVLAATRGDGTTGEDVTANVRTIADIPQRLTGQAVPDLFEVRGEVYMA 187

Query: 195 KNDFLALNDEMIAVGRKP-----YANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           K DF+ALN+ ++A    P     +ANPRNAA+G LR+ +     +R L F  HG G+ S 
Sbjct: 188 KADFVALNERLLAEAEDPEKARQFANPRNAAAGSLRQKDAAVTASRPLRFLAHGWGEVSA 247

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A+ Q  ++Q +   G PV++ +   +T   ++++Y  +++ R+ LP+DIDG+VYKVD 
Sbjct: 248 VPAQTQLGVMQAIAGWGLPVSDRLACVDTLEALIAHYRAIEAARAELPFDIDGVVYKVDR 307

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q++LG  A++PRW I+HKF  ++A T L  IDIQ+GRTG LTPV RL PV +GG ++
Sbjct: 308 LDWQQRLGFVAKAPRWAIAHKFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPVTVGGVVV 367

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +N TLHN D I  L            +R GDR++V+RAG+VIP+VVD +   R     PF
Sbjct: 368 SNVTLHNADEIARL-----------GVRPGDRIVVQRAGDVIPQVVDNLT--RDDPRSPF 414

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+CQS  VR+     G++    RCTGGL C+AQ+ ERL+HFVSR A +IEGLG+
Sbjct: 415 IFPDHCPVCQSEAVRE----EGEVDI--RCTGGLICAAQRFERLRHFVSRAALDIEGLGE 468

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++ F    D  + I  PADIF    R +T  T +    G+ + SV NL  +I  +R  
Sbjct: 469 KSIEEFL---DLGW-IAEPADIF----RLRTHRTDLLGREGWKEKSVDNLLAAIEAKRQP 520

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNN---------------- 592
              R +F LGIRH+GA  AR L K Y +          IIA  +                
Sbjct: 521 DAARLLFGLGIRHIGAVTARDLLKRYTTLPAIHGLAKEIIALRDAAAPAEGEEESRFRNR 580

Query: 593 -DDWLS-LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
            D  ++  I V  VG  +  A+ +F+  P N+     LL EVSP     E   S+ +  K
Sbjct: 581 LDKAIAEQIGVENVGSAVGHALADFFHEPHNVEVWNDLLSEVSPPDYVVETTASA-VTGK 639

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG L+ + R +A+    +LGA  +  +S KTD+++ G   GSKL++A  LG+++++
Sbjct: 640 TVVFTGKLETMSRDEAKAQAERLGAKAAGSVSAKTDLLVAGPGAGSKLKQAAALGIEVID 699

Query: 711 EEQF 714
           E  +
Sbjct: 700 EAAW 703


>gi|157964864|ref|YP_001499688.1| NAD-dependent DNA ligase LigA [Rickettsia massiliae MTU5]
 gi|166216234|sp|A8F2K5|DNLJ_RICM5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157844640|gb|ABV85141.1| DNA ligase, NAD-dependent [Rickettsia massiliae MTU5]
          Length = 689

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 276/712 (38%), Positives = 422/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S ++A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEKEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQVPMLSLSNAFDEQDVRDFVDRIKNFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGLSFSAVYKNGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDASITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNREDLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARSPRFATAHKFPAIIGQTQLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D   
Sbjct: 358 VSRATLHNFQEI-----------ARKDVRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTAT 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S+    L+     ++   RC  GL C AQ  ER++HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSK----LHYMPEDIII--RCDNGLNCPAQNYERIRHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I  P DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+   SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLAREVGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++  L E+       E    S + +K +VFTG+L  I R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKK-LGEILNIEDYKETREQSSLTDKIVVFTGSLPTISRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+A +S  TD+++ G + GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVTAGVSSNTDLVVAGVDAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|229587074|ref|YP_002845575.1| NAD-dependent DNA ligase LigA [Rickettsia africae ESF-5]
 gi|254781406|sp|C3PLJ2|DNLJ_RICAE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|228022124|gb|ACP53832.1| DNA ligase, NAD-dependent [Rickettsia africae ESF-5]
          Length = 689

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 275/712 (38%), Positives = 423/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S E+A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQVPMLSLSNAFDEQDVRDFVDRIKIFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGLSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQDEQGKDKFANPRNAAAGSLRQLDSSITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFVLQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D + 
Sbjct: 358 VSRATLHNFQEI-----------ARKDLRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTET 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S++     P+   +    RC  GL C AQ  ER++HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSKL--HYTPEDIII----RCDNGLNCPAQNYERIRHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I  P DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++ L   ++    +  +  SS + +K +VFTG+L  I R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKKLGGILNIEDYKETREQSS-LTDKIVVFTGSLSTISRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+  +S  TD+++ G   GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVAVGVSSNTDLVVAGVGAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|238650378|ref|YP_002916230.1| NAD-dependent DNA ligase LigA [Rickettsia peacockii str. Rustic]
 gi|257096313|sp|C4K0T1|DNLJ_RICPU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|238624476|gb|ACR47182.1| NAD-dependent DNA ligase LigA [Rickettsia peacockii str. Rustic]
          Length = 689

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 275/712 (38%), Positives = 421/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S E+A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KV H +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVMHQVPMLSLSNAFDEQDVRDFVDRIKIFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGLSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDSSITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D + 
Sbjct: 358 VSRATLHNFQEI-----------ARKDLRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTET 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S++     P+   +    RC  GL C AQ  ER+ HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSKL--HYTPEDIII----RCDNGLNCPAQNYERIHHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I  P DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLARAFGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++  L E+       E    S + +K +VFTG+L  I R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKK-LGEILNIEDYKETREQSSLTDKIVVFTGSLPTISRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+  +S  TD+++ G + GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVAVGVSSNTDLVVAGVDAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|15604557|ref|NP_221075.1| NAD-dependent DNA ligase LigA [Rickettsia prowazekii str. Madrid E]
 gi|6225281|sp|Q9ZCK9|DNLJ_RICPR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|3861252|emb|CAA15151.1| DNA LIGASE (lig) [Rickettsia prowazekii]
 gi|292572364|gb|ADE30279.1| DNA ligase, NAD-dependent [Rickettsia prowazekii Rp22]
          Length = 689

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 275/717 (38%), Positives = 422/717 (58%), Gaps = 39/717 (5%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S ++A+K L  L  +I+ ++  YY    P++ DSEYD L      + + FP L  S
Sbjct: 4   IDLISEQEAKKLLKELADKIAMYNHAYYIEDNPLVSDSEYDQLFNINLKLENTFPHLVLS 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G  +     KV H  P LSL   ++ +DLR F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGANITNKFAKVIHQAPMLSLSNAFDEDDLRDFLERIKNFLRINEFTPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G F+  A RGDG+ GED++  I+ I   P  +  N PE +EVR
Sbjct: 120 -CEPKIDGVSFSAIYKNGLFITGATRGDGYVGEDITMNIKTIKNFPHKID-NAPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E  A  R  +ANPRNAA+G +R+L+      R L +F++  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEAQNRGKFANPRNAAAGSIRQLDVAITAQRPLKYFIYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++ L F VN   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASTQEQLLTKLKALSFSVNEISKLASSEEEIFAFYEYLKTNRHNLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
            F++Q ++G  ARSPR+ I+HKF      T+LL I +Q+GRTG+LTPVA L+P+ IGG +
Sbjct: 298 NFAMQNRMGFIARSPRFAIAHKFPAIIGQTKLLSITVQVGRTGMLTPVAELDPIEIGGVV 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIP++  + +++R  D   
Sbjct: 358 VSRATLHNFQDI-----------ARKDVRIKDYVFLQRAGDVIPQITGVDISKRSNDTVK 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F  P FCP C S+   V  D+           RC  GL C AQ  ER+ HFVS++A +IE
Sbjct: 407 FDTPVFCPSCNSKLRYVSEDI---------IIRCDNGLNCPAQNYERICHFVSKNAMDIE 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q+ F          I  P DIF L+ + +T+  ++EN+ G+G  SV NL+ +I K
Sbjct: 458 GLGRKQVAFLIDKR----LISNPLDIFFLKEKNETNLIRLENMDGWGKKSVANLFKNIEK 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            + ISL+RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +++D +  L  +  +
Sbjct: 514 SQKISLQRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLSKNDSDIYQKLNDLEGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEAL--LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           GD I   IV+F+    N   ++ L  +  +       E+N+   +  K +VFTG+L  I 
Sbjct: 574 GDKILVDIVDFFYVKENTQLIKRLGSVLNIEDYQETREQNI---LTGKIVVFTGSLSTIS 630

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           R +A+E   +LGA V+A +S  TD++I G N GSKL+KA++L +KI++E ++L  ++
Sbjct: 631 RVEAKEIAEKLGAKVTASVSLNTDLVIAGVNGGSKLKKAKELNIKIIDEVEWLAFIK 687


>gi|15893019|ref|NP_360733.1| NAD-dependent DNA ligase LigA [Rickettsia conorii str. Malish 7]
 gi|81527939|sp|Q92GM7|DNLJ_RICCN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15620219|gb|AAL03634.1| DNA ligase [Rickettsia conorii str. Malish 7]
          Length = 689

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 275/712 (38%), Positives = 422/712 (59%), Gaps = 29/712 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S E+A+K L  L  +I+ ++  YY    P++ DSEYD L      +   FP L   
Sbjct: 4   IDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQVPMLSLSNAFDEQDVRDFVDRIKIFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  +  N+PE +EVR
Sbjct: 120 -CEPKIDGLSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNFPHKID-NVPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN E    G+  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDSSITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF +N   + A++   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN   I             +D+R+ D V ++RAG+VIPK++ +  ++R  D + 
Sbjct: 358 VSRATLHNFQEI-----------ARKDLRIKDYVFLQRAGDVIPKIMGVDFDKRPNDTET 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P FC  C S++     P+   +    RC  GL C AQ  ER++HFVS++A +IEGLG
Sbjct: 407 FDTPLFCLSCNSKL--HYTPEDIII----RCDNGLNCPAQNYERIRHFVSKNAMDIEGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++F     D    I    DIF L+ +  +S  K+EN+ G+G  SV NL+ +I K +N
Sbjct: 461 RKQVEFLI---DKGL-ISNLLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKN 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
           +SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +  D +  L  +  +GD 
Sbjct: 517 VSLPRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLRTNEPDIYQKLKNLEGIGDK 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           I   I++F+    NI  ++  L E+       E    S + +K +VFTG+L  I R +A+
Sbjct: 577 ILVDIIDFFDVKENIELIKK-LGEILNIEDYKETREQSGLTDKIVVFTGSLPTISRAEAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
               +LGA V+  +S  TD+++ G + GSKL+KA++L +KI++EE++L L++
Sbjct: 636 ATAEKLGAKVAVGVSSNTDLVVAGVDAGSKLKKAKELNIKIIDEEEWLTLIK 687


>gi|294011619|ref|YP_003545079.1| NAD-dependent DNA ligase [Sphingobium japonicum UT26S]
 gi|292674949|dbj|BAI96467.1| NAD-dependent DNA ligase [Sphingobium japonicum UT26S]
          Length = 711

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 284/736 (38%), Positives = 429/736 (58%), Gaps = 56/736 (7%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + +++  +A   L  L +EI+ H+  Y+   +P I D+ YDAL R  +A+  AFP L RS
Sbjct: 4   LTSMTEAEAANHLMRLAREIARHNRLYHDQDQPEITDAAYDALIRENNALEAAFPHLVRS 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
           + PN    ++G     +L KV H++  +SL+  +  ED+ +FI R+ RF    ++  +  
Sbjct: 64  DSPNA---QVGAAPTSALKKVQHAVRMMSLDNGFADEDIAEFIARVRRFLALPENAPVAL 120

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEV 187
           T EPKIDG   ++RYEKG+ V AA RGDG +GEDV+A +R I  IP R+    +P++ EV
Sbjct: 121 TAEPKIDGLSCSLRYEKGELVLAATRGDGTTGEDVTANVRTIADIPERLTGDTVPDLFEV 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKP-----YANPRNAASGILRRLNPT-DITRYLNFFVH 241
           RGEVY++K +F+ALN+ ++A    P     +ANPRNAA+G LR+ +     +R L F  H
Sbjct: 181 RGEVYMAKANFVALNERLLAEAEDPEKARQFANPRNAAAGSLRQKDAAVTASRPLRFLAH 240

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
           G G+ S + A+ Q  ++Q +   G PV++ +   +T   ++++Y  +++ R+ LP+DIDG
Sbjct: 241 GWGEVSAVPAETQLGVMQAIASWGLPVSDRLTCVDTLESLIAHYRAIEAARAELPFDIDG 300

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD    Q++LG  A++PRW I+HKF  ++A T L  IDIQ+GRTG LTPV RL PV
Sbjct: 301 VVYKVDRLDWQQRLGFVAKAPRWAIAHKFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPV 360

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG +++N TLHN D I  L            +R GDR++V+RAG+VIP+VVD +  + 
Sbjct: 361 TVGGVVVSNVTLHNADEIARLG-----------VRPGDRIVVQRAGDVIPQVVDNLTRD- 408

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
            P A PF+FP  CP+CQS  VR+     G++    RCTGGL C AQ+ ERL+HFVSR A 
Sbjct: 409 DPRA-PFAFPDHCPVCQSEAVRE----EGEVDI--RCTGGLICPAQRFERLRHFVSRAAL 461

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG++ ++ F    D  + I  PADIF    R +T    +    G+ + SV NL  +
Sbjct: 462 DIEGLGEKSIEEFL---DLGW-IAEPADIF----RLKTHRADLMGREGWKEKSVDNLLAA 513

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNN--------- 592
           I  +R     R +F LGIRH+GA  AR L K Y +          IIA  +         
Sbjct: 514 IEAKRQPDAARLLFGLGIRHIGAVTARDLLKRYATLPAIHALALEIIALRDAAQPAEGEE 573

Query: 593 --------DDWLS-LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
                   D  ++  I V  VG  +  A+ +F+  P N+     LL EVSP     E   
Sbjct: 574 ESRFRNRLDKAIAEQIGVENVGSAVGHALADFFHEPHNVEVWNDLLSEVSPPDYVVETTA 633

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
           S+ +  K +VFTG L+ + R +A+    ++GA  +  +S KTD+++ G   GSKL++A  
Sbjct: 634 SA-VTGKTVVFTGKLETMSRDEAKAQAERMGAKAAGSVSAKTDLVVAGPGAGSKLKQAAA 692

Query: 704 LGVKIMNEEQFLFLLQ 719
           LG+++++E  +  +++
Sbjct: 693 LGIEVIDEAAWAEIVK 708


>gi|88658391|ref|YP_507122.1| DNA ligase, NAD-dependent [Ehrlichia chaffeensis str. Arkansas]
 gi|123763773|sp|Q2GHG1|DNLJ_EHRCR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|88599848|gb|ABD45317.1| DNA ligase, NAD-dependent [Ehrlichia chaffeensis str. Arkansas]
          Length = 676

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/703 (39%), Positives = 422/703 (60%), Gaps = 41/703 (5%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A+ EL  L ++I +HD  YY    P I D+EYD L R+ + I +AFP L +S D    
Sbjct: 5   EKAKLELDKLNKQIQHHDVLYYVQDNPEISDAEYDELCRKRNLILNAFPKLTQSNDYQ-- 62

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
            N IG   +    KV H     SL+  +N +D+ KFITR  +F    D+ SI  + E KI
Sbjct: 63  -NNIGSSPDTKFAKVKHEEKMFSLDNAFNQQDVEKFITRTKKFLNINDNQSIPLSCELKI 121

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG   ++ Y+KG+   A+ RG+G+ GE+++  ++ I  +P ++  N P+++EVRGE+YI 
Sbjct: 122 DGLSFSVIYKKGEIYQASTRGNGYFGENITTNVKTIKNLPHIIH-NAPDLLEVRGEIYID 180

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAK 252
           + DF+ LN++        +ANPRNAA+G +R+L+  +IT  R L +F++ +  T+ +   
Sbjct: 181 RCDFIQLNND-----GNNFANPRNAAAGSVRQLDH-NITAQRKLKYFMYTIVNTACL--- 231

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
            Q E+L +++  GF VN      +      ++YN++ + RS + YDIDG++YKV++   Q
Sbjct: 232 TQEELLYQLKIWGFCVNEHTITTDNIEEAFNFYNQVYNNRSNINYDIDGIIYKVNDIKSQ 291

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
             LG  ++SPRW I++KF   +A T+L  I IQIGRTG+LTP+A L P+NIGG ++T A+
Sbjct: 292 HILGTTSKSPRWAIAYKFPAAEAKTQLNKISIQIGRTGVLTPIAELSPINIGGVIVTRAS 351

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN++ I+            +DIR GD V+VKRAG+VIP++VD+  N R  +   F FP+
Sbjct: 352 LHNKNEIE-----------RKDIREGDYVIVKRAGDVIPQIVDVDKNLRTQELTKFVFPT 400

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C S V +       K  A+  CTG L C  Q LE++KHFVS+DAFNI G GK+QL 
Sbjct: 401 TCPSCGSSVYQ------AKQEASIYCTGELFCKDQILEKIKHFVSKDAFNIIGFGKKQLL 454

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
           FF++       I    DIFTL+ +   S  K+E++ G+G+ S++NL+ +IN  + ISLE 
Sbjct: 455 FFYEQR----LITNITDIFTLEEKISNSDVKLESLHGWGEKSMSNLFSAINNSKVISLEN 510

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR +G  IA+ LA ++ SY+ +  E+   +A N D  L+   +  +G     ++
Sbjct: 511 FIFALGIRFIGKYIAKILANHFSSYETWYNEMLK-LAQNEDYSLN---IQQIGSKTIGSL 566

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
             F+  P N+  +  L+K ++ +      +  S I  K +VFTG L  + R +A+     
Sbjct: 567 KMFFSQPHNLNMINDLVKHLTIT-DTQSSSYLSLIHGKIIVFTGELSSMSRSEAKIRSET 625

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            GA VS+ LS+ TD +I G+NPGSK +KAQ L V+I+ E+ +L
Sbjct: 626 AGAKVSSSLSKNTDFLIAGNNPGSKYKKAQSLNVQILTEDLWL 668


>gi|157804104|ref|YP_001492653.1| NAD-dependent DNA ligase LigA [Rickettsia canadensis str. McKiel]
 gi|166216233|sp|A8EZT5|DNLJ_RICCK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157785367|gb|ABV73868.1| DNA ligase [Rickettsia canadensis str. McKiel]
          Length = 689

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 274/714 (38%), Positives = 423/714 (59%), Gaps = 35/714 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I  +S ++A+K L  L  +I  ++  YY  +  ++ D+EYD L      +   FP L   
Sbjct: 4   IYLISEKEAKKLLKELADKIERYNHAYYIENNHLVSDAEYDQLFNTNLKLEQKFPHLILE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  K+G ++     KVTH  P LSL  +++ +D++ F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKKVGAKIANKFAKVTHQAPMLSLSNVFDEQDVKDFVDRIKNFLRLNEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G     A RGDG+ GED++A I+ I   P  ++ N PE +EVR
Sbjct: 120 -CEPKIDGLSFSAIYKNGLLTIGATRGDGYIGEDMTANIKTIKNFPHKIN-NAPEFLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DF  LN E    GR  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFFNLNKEQEEQGRDKFANPRNAAAGSLRQLDSSVTAKRPLKYFVYSGGATE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q E+L+K++  GF VN   + A++   I ++Y  +K+ R  L Y+IDG+VYK++
Sbjct: 238 QNIASSQNELLKKLKEFGFRVNEISKLADSEEEIFAFYEYLKTNRENLSYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+LQ ++G  AR+PR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFALQNRMGFIARAPRFATAHKFPAIVGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN           +++R  +D+R+ D V ++RAG+VIP+++ + + +R  DA  
Sbjct: 358 VSRATLHN---------FQEIIR--KDVRIRDYVFLQRAGDVIPQIIGVDIGKRSTDATT 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F+ P FCP C S+   +  D+           RC   L C AQ  ER++HFVS++A +IE
Sbjct: 407 FNTPLFCPSCNSKLHYIPEDI---------IIRCDNVLNCPAQNYERIRHFVSKNAMDIE 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++F     D    I  P DIF L+ + + S TK+EN+ G+G  SV NL+ +I +
Sbjct: 458 GLGRKQVEFLI---DKGL-ISNPLDIFLLKEKNEASLTKLENMDGWGRKSVENLFKNIEE 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            RN+SL RFI++LGIRH+G + A+ LA+ + SY NF  +I  +  ++++ +  L  +  +
Sbjct: 514 SRNVSLPRFIYALGIRHIGEQNAKLLAREFESYNNFISQIELLSKNDSNIYQKLNNLEGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           GD I   I+ F+    NI  ++  L EV       E    S +  K +VFTG+L    R 
Sbjct: 574 GDKILVDIINFFDVKENIELIKK-LGEVLNIEDYKETKEHSSLTGKIVVFTGSLPTTSRV 632

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+    +LGA V+  +S  TD++I G + GSKL+KA++LG+KI++EE++L ++
Sbjct: 633 EAKAMAEKLGAKVAVSVSSNTDLVIAGVDAGSKLKKAKELGIKIIDEEEWLTIV 686


>gi|288958932|ref|YP_003449273.1| DNA ligase (NAD+) [Azospirillum sp. B510]
 gi|288911240|dbj|BAI72729.1| DNA ligase (NAD+) [Azospirillum sp. B510]
          Length = 788

 Score =  482 bits (1240), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 263/623 (42%), Positives = 393/623 (63%), Gaps = 32/623 (5%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I ++AL+ EQA  +L++L  EI++HD  Y+Q  +P I D++YDAL RR  AI   FP+L 
Sbjct: 14  IAVDALTPEQAAADLAALAAEIAHHDRLYHQQDQPEITDADYDALVRRNLAIEARFPELR 73

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P+    ++G        KV H+IP LSL   +  ED+ +F  R+ RF    DD  +
Sbjct: 74  RADSPS---LRVGAAPAAGFGKVRHAIPMLSLGNAFAPEDVAEFDARVRRFLGLADDAPL 130

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            F  EPKIDG   ++RY+KG+ V AA RGDG  GE+V+A +R I  +P  L    PE++E
Sbjct: 131 TFVAEPKIDGLSCSLRYQKGELVLAATRGDGAEGENVTANVRTIRDVPHRLPAPFPEVLE 190

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S++DFLA+N      G + +ANPRNAA+G LR+L+     +R L FF + LG+
Sbjct: 191 VRGEVYMSRDDFLAMNAARAEKGEQLFANPRNAAAGSLRQLDSAITASRPLCFFGYALGE 250

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE  A+ Q+ + ++++  GF +N      +    +++YY  +  +R+ LP+DIDG+VYK
Sbjct: 251 ASEPIAETQWGIRERLKGWGFQLNRPAELCDGKDKLLAYYEGIGRLRAGLPFDIDGVVYK 310

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ++LG  +R+PRW I+HKF  +QA TRL  I IQ+GRTG LTPVA L+ + +GG
Sbjct: 311 VDSLELQQRLGFVSRAPRWAIAHKFPAEQAQTRLKAITIQVGRTGALTPVAELDDITVGG 370

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++ ATLHNED I             +DIRVGD V+V+RAG+VIP+VV++++++R  D+
Sbjct: 371 VVVSRATLHNEDEI-----------ARKDIRVGDLVVVQRAGDVIPQVVEVVLSQRPADS 419

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+     CP+C S  +R+     G++V   RCTGGL C+AQ  ERL+HFVSRDAF+IEG
Sbjct: 420 VPYVPVETCPVCGSLAIRE----AGEVV--RRCTGGLICAAQAKERLRHFVSRDAFDIEG 473

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++ ++ F+   D  F I+ P DIFTL+ R      ++    G+ + SV NL+ +IN+R
Sbjct: 474 LGEKIIEEFW---DEGF-IKSPVDIFTLEDR-----VELIGRPGWKEKSVENLFKAINQR 524

Query: 546 RN-ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI-IAHNNDDWLSLIRVPL 603
           R+ I L R IF+LGIRHVG   A+SLA++Y + + +   +     A    +W  L  +  
Sbjct: 525 RDGIELHRVIFALGIRHVGEVTAKSLARHYRTMRGWVDGMRAAERAMPGQEWRDLHALNG 584

Query: 604 VGDIIAQAIVEFYQNPRNICAVE 626
           VG + A  I+ ++ +P +   ++
Sbjct: 585 VGPVTADTILAWFADPESAAKLD 607



 Score =  103 bits (258), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 96/187 (51%), Gaps = 1/187 (0%)

Query: 530 FGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA 589
           F D       D       + LE  I SLGI+ +    A++LA  Y +  ++   +   +A
Sbjct: 597 FADPESAAKLDFYAGSEALRLETIIGSLGIKRLNTRAAQALATRYGNLSDWRAAMERAVA 656

Query: 590 HN-NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIE 648
                 WL L+  P VG++ A+ +  F+   RN   VEAL   +        K  +S I 
Sbjct: 657 QAPGQPWLDLVATPDVGEVAAEELAGFFAEERNRLIVEALAGRLIVLEAAVPKAGNSPIA 716

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +VFTGTL+++ R +A+     LGA V+  +S KTD ++ G + GSK  KA+ LGV+I
Sbjct: 717 GKTVVFTGTLERMTRSEAKARAESLGAKVAGSVSGKTDYLVAGADAGSKAAKAKDLGVEI 776

Query: 709 MNEEQFL 715
           + EE++L
Sbjct: 777 LTEEEWL 783


>gi|73667316|ref|YP_303332.1| NAD-dependent DNA ligase [Ehrlichia canis str. Jake]
 gi|123732189|sp|Q3YRC1|DNLJ_EHRCJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|72394457|gb|AAZ68734.1| NAD-dependent DNA ligase [Ehrlichia canis str. Jake]
          Length = 677

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 269/703 (38%), Positives = 415/703 (59%), Gaps = 41/703 (5%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A+ EL  L  +I +HD  YY    P I D+EYD L  + + I  +FP+LA +   N  
Sbjct: 4   EEAKLELDKLNSQIQHHDFLYYTQDNPQITDAEYDVLCHKRNLILESFPELASN---NNY 60

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
            + +G   +    KV H+   LSL+  +N +D+ KFITR  +     +  SI  + E KI
Sbjct: 61  QDNVGSTPDAKFAKVKHAEKMLSLDNAFNQQDIEKFITRTKKLLDMDNSQSIAISCELKI 120

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG   ++ Y+KG+   A+ RG+G+ GE+++  ++ I  +P  +  N P+ +EVRGE+YI 
Sbjct: 121 DGLSFSVIYKKGEISQASTRGNGYFGENITNNVKTIKNLPHTIQ-NAPDSLEVRGEIYID 179

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAK 252
           ++DF+ LN +        +ANPRNAA+G +R+L+  +IT  R L +F++ +  T  +   
Sbjct: 180 RSDFIQLNKD-----GNNFANPRNAAAGSVRQLD-INITAQRKLKYFMYTIVNTKCL--- 230

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
            Q E L +++ LGF VN      N     +++YN+  + RS + YDIDG++YKV++   Q
Sbjct: 231 TQEETLNQLKTLGFCVNEHTITTNNIEDALNFYNQFYNNRSNISYDIDGIIYKVNDIKSQ 290

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
             LG   +SPRW I++KF   +A T +  I IQIGRTG+LTP+A L P+NIGG ++T A+
Sbjct: 291 HILGATNKSPRWAIAYKFPAAEAKTLVNKISIQIGRTGVLTPIAELSPINIGGVIVTRAS 350

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN+  I+            +DIR GD V+VKRAG+VIP+VVD+  N R  +   F FP+
Sbjct: 351 LHNKSEIE-----------RKDIREGDYVIVKRAGDVIPQVVDVDKNLRAQELTKFIFPT 399

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C S + +       +   +  CTG L C  Q LE++KHFVS+DAFNI G GK+QL 
Sbjct: 400 TCPSCGSNLFQ------AEQEVSIYCTGELFCKNQILEKIKHFVSKDAFNIIGFGKKQLL 453

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
           FF++       I    DIFTL+ +   S  K+E++ G+G+ S+ NL+ +IN  + ISLE 
Sbjct: 454 FFYEQG----LITNIVDIFTLEEKISNSDLKLESLHGWGEKSIHNLFSAINNSKTISLEN 509

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR VG  IA+ LAK++LSY+ +  E+  +    N     L+ +  +G     ++
Sbjct: 510 FIFALGIRFVGKYIAKILAKHFLSYEKWYHEMLRLAQDEN----YLLNIQQIGHKTIHSL 565

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
             F+    N+  +  L++ ++ +  +   ++S  +  K +VFTG L  + RH+A+     
Sbjct: 566 KMFFTEQHNLDTINNLVRHLTITDAKTTSHLSL-LHGKTIVFTGELSNMSRHEAKTKSET 624

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            GA VS+ LS+ TD +IVG+NPGSK +KAQ L ++I+ E+ +L
Sbjct: 625 AGAKVSSSLSKNTDFLIVGNNPGSKYKKAQSLNIQILTEDLWL 667


>gi|114705256|ref|ZP_01438164.1| DNA ligase, NAD-dependent [Fulvimarina pelagi HTCC2506]
 gi|114540041|gb|EAU43161.1| DNA ligase, NAD-dependent [Fulvimarina pelagi HTCC2506]
          Length = 821

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 259/649 (39%), Positives = 383/649 (59%), Gaps = 47/649 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E L   +A  EL  L +EI+ HD  YY    P + D++YDAL+RR  AI   FP L R
Sbjct: 5   PVENLDETEAASELERLAREIAEHDRAYYGDDAPTLSDADYDALRRRNTAIEARFPALIR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P+    ++G   + +  KV H++P LSL+  +  ED+  F  R+ R  + +D + + 
Sbjct: 65  ADSPS---KRVGAAPSTTFAKVRHAVPMLSLDNAFTEEDVADFAKRVRRIAKLQDTDGLG 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG  +++RY  G+   AA RGDG  GEDV+   R +  IP V     P++ EV
Sbjct: 122 ITAEPKIDGLSLSLRYVNGELETAATRGDGTVGEDVTPNARTVDDIP-VRIDRAPKVFEV 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGK 245
           RGEVY++  DF ALN+   A G+  +ANPRNAA+G LR+ +  ++TR   L FF +  G+
Sbjct: 181 RGEVYMAHADFAALNERQEAAGKPRFANPRNAAAGSLRQKD-AEVTRSRPLRFFAYAWGE 239

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+  + Q E++  +   GFPVN  +++  T   ++ +Y  ++  R++L YDIDG+VYK
Sbjct: 240 ASEVPGETQSEVVAAIGKFGFPVNELMQRFETIDALIEHYRRIEENRASLGYDIDGVVYK 299

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQK LG  +R PRW I+HKFA ++A+T L  ID+  GRTG L P+ARLEPV +GG
Sbjct: 300 VDDLRLQKDLGFVSRFPRWAIAHKFAAEKATTVLKGIDVTTGRTGALNPIARLEPVTVGG 359

Query: 366 ALITNATLHNEDYIKGLDASGKVMR-GGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
            +++NATLHNEDYI G+DA G+ +R  G DIR+GD V+++RAG+VIP+++D++  +R   
Sbjct: 360 VVVSNATLHNEDYIAGIDADGETIRPSGLDIRIGDTVVIQRAGDVIPQIIDVVAEKRPAG 419

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+PF FP+ C +C S  VR++NP+TG+  +   CT GL C AQ  E LKH VSR AF+IE
Sbjct: 420 AKPFVFPTHCAVCGSNAVREMNPRTGRPDSKRHCTAGLTCPAQGREGLKHLVSRSAFDIE 479

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGF-------------- 530
           GLG+  ++  F   D    +R PADIFTL   +  +  +   +                 
Sbjct: 480 GLGETLVEALF---DEGL-VRQPADIFTLDFEKMKALLEERALAARREREAAEDEAARAE 535

Query: 531 -------GD-------VSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLS 576
                  GD        S  N++D I+ RR + LERFIF LGI +VG   A++LA++   
Sbjct: 536 GREPKVRGDDRAYDYTKSTQNIFDGIDARRTLPLERFIFGLGIPNVGETTAKALARH--- 592

Query: 577 YQNFAQEINNIIAHN----NDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           + + A  I  + A         W+ L  +  +G+   + I++  Q+  N
Sbjct: 593 FSDVAALIGGVDAAEKGKPGSAWIELSALKGIGEKSFEQILDLDQSKLN 641



 Score = 80.5 bits (197), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 71/124 (57%), Gaps = 3/124 (2%)

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE---IENKK 651
           +L+L     +G +  Q+++ F+    N  AV+ALLK    +       V+S    +    
Sbjct: 689 YLNLTTDSDIGTVATQSLINFFAEDHNRQAVDALLKAGVSTTNERMTAVASNDSPVSGLT 748

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG+L+K+ R  A+E    LGA VS  +S KTD+++ G   GSKL KA +LG+++++E
Sbjct: 749 IVFTGSLEKMTREAAKEMAEGLGAKVSGSVSNKTDLVVAGPGAGSKLSKASELGIEVIDE 808

Query: 712 EQFL 715
           + + 
Sbjct: 809 DAWF 812


>gi|58038653|ref|YP_190617.1| NAD-dependent DNA ligase [Gluconobacter oxydans 621H]
 gi|81352629|sp|Q5FUI5|DNLJ_GLUOX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|58001067|gb|AAW59961.1| NAD-dependent DNA ligase [Gluconobacter oxydans 621H]
          Length = 683

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 276/701 (39%), Positives = 419/701 (59%), Gaps = 38/701 (5%)

Query: 22  SSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGE 81
           ++LE +++  D+ Y+   +P + D+ YDA +R   A+  A+PDL   E   G   ++G  
Sbjct: 13  AALEADLAQWDEAYHGRDEPEVSDAVYDAARRELLALEEAYPDLRSQE---GASQRVGAT 69

Query: 82  MNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN--SIFFTLEPKIDGTMI 139
            + +  K  H +P LSL+ +++ E    F++R+ RF    +D   ++ F  EPKIDG  I
Sbjct: 70  PDSAFGKYRHLVPMLSLDNVFDPEGFDGFVSRVGRFLGLDEDGLQALQFVAEPKIDGLSI 129

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFL 199
           ++ YE G FV    RGDG  GEDV+A +  +  IPR L    PE +E+RGEV++SK+ FL
Sbjct: 130 SLTYEHGHFVRGTTRGDGIEGEDVTANLLTLKDIPRELPGEAPERVEIRGEVFLSKSSFL 189

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAKGQYEM 257
            LN++ +A G KP+ANPRNAA+G LR+L+  +ITR   L+ F +  G TS   A   ++ 
Sbjct: 190 TLNEQQVARGAKPFANPRNAAAGSLRQLD-AEITRSRPLSLFAYAQGYTSSPVATTHWDY 248

Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317
           L+K+R  GF VN   +       I +Y  ++   RS L YDIDG+V+K+D+ SLQ +LG 
Sbjct: 249 LEKLRSWGFTVNPLSQMIAHARDIPAYVEKLARERSELDYDIDGIVFKLDDLSLQDRLGF 308

Query: 318 RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED 377
             R+PRW I+ KF  +QA TRL +I+IQ+GRTG LTPVA LEPVN+GG +++ ATLHNED
Sbjct: 309 AGRAPRWAIAWKFPAEQAITRLREIEIQVGRTGALTPVAHLEPVNVGGVIVSRATLHNED 368

Query: 378 YIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPIC 437
            I             +D+RVGD V ++RAG+VIP+++  + +E  P ++PF +P  CP+C
Sbjct: 369 EI-----------ARKDVRVGDLVRLQRAGDVIPQILGPVPSE-EPRSEPFVYPDHCPVC 416

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
            S   R          A  RCTGGL C AQ +ERL H VSR+AF+I+GLG++ +  F+  
Sbjct: 417 GSLAERVHGE------AVRRCTGGLTCEAQIVERLIHMVSRNAFDIDGLGERSIREFYD- 469

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
              A  IR P DIF L++ ++    +     G+G +SV NL+ +I  RR I L R IF L
Sbjct: 470 ---AGYIRRPGDIFRLRQHEEALLQRD----GWGRLSVDNLFRAIEDRRTIPLSRLIFGL 522

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH-NNDDWLSLIRVPLVGDIIAQAIVEFY 616
           GIR +G   A+ LA++Y +++N+   +  + A  ++++  SL  +  VGD IA  +  F+
Sbjct: 523 GIRRIGERNAQLLARHYQTFENWRTAM--LAARPDSEERASLGAIMGVGDAIADELSAFF 580

Query: 617 QNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAV 676
               NI  ++ L  E+   I   E      +  K +VFTGTL  + R +A+    +LGA 
Sbjct: 581 SESHNIETLDDLALELKDIIA-EEAPSEGHLSGKVIVFTGTLTTMSRPEAKAIAERLGAQ 639

Query: 677 VSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           V+  +S+KT ++++G+  GSK +KA +LG++ ++E  +  L
Sbjct: 640 VTDSVSKKTSLVVLGEKAGSKAKKAAELGIETVDESGWRVL 680


>gi|157826142|ref|YP_001493862.1| NAD-dependent DNA ligase LigA [Rickettsia akari str. Hartford]
 gi|166216231|sp|A8GPM9|DNLJ_RICAH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157800100|gb|ABV75354.1| DNA ligase [Rickettsia akari str. Hartford]
          Length = 689

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 272/715 (38%), Positives = 415/715 (58%), Gaps = 35/715 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ +S  +A+K L  L  +I+ ++  YY    P++ D+EYD L      +   FP L   
Sbjct: 4   IDFISEAEAKKLLEELSCKIAAYNHAYYIEDNPLVSDAEYDQLVNINLKLEQQFPHLVLE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  ++G ++     KVTH +P LSL   ++ +D+R F+ RI  F +  +   IF 
Sbjct: 64  ---NSPSKEVGAKIANKFVKVTHQVPMLSLSNAFDEQDVRDFVDRIKNFLRLDEFAPIF- 119

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             EPKIDG   +  Y+ G  +  A RGDG+ GED++A I+ I   P  +  N PE +EVR
Sbjct: 120 -CEPKIDGLSFSAIYKNGLLITGATRGDGYVGEDITANIKTIKNFPHKID-NAPECLEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+YI K DFL LN+E    GR  +ANPRNAA+G LR+L+ +    R L +FV+  G T 
Sbjct: 178 GEIYIEKQDFLNLNEEQEEQGRDQFANPRNAAAGSLRQLDASITAKRPLKYFVYSGGVTE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           +  A  Q ++L K++  GF VN   +   +   I ++Y  +K+ R  LPY+IDG+VYK++
Sbjct: 238 QNLASSQDQLLTKLKKFGFSVNEISKLTKSEEEIFAFYEYLKTNRENLPYEIDGVVYKLN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F LQ ++G  ARSPR+  +HKF      T+LL I +Q+GRTG LTPVA LEP+ IGG  
Sbjct: 298 DFELQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTGTLTPVAELEPIEIGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHN           +++R  +D+++ D V ++RAG+VIPK+    + +R  D   
Sbjct: 358 VSRATLHN---------FQEIVR--KDVQIKDYVFLQRAGDVIPKITGADIEKRPNDTIA 406

Query: 428 FSFPSFCPICQSR---VVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           F  P FCP C S+   V  D+           RC  GL C AQ  ER++HFVS++A +I 
Sbjct: 407 FEAPLFCPSCNSKLYYVPEDI---------IIRCDNGLNCPAQHYERIRHFVSKNAMDIA 457

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++F          I  P DIF L++  + S  K+EN+ G+G  SV  L  +I K
Sbjct: 458 GLGRKQVEFLIAKG----LISNPLDIFFLKKNNEASLIKLENMDGWGQKSVEKLLKNIEK 513

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            +N+SL RFI++LGIRH+G + A+ LA+ + SY NF  ++  +  +++D +  L  +  +
Sbjct: 514 SKNVSLPRFIYALGIRHIGEQNAKLLAREFGSYNNFIAQMELLSKNDSDIYQKLNNLEGI 573

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           GD I   I+ F     NI  ++  L E+       E    S +  K +VFTG+L  I R 
Sbjct: 574 GDKILIDIIAFLDVKENIQLIKK-LGEILNIEDYKETRAQSSLTGKIVVFTGSLPTISRA 632

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           + +    +LGA V+A +S  TD+++ G + GSKL+KA++L +KI++EE++L L++
Sbjct: 633 EVKATAEKLGAKVAASVSSNTDLVVAGLDAGSKLQKAKELNIKIIDEEEWLTLIK 687


>gi|85374270|ref|YP_458332.1| DNA ligase [Erythrobacter litoralis HTCC2594]
 gi|123409617|sp|Q2N9V6|DNLJ_ERYLH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|84787353|gb|ABC63535.1| DNA ligase [Erythrobacter litoralis HTCC2594]
          Length = 736

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 286/753 (37%), Positives = 416/753 (55%), Gaps = 82/753 (10%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E LS  +A  EL  L ++I+ HD  Y+    P I D EYDAL RR   +  AFP L R 
Sbjct: 5   LENLSEAEAANELMRLARQIAKHDRLYHAEDAPEITDQEYDALVRRNAELEAAFPHLVRE 64

Query: 69  EDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           + P+    K+G  +  S L KVTH +  +SL+  +  E++ +F+ R+ R+    +D +I 
Sbjct: 65  DSPS---RKVGHAVAASPLSKVTHEVRMMSLDNAFADEEVAEFVARVRRYLNIGEDEAIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS--------- 178
           FT E KIDG   ++RYE GK V AA RGDG  GEDV+  +  I  IP+ L+         
Sbjct: 122 FTAEDKIDGLSCSLRYENGKLVRAATRGDGQVGEDVTPNVAHIGDIPQELTPLPLAGGAG 181

Query: 179 ----------------------LNIPEIIEVRGEVYISKNDFLALNDEMIAVGR------ 210
                                  N P + E+RGEVY++  DF ALN  ++   R      
Sbjct: 182 GGPLDDSGSAPTPDPSRRREGKWNGPAVFEIRGEVYMATADFHALNARLMDEARAEADEK 241

Query: 211 ---------KPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT-SEIFAKGQYEMLQ 259
                    + +ANPRNAA+G LR+ + +   TR L F+ HG G    ++  + Q E+++
Sbjct: 242 DNAFDTAKVRQFANPRNAAAGSLRQKDASVTATRPLRFWAHGWGAVEGDVPGETQVEVVE 301

Query: 260 KMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERA 319
           ++   G PV+   R+  T   ++++Y  + + R+ LPY+IDG+VYKVD    Q++LG  A
Sbjct: 302 QIAAWGVPVSPLFRRCETLEEMLAHYEAIGAQRADLPYEIDGVVYKVDRLDYQQRLGFVA 361

Query: 320 RSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYI 379
           ++PRW I+ KF  +QA T L +IDIQ+GRTG LTPV RL PV +GG  +TN TLHN D I
Sbjct: 362 KAPRWAIARKFPAEQAETTLENIDIQVGRTGKLTPVGRLAPVLVGGVTVTNVTLHNRDEI 421

Query: 380 KGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQS 439
           + L            +R GDRV+V+RAG+VIP+VV  +  +   D+  F FP  CP C S
Sbjct: 422 ERL-----------GVRPGDRVVVQRAGDVIPQVVRNLTPDEKRDS--FEFPDTCPECGS 468

Query: 440 RVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSED 499
             V +   + G  V   RCTGGL C AQ+ ERLKHFVSR A +I+GLG++ +D FF    
Sbjct: 469 EAVSE---EGGVDV---RCTGGLICPAQRTERLKHFVSRAALDIDGLGEKTIDQFFA--- 519

Query: 500 PAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGI 559
               +  PADIF L+ R+     +I  + G+ D SV NL  S+  RR     R +  LGI
Sbjct: 520 -LGWLESPADIFRLKDRRD----EILALEGWMDKSVDNLLASVEARREPDTARLLLGLGI 574

Query: 560 RHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNP 619
           RHVGA  AR L KY+       +      A + +  ++L  +  +G  + +A+ +F+   
Sbjct: 575 RHVGAVTARDLMKYFHELPALRETAEKARAGDEEAVVALTSIDGIGSAVVEALGDFFHEE 634

Query: 620 RNICAVEALLKEVSPSIGRHE-KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678
            N    + LL EVSP   R+E + + S +  K +VFTG L+ + R +A+    +LGA  S
Sbjct: 635 HNRAVWDDLLSEVSPP--RYEVETLDSPVAGKTVVFTGKLETMSRDEAKAQAERLGAKAS 692

Query: 679 AILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
             +S KTD+++ G   GSKL+KAQ LG+++++E
Sbjct: 693 GSVSAKTDLLVAGPGAGSKLKKAQDLGIEVIDE 725


>gi|329889238|ref|ZP_08267581.1| DNA ligase, NAD-dependent [Brevundimonas diminuta ATCC 11568]
 gi|328844539|gb|EGF94103.1| DNA ligase, NAD-dependent [Brevundimonas diminuta ATCC 11568]
          Length = 774

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 263/598 (43%), Positives = 364/598 (60%), Gaps = 32/598 (5%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
             P+E L+  QAR+EL  L  E++ HD  YY  + P I D++YD LKRR  A+  AFP L
Sbjct: 5   FTPVETLTEAQAREELDRLSAELARHDALYYADAAPEISDADYDELKRRALALEAAFPAL 64

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           +    P  P  ++G  ++    +V H +P LSL+  ++  ++R F+ RI RF +   D  
Sbjct: 65  S---GPISPSQRVGAPVSTQFAEVRHGVPMLSLDNAFDEGEVRDFVARIARFLKLPGDEP 121

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEI 184
           I F  EPKIDG   ++RYEKG  V  A RGDG +GEDV+A +R + +IP+ L+    P++
Sbjct: 122 IAFVAEPKIDGLSASLRYEKGVLVQGATRGDGKTGEDVTANLRTLDSIPQTLAGSGWPDV 181

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHG 242
           IE+RGEVY     F A N    A G++ YANPRN A+G LR+ +P  IT  R L FF + 
Sbjct: 182 IEIRGEVYAPNAAFDAFNAAAEAEGKRTYANPRNFAAGSLRQKDPK-ITALRPLTFFAYA 240

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+TS  FA+ Q   L+  R  GF VN+   +     G++  Y  +++ RS L YDIDG+
Sbjct: 241 WGETSAPFAETQAGALEAFRSWGFQVNDRSARVEGADGLIGVYQTLETDRSRLGYDIDGV 300

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD    Q++LG  ARSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL PV 
Sbjct: 301 VYKVDRLDWQQRLGFIARSPRWAIAHKFPAQQATTVLEGIDIQVGRTGSLTPVARLHPVT 360

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG ++ NATLHNED I             +D+RVGD V+++RAG+VIP++V ++   R 
Sbjct: 361 VGGVVVRNATLHNEDEI-----------ARKDVRVGDTVVLQRAGDVIPQIVGVVETLRP 409

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
            DAQP+ FP+ CP+C S  VR+ +          RCTGGL C AQ +ERLKHFVSR AF+
Sbjct: 410 DDAQPYIFPTVCPVCGSEAVREGDE------VKRRCTGGLICDAQIVERLKHFVSRRAFD 463

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQR-RQQTSTTKIENILGFGDVSVTNLYDS 541
           IEGLG++QL  F         I+ PADIF L R  ++ +  + E+  G+G+ SV NL   
Sbjct: 464 IEGLGEKQLIAFHARG----WIKEPADIFRLARDEEKLALLRAED--GYGETSVGNLIAG 517

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH-NNDDWLSL 598
           I+ RR ISL+R IF LG+R +G + +  L++ + S+  F        +   +DDW +L
Sbjct: 518 IDARRVISLDRLIFGLGVREIGEQTSLVLSRAFGSWTAFRDACMAAASGLASDDWKTL 575



 Score = 84.7 bits (208), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 85/165 (51%), Gaps = 1/165 (0%)

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR-VPLVGDIIAQAIV 613
            +L    + A   RSLA+    + +  +           D L+ I  V  VG + A+A+ 
Sbjct: 609 IALAFPGMAAPARRSLAEISEGWSDLTRWAAVARDEGPSDMLNQIAGVSGVGPVAAEALA 668

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
            F+  P N+  V+ALL E+            S +  K +VF+G+L++  R +A+     L
Sbjct: 669 HFFHEPHNLQVVDALLAELERVEDVAAPVTDSPVAGKTVVFSGSLERFTRDEAKARAESL 728

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           GA VS  +S+KTD ++ G   GSKL+ A++ GV ++ E+++L L+
Sbjct: 729 GAKVSGSVSKKTDYVVAGPGAGSKLKDAEKHGVTVLTEDEWLALI 773


>gi|330994412|ref|ZP_08318338.1| DNA ligase [Gluconacetobacter sp. SXCC-1]
 gi|329758538|gb|EGG75056.1| DNA ligase [Gluconacetobacter sp. SXCC-1]
          Length = 712

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 274/705 (38%), Positives = 398/705 (56%), Gaps = 35/705 (4%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
           A K L+ L   +   D  Y+Q+  P++ D+ YD+L++    +   FPDL R+   + P  
Sbjct: 31  AEKALTQLATLLPALDAAYHQHDAPLVDDATYDSLRQLNTRLEARFPDLRRT---DSPAQ 87

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS--IFFTLEPKI 134
           ++G        +  H +P LSL+ +++ E+   FI+RI RF    ++ +  + F  EPKI
Sbjct: 88  QVGAPATGPFRRHRHMVPMLSLDNVFSREEFEGFISRIARFLGLDEEQARQLSFVAEPKI 147

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG  I++ YE G+FV    RGDG  GEDV+A +R +  IP  L    P++IE+RGEV++S
Sbjct: 148 DGLSISLTYEHGRFVRGTTRGDGTEGEDVTANLRTLRDIPDQLPAPCPDVIEIRGEVFLS 207

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAK 252
           K  FL LN      G +P+ANPRNAA+G LR+L+   IT  R L+ F +  G  S   A 
Sbjct: 208 KQAFLELNAAQERAGDRPFANPRNAAAGSLRQLD-AGITARRPLSLFAYAAGYCSAPLAA 266

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             +  L ++   GF VN    Q        ++   +   RS L YDIDG+VYK+D+ +LQ
Sbjct: 267 THHGYLAQLAAWGFRVNPLSTQVKDAGAAEAFMERLTLERSALDYDIDGIVYKLDDRALQ 326

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           ++LG   R+PRW ++ KF  +QA TRL  IDIQ+GRTG LTPVA LEPVN+GG ++T A+
Sbjct: 327 ERLGFAGRAPRWAVAWKFPAEQAVTRLEKIDIQVGRTGALTPVAFLEPVNVGGVMVTRAS 386

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHNED I             +DIR GD V V+RAG+VIP+V  +++   H D  P+ FP 
Sbjct: 387 LHNEDEIT-----------RKDIREGDLVHVQRAGDVIPQVTGVVLPRDH-DRPPYRFPH 434

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C +   R      G++V   RC+GGL C AQ +ERL HFVSRDAF+IEGLG + + 
Sbjct: 435 VCPACGAHAER----PEGEVV--WRCSGGLTCPAQVVERLIHFVSRDAFDIEGLGDRTIV 488

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
            F +       +R PADIF L   +     +I +  G+G VS  NL  +I  RR I L R
Sbjct: 489 EFHE----LGWLRTPADIFRLDAHE----AEIASRDGWGRVSAHNLVTAIAARRTIELSR 540

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
            I++LGIR +G   AR LA++Y S  N+  ++       +D  L L  +  +G  IA  +
Sbjct: 541 LIYALGIRRIGINNARLLARHYGSLANWRAQMEKAAVIGSDARLELGSITGIGTAIADEL 600

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
           V F+    N   ++  L  V   +   +      +  + +VFTGTL  + R +A+    +
Sbjct: 601 VAFFAEAHNRATLDD-LTHVLDHVTDEQAVAEGTLSGRTIVFTGTLTTMTRPEARAVAER 659

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           LGA VS  +S KTD++++G+  GSK  KA +LG++ M+E  +  L
Sbjct: 660 LGARVSDSVSTKTDLVVLGEKAGSKARKAAELGIRTMDEAGWRVL 704


>gi|85702769|ref|ZP_01033873.1| DNA ligase, NAD-dependent [Roseovarius sp. 217]
 gi|85671697|gb|EAQ26554.1| DNA ligase, NAD-dependent [Roseovarius sp. 217]
          Length = 866

 Score =  475 bits (1223), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 287/706 (40%), Positives = 407/706 (57%), Gaps = 47/706 (6%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+ ++AR EL+ L   ++  +  Y+    P I D+ YDALK R  AI    P L 
Sbjct: 5   IAVEDLTEDEARTELARLAALLAEANRAYHTEDAPEITDAAYDALKARNAAIEARLPALK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++  +   +++G   +    KVTH I  LSL   +   D+ +F TRI R+    DD  +
Sbjct: 65  RADSAS---DQVGAAPSDGFAKVTHRIRMLSLGNAFEAGDVAEFDTRIRRYLGLADDAPL 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE+G+ V AA RGDG  GE+V+A    I  IP  L+   PE++E
Sbjct: 122 AYTAEPKIDGLSLSLRYEQGRLVQAATRGDGEVGENVTANAHTIADIPETLT-GAPEVLE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF ALN    A   K +ANPRNAA+G LR+L+ T    R L FF +  G+
Sbjct: 181 VRGEVYMSHADFAALNARQAAKSDKSFANPRNAAAGSLRQLDATITAARPLRFFAYSWGE 240

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q   + ++  LGF  N      +    +++ Y  ++  R+TL YDIDG+VYK
Sbjct: 241 LSAPLADTQMGAIDRLAALGFQTNPLTVLCDGTEALLAQYARIEQARATLGYDIDGVVYK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 301 VDDLGLQARLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLTPVTVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMR-----GGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +++NATLHNEDYI G D+ G V+R       +DIRVGD V V RAG+VIPK+ D+ + +
Sbjct: 361 VVVSNATLHNEDYIAGRDSKGAVIRPDENGNAKDIRVGDWVQVYRAGDVIPKIADVDLTK 420

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  +A PF FP+ CP C S  VR+         A  RC GGL C AQ +E+LKHFVSR A
Sbjct: 421 RPENAAPFIFPTTCPECGSDAVREEGD------AVRRCMGGLICPAQAVEKLKHFVSRAA 474

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q++ F+   D    I+ PADIFTL+ R   + TK+ N  G+G+ SV  L++
Sbjct: 475 FDIEGLGAKQIEMFYN--DDQLPIKQPADIFTLKERDGKNLTKLANREGWGEKSVAKLFE 532

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFA--------QEINNIIAH-- 590
           +I  RR++ L RFIF+LGI +VGAE+++ LA ++ S+            Q I   I H  
Sbjct: 533 AIEARRSVELPRFIFALGIPNVGAEVSKDLANFHGSWTALVQANDDVKNQRIQTAIEHWS 592

Query: 591 -----NNDDWLSLIRVPLVGDIIAQAIVEFYQNP---RNICAVEALLKEVSPSIGRHEKN 642
                N+ +WL ++    V + + +  + F+      + +  V  LL  +   +G+    
Sbjct: 593 RINISNDTNWLEVVE---VANELREFELSFWDRLYAYKGVAGV-GLLANLRKFLGKSLTK 648

Query: 643 VSSEIENKKLVFTGTLQKIQRHK-----AQEYVTQLGAVVSAILSR 683
           VS E   K  VF  T +  +R+      A+E    LGA    +L +
Sbjct: 649 VSDEQATK--VFDATFKNTKRYSTKYEAAKEQFGSLGAFKEELLQK 692



 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 601 VPLVG--DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
           +PLVG   +   +I+ F+ N  N+ AV ++LK V P     +    S I  K +VFTGTL
Sbjct: 744 LPLVGHGQVTVDSIIRFFGNNNNVAAVNSILKYVDPKEFEKQAITDSSIYGKTVVFTGTL 803

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+     LGA V+  +S KTD++I G   GSK +KA +LG++ ++E+ +L L+
Sbjct: 804 EKMTRAEAKARAEGLGAKVAGSVSAKTDLLIAGPGAGSKAKKAAELGIETIDEDGWLALI 863


>gi|296285034|ref|ZP_06863032.1| DNA ligase [Citromicrobium bathyomarinum JL354]
          Length = 733

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 284/747 (38%), Positives = 412/747 (55%), Gaps = 78/747 (10%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E LS  +A  EL  L + I  H+  Y+    P I D EYDAL RR +A+  AFPDL R  
Sbjct: 9   EPLSEAEAANELMRLARTIRKHNRLYHAEDAPEITDQEYDALVRRNEALEAAFPDLVR-- 66

Query: 70  DPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
            P+ P   +G E+  S L KVTH++  +SL+  +N E++ +++ R+ RF   + D  I F
Sbjct: 67  -PDSPSKGVGHEVAGSPLSKVTHAVRMMSLDNAFNGEEVGEWVARVRRFLDLEVDTPIAF 125

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T E KIDG   ++RYEKG+ V AA RGDG  GEDV+A +  I  IP  L+ + P++ EVR
Sbjct: 126 TAEDKIDGLSCSLRYEKGQLVRAATRGDGQVGEDVTANVAHIADIPAQLTGDAPDVFEVR 185

Query: 189 GEVYISKNDFLALNDEMIAVGR---------------KPYANPRNAASGILRRLNPT-DI 232
           GEVY+ +  F  LN  ++   R               + +ANPRNAA+G LR+ + +   
Sbjct: 186 GEVYMERAAFADLNTRLMDEARAAASEKGEEFDPAKARQFANPRNAAAGSLRQKDASVTA 245

Query: 233 TRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIR 292
            R L F+ HG G+ S++  + Q ++++ +   G PV+    +      ++ +Y  + S R
Sbjct: 246 KRPLRFWAHGWGEASQVPGETQTDVIRAIEAFGLPVSPQFTRVEGLDALLDHYETIASAR 305

Query: 293 STLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGIL 352
             LPY+IDG+VYKVD    Q++LG  A++PRW ++HKF  ++A T L  IDIQ+GRTG L
Sbjct: 306 PDLPYEIDGVVYKVDRLDWQERLGFVAKAPRWALAHKFPAERAETTLEAIDIQVGRTGKL 365

Query: 353 TPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPK 412
           TPV RL PV +GG  +TN TLHN D I  L            +RVGDRVL++RAG+VIP+
Sbjct: 366 TPVGRLAPVLVGGVTVTNVTLHNRDEIARL-----------GLRVGDRVLIQRAGDVIPQ 414

Query: 413 VVDIIVNERHPDAQ--PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLE 470
           VV+ +     PDAQ   F FP  CP C S  V + +          RCTGGL C AQ+LE
Sbjct: 415 VVENLT----PDAQRERFEFPETCPECGSEAVAEEDE------VDVRCTGGLICPAQRLE 464

Query: 471 RLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGF 530
           R+KHFVSR A +IEG+G++ +  F +       +  PADIF L++R+     +I  + G+
Sbjct: 465 RMKHFVSRGALDIEGMGEKTIAEFLER----GWLESPADIFRLRKRRD----EILALEGW 516

Query: 531 GDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF---AQEINNI 587
            D SV NL  +I  +R     R +F LGIRHVGA  AR L K     +     A E +  
Sbjct: 517 QDKSVDNLLAAIEAKRAPDAARLLFGLGIRHVGAVTARDLLKGLGDIRKLPGKAAEFHRY 576

Query: 588 IAHN---NDDWLSL--------------IRVPLVGDIIAQAIVEFYQNPRN------ICA 624
              N    D+ +S               +R   +G  +  A+ +F+    N      +  
Sbjct: 577 RIENPRGEDEKVSPFNARMLDAVRRIYEVRADGIGTAVGHALADFFHEEHNRQVWDDLIG 636

Query: 625 VEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRK 684
            E    EV P +   E  V S +  K +VFTG L+ + R +A+    +LGA  +  +S K
Sbjct: 637 AEPGAGEVDPPVYEVE-TVESPVAGKTVVFTGKLETMSRDEAKAQAERLGAKAAGSVSAK 695

Query: 685 TDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           TD+++ G   GSKL+KA++LG+++++E
Sbjct: 696 TDLLVAGPGAGSKLKKAEELGIEVIDE 722


>gi|296532809|ref|ZP_06895486.1| NAD-dependent DNA ligase LigA [Roseomonas cervicalis ATCC 49957]
 gi|296266870|gb|EFH12818.1| NAD-dependent DNA ligase LigA [Roseomonas cervicalis ATCC 49957]
          Length = 719

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 293/739 (39%), Positives = 422/739 (57%), Gaps = 60/739 (8%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           +P+ AL+  QA +EL++L Q I+  D  Y+Q   P+I D+EYDAL+RR  AI   FP L 
Sbjct: 8   LPVTALTEAQAAEELAALAQAIAEADLAYHQQDAPVITDAEYDALRRRNAAIEARFPALK 67

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R++ P+            +  +  H  P LSL+  +  ED  +F   I RF +  +   +
Sbjct: 68  RADSPSDASPGAAPAAGFAKAR--HGTPMLSLDNAFAPEDFLEFTKSIRRFLRLDEAELL 125

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIP--TIPRVLSLNIPEI 184
            F  EPKIDG  + + YE G FV  A RGDG  GED++  +       +PR L+   PE 
Sbjct: 126 RFVAEPKIDGLSVNLTYENGVFVRGATRGDGTEGEDITRNLETFSDKNLPRRLAAPFPEQ 185

Query: 185 IEVRGEVYISKNDFLALNDEMIA--------------VG---RKPYANPRNAASGILRRL 227
           IE+RGEV+++K DF+A  DE                 VG   R P ANPRNAA+G LR+L
Sbjct: 186 IEIRGEVFMTKADFIAFRDEQARLAEEREQRRERGEKVGPEIRIP-ANPRNAAAGSLRQL 244

Query: 228 NPTDITRY--LNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYY 285
           +P +ITR   L  F +  G++S   A+     L ++   GF VN   R     H   ++ 
Sbjct: 245 DP-EITRQRPLRLFAYAQGESSAPVAETHSGYLARLAEWGFDVNPLSRALPDEHAAEAFQ 303

Query: 286 NEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQ 345
            EM + R+ L YDIDG+VYK+D    Q +LG   R+PRW I+ KF  +QA TRLLDI IQ
Sbjct: 304 AEMAAQRAGLAYDIDGVVYKLDRLDWQARLGFVGRAPRWAIAWKFPAEQAMTRLLDIQIQ 363

Query: 346 IGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKR 405
           +GRTG LTP A ++PVN+GG ++ +ATLHNED I             +D+R+GD V+++R
Sbjct: 364 VGRTGALTPRAVMQPVNVGGVMVQHATLHNEDEI-----------ARKDVRIGDTVILQR 412

Query: 406 AGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACS 465
           AG+VIP++V I+  +R  +A PF+FP+ CP C S  VR      G++V   RCTGGL C 
Sbjct: 413 AGDVIPQIVGIVPEKRPAEAVPFAFPTTCPACGSHAVR----PEGEVV--RRCTGGLICP 466

Query: 466 AQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIE 525
           AQ +ERLKHFV R A +IEGLG++ +    +  +    ++ PADIF L R  +    ++ 
Sbjct: 467 AQTVERLKHFVGRTAMDIEGLGEENI---LRLHEEGL-VKSPADIFRLHRHAE----RMR 518

Query: 526 NILGFGDVS-----VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF 580
              G+G  +     V NL  +I  RRN  LERFIF+LGIR +GA+ A+ LA++Y S   +
Sbjct: 519 GWEGWGKGAKTSKKVDNLLAAIEARRNPPLERFIFALGIRRIGAQNAKLLARHYHSLAEW 578

Query: 581 AQEI--NNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR 638
             ++    II     + L  I+   VG  IA  + EF+   RN  A++ L +EV+P    
Sbjct: 579 RAKMLAATIIGSEAREELGSIQG--VGPAIATELAEFFAEQRNRDALDDLAREVTPQDAE 636

Query: 639 HEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKL 698
             ++  S    K +VFTGTL++  R +A+    +LGA V+  +S+KTD ++VG + GSK 
Sbjct: 637 RLES-DSPFAGKVVVFTGTLERSSRDEAEAVADRLGAKVTKSVSKKTDFVVVGADAGSKA 695

Query: 699 EKAQQLGVKIMNEEQFLFL 717
           +KA +LGV+ + E ++  L
Sbjct: 696 KKAAELGVRTLTEPEWRAL 714


>gi|89094416|ref|ZP_01167356.1| DNA ligase [Oceanospirillum sp. MED92]
 gi|89081308|gb|EAR60540.1| DNA ligase [Oceanospirillum sp. MED92]
          Length = 674

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 278/723 (38%), Positives = 423/723 (58%), Gaps = 67/723 (9%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SIEQ    L  L  ++++H+  YY    P + D+EYD L R    +    P+L  +ED 
Sbjct: 1   MSIEQ---HLQQLRDQLNHHNYQYYVLDDPEVPDAEYDRLFRELKKLESDNPELI-TED- 55

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
             P  ++G     +  +V+H +P LSL+  +N ED+ +F  RI      ++  +I +  E
Sbjct: 56  -SPTQRVGSTPLSAFSQVSHELPMLSLDNAFNDEDMEEFDRRIKDRLNMQE--TISYACE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGE 190
           PK+DG  +++ YE+G  V  A RGDG +GED++  +R IPTIP ++   N P+ +EVRGE
Sbjct: 113 PKLDGIAVSLLYEQGLLVRGATRGDGSTGEDITQNVRTIPTIPLKLTGDNFPDRLEVRGE 172

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-------PTDITRYLNFFVHG- 242
           +Y+ K  F ALND+  A G+K + NPRNAA+G LR+L+       P ++  Y    V G 
Sbjct: 173 IYMPKAGFDALNDKARATGQKTFVNPRNAAAGSLRQLDSRITASRPLEMCSYSVGVVEGG 232

Query: 243 --LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
              GK SEI A+        ++  GF +N  +       G + YY  +  +R TLPY+ID
Sbjct: 233 ALAGKHSEILAQ--------LKEWGFRLNPLLESVEGVAGCLDYYRRISELRDTLPYEID 284

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+V+KVD+  LQ++LG  +R+PRW I+HKF  ++  T +  I+ Q+GRTG +TPVARLEP
Sbjct: 285 GVVFKVDQLELQQRLGFVSRAPRWAIAHKFPAQEELTSIRSIEFQVGRTGAVTPVARLEP 344

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG  ++NATLHN D I+ L           D+R GD V+++RAG+VIP+VV ++  +
Sbjct: 345 VFVGGVTVSNATLHNMDEIERL-----------DVRAGDTVVIRRAGDVIPQVVRVLHEK 393

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  D +    P  CPIC+S++ R      G+ VA  RC+GGL C AQ+ E LKHF SR A
Sbjct: 394 RPADTEAVIIPDACPICESKIER----IEGEAVA--RCSGGLYCEAQRKEALKHFASRKA 447

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +I+GLG + ++     +     +  PAD++ L   QQT   ++E +   G  S  NL +
Sbjct: 448 MDIDGLGDKLIEMLVDLD----MVHNPADLYAL---QQTELARLERM---GPKSAENLVN 497

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +I   RN  L RF+++LGIR VG   ARSLA ++L       ++  +I  + +   +L+ 
Sbjct: 498 AIQASRNTELPRFLYALGIREVGEATARSLAMHFL-------DLPALIEASEE---ALLE 547

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTL 658
           VP VG I+A+ I  F+Q   NI  ++AL ++  VS S+   +   S  I  +  V TG L
Sbjct: 548 VPDVGPIVAKHIKSFFQQSHNIEVLDALREKAGVSWSVLETKDEESQPISGETWVLTGKL 607

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL-FL 717
           +++ R +A+ Y+ +LGA V+  +S KTD ++ G   GSKL+KA +LG+K M+E+ F+ FL
Sbjct: 608 EQMGRSEAKNYLLELGAKVAGSVSAKTDCVVAGPGAGSKLKKATELGIKTMDEDSFVSFL 667

Query: 718 LQQ 720
            +Q
Sbjct: 668 AEQ 670


>gi|254456450|ref|ZP_05069879.1| DNA ligase, NAD-dependent [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083452|gb|EDZ60878.1| DNA ligase, NAD-dependent [Candidatus Pelagibacter sp. HTCC7211]
          Length = 676

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 269/711 (37%), Positives = 423/711 (59%), Gaps = 49/711 (6%)

Query: 18  RKELSSLEQE----ISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +KE+  L QE    ++ ++  YY  +KP+I D  YD LK    ++   +  LA  + P+ 
Sbjct: 3   KKEIQKLYQEKIKLLNKYNQYYYDKNKPLIDDKNYDELKISILSLEKKYNFLASKKSPSE 62

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
                G + + +  K  H +P LSL   ++ EDL  F  +I  F  + ++  ++++ EPK
Sbjct: 63  I---TGYKPSKNFKKSAHKVPMLSLANAFSEEDLINFEKKILNFLSENENFKLYYSAEPK 119

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVRGEVY 192
           IDG   ++ Y+ GKFV    RGDG  GED+++ +  I  IP+ +S  N PE I++RGEV+
Sbjct: 120 IDGISASLTYKNGKFVKGLSRGDGKEGEDITSNLETIKDIPKKISNKNFPEEIDIRGEVF 179

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSEIFA 251
           I  +DF    D+        +ANPRNAASG LR+ +P D ++  L F  +  G   ++  
Sbjct: 180 IKNSDFENFKDK--------FANPRNAASGSLRQKDPNDTSKIPLKFIAYTFGYEKKLNI 231

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
             Q++ L+++   GF  N   +  +    ++  YNE++  R+ + +DIDG+VYKV+ F L
Sbjct: 232 DNQFDFLKRLNEWGFKTNPLNKLISGVKNLLINYNEIEKKRAEIDFDIDGIVYKVNNFKL 291

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           QK+LG  A +PRW ++HKF+  +A ++++ IDIQIGRTG LTPVA+++PVNIGG  ++NA
Sbjct: 292 QKRLGNVANAPRWAVAHKFSSNKAVSKIISIDIQIGRTGALTPVAKIKPVNIGGVQVSNA 351

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHNED         ++MR  +D+RVGD V+V+RAG+VIP ++ + +N+R   +  F FP
Sbjct: 352 TLHNED---------EIMR--KDVRVGDTVVVERAGDVIPHILTVDINKRSKKSIKFVFP 400

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTG-GLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
             CP C S+  ++ N  T K  A  RCT  G  C    +E+LKHFVS++AFNIEGLGK+ 
Sbjct: 401 KKCPSCGSKTTKEYNEITKKNDAVRRCTSEGYECEKISIEKLKHFVSKEAFNIEGLGKKI 460

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F+K +     IR+P DIF L         +IEN+ G+G +SV NL  SIN+++NISL
Sbjct: 461 IENFWKLK----LIRLPQDIFRLD------YNRIENLEGWGRLSVENLKYSINEKKNISL 510

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           ER I++LGIRH+G E A+ L+K++ ++ NF +        N  ++  L+ V  +G+    
Sbjct: 511 ERLIYALGIRHIGLENAKLLSKFFKTFSNFKE------LSNKSNYNDLLNVDKIGETQVS 564

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +I  F+ N  N   +  L KE+S      EK  +  ++N   + TG L  I R + +  +
Sbjct: 565 SIKSFFSNKINNEIINQLSKELSIKNTLIEKK-NGLLKNYTFMITGKLSGISRAEIKSLI 623

Query: 671 TQ-LGAVVSAILSRKTDIIIVGDNPGS-KLEKAQQLGVKIMNEEQFLFLLQ 719
            +  G+ VS++ ++K D +I+GD P   K+E A++L +KI+N+ QFL +L 
Sbjct: 624 EENSGSTVSSV-TKKLDYLIIGDKPTKRKIETAKELRIKIINQSQFLKMLN 673


>gi|78485583|ref|YP_391508.1| DNA ligase, NAD-dependent [Thiomicrospira crunogena XCL-2]
 gi|123741582|sp|Q31G89|DNLJ_THICR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78363869|gb|ABB41834.1| DNA ligase, NAD-dependent [Thiomicrospira crunogena XCL-2]
          Length = 672

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 269/714 (37%), Positives = 410/714 (57%), Gaps = 50/714 (7%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           Q +K    L + ++ H   YY    PII D +YD L ++   I    PD      P  P 
Sbjct: 2   QDQKAYQKLVESLNQHSYQYYVLDDPIISDPQYDVLYQKLLRIEDEHPDWIL---PESPS 58

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            +IG E       V H++P  SL+  +  ++L+ F+ RI    +  D  S+ F+ EPK+D
Sbjct: 59  QRIGDEPLKEFHTVRHAVPMYSLDNAFEDDELKSFLKRIEE--KLPDQKSLAFSAEPKMD 116

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYIS 194
           G  I IRYE G+ V A  RGDG  GEDV+  IR I ++P ++   N PE++EVRGEV++S
Sbjct: 117 GLAINIRYENGQLVQATTRGDGQVGEDVTHNIRPIYSVPLKLFGNNWPEVVEVRGEVFMS 176

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKG 253
           K+ F  LN+    +G K +ANPRNAA+G LR+L+      R+L+FF++G G+ S+ +   
Sbjct: 177 KSAFEQLNEHQQEIGGKIFANPRNAAAGSLRQLDSKVAAKRHLSFFLYGWGELSDDWQLP 236

Query: 254 QY--EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
           QY  EM++++   G P N      +   G+ +YY ++++ RS LPY+IDG+VYK+++  L
Sbjct: 237 QYYSEMIEQLVEWGLPANPQSEIISGLEGMFAYYEKIQAKRSELPYEIDGIVYKLNDIKL 296

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q+QLG  AR+PRW I+ KF  ++  T+LLDI++Q+GRTG +TPVARL+PV++GG +++NA
Sbjct: 297 QQQLGFTARAPRWAIARKFPAEEVWTKLLDIEVQVGRTGAITPVARLQPVSVGGVIVSNA 356

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D IK            +D+R+GD V+V+RAG+VIP+VV  I+ +R  + Q F  P
Sbjct: 357 TLHNMDEIK-----------RKDVRIGDTVIVRRAGDVIPEVVGPILTQRPENTQLFEMP 405

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
             CP C S VV++L+       A  RCTGGL C AQ+   L HFVSR A +I+GLG + +
Sbjct: 406 QHCPECGSDVVKELDK------AVFRCTGGLVCPAQRKRALHHFVSRKAMDIQGLGDKLI 459

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           D      D  + ++ P D + L      +  K+  +    + S  N+   I      +L 
Sbjct: 460 DQLV---DKGW-VKHPDDFYHL------TVEKLATLERMAEKSAQNVITGIQASLETTLA 509

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQ-EINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           +FI+SLGI  VG   A++LA ++       Q E   +I  N+           VG+++A+
Sbjct: 510 KFIYSLGIPEVGEVTAKNLANHFKDLNAIKQAEFEELITLND-----------VGEVVAE 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            IV F++ P N   ++ LL      P+      N  S   NK +V TGTL ++ R +A+ 
Sbjct: 559 HIVNFFKEPHNESVIQGLLDAGMHWPTPETTLVNEDSPFANKVVVLTGTLSEMSRPEAKV 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
            +   GA ++  +S KTD +I G+  GSKL KA+ LGV +++E ++L ++ Q +
Sbjct: 619 LLEAQGAKITGSVSAKTDYVIAGEKAGSKLTKAESLGVAVLSEAEWLAMMPQQD 672


>gi|145589636|ref|YP_001156233.1| DNA ligase, NAD-dependent [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|190359270|sp|A4SYV5|DNLJ_POLSQ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145048042|gb|ABP34669.1| DNA ligase, NAD-dependent [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 671

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 275/701 (39%), Positives = 405/701 (57%), Gaps = 50/701 (7%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ E++  +  YY    P++ D EYD L R    I  A P    SE  +    ++GG   
Sbjct: 16  LQAELARLEHAYYVLDNPLLPDIEYDRLYRELLDIEAAHPQWVTSESLS---QRVGGTAL 72

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
                VTH++P LSL   +   +L  F  R       +    + +  E K DG  I++RY
Sbjct: 73  KEFDSVTHAVPMLSLNNAFEDSELIAFDRRCREALHVE---HVAYAGELKFDGLAISLRY 129

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALN 202
           E G  V AA RGDG SGEDV+A I+ I  IP ++   NIPEI+EVRGEV++   DF  +N
Sbjct: 130 ENGTLVTAATRGDGASGEDVTANIKTIRAIPLKLTGKNIPEILEVRGEVFMYLKDFEKMN 189

Query: 203 DEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG--KTSEIFAKGQYEML 258
            +   +G K +ANPRNAA+G LR+L+ + IT  R L+FF +GLG  +      K   E+L
Sbjct: 190 RQAAELGEKEFANPRNAAAGSLRQLD-SKITAKRPLSFFAYGLGALEPQSWLPKTHEELL 248

Query: 259 QKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGER 318
                LG PV +  R  ++   I+++YNE+ + R +LPYDIDG+VYKV+ F+ Q +LG  
Sbjct: 249 NAYVELGLPVCSERRVLHSVEEILAFYNEIGAKRDSLPYDIDGVVYKVNSFAEQAKLGFV 308

Query: 319 ARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDY 378
           +R+PR+ ++HK+  ++A T +L ID+Q+GRTG +TPVARL PV +GG  +TNATLHNED 
Sbjct: 309 SRAPRFALAHKYPAQEALTTVLGIDVQVGRTGAITPVARLAPVEVGGVTVTNATLHNEDE 368

Query: 379 IKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQ 438
           +K            +D+R+GD V V+RAG+VIP+VV +I   R  DA+ F  PS CP+C 
Sbjct: 369 VK-----------RKDVRIGDTVSVRRAGDVIPEVVSVIKERRPSDAKEFVMPSRCPVCD 417

Query: 439 SRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSE 498
           S + R  +       A  RC+GGL C AQ+ + L HF  R A +IEGLG++ +D      
Sbjct: 418 SHIERLADE------AVARCSGGLFCGAQRKQALIHFAHRRALDIEGLGEKIVDQLVDQN 471

Query: 499 DPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLG 558
                +R PAD++ L        T + N+   G+ S  NL  +IN+ RN +L RFIF+LG
Sbjct: 472 ----LVRTPADLYRL------GFTALANLERMGEKSADNLIQAINQSRNTTLARFIFALG 521

Query: 559 IRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQN 618
           IRHVG   A+ LA +Y       Q ++ ++  + ++ L+   V  VG ++A +I  F Q 
Sbjct: 522 IRHVGETTAKDLANHY-------QSMHALMDASVEELLT---VKDVGPVVADSITSFMQE 571

Query: 619 PRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678
             N   +E LL      +   EK +S+ +  K  V TGT   + R +A++ + + GA V+
Sbjct: 572 AHNREVIEQLLAS-GMQLSVEEKIISAAVFGKTFVLTGTFPTMTRDEAKDLLEKAGAKVA 630

Query: 679 AILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +S+KTD ++ G + GSKL KA++LGV +++EE+ L LL+
Sbjct: 631 GSVSKKTDYVVAGTDAGSKLAKAEELGVPVIDEEEMLNLLK 671


>gi|262276434|ref|ZP_06054243.1| DNA ligase [Grimontia hollisae CIP 101886]
 gi|262220242|gb|EEY71558.1| DNA ligase [Grimontia hollisae CIP 101886]
          Length = 670

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 264/707 (37%), Positives = 415/707 (58%), Gaps = 46/707 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           +++L SL+ +++YH   YY   KP + D+EYD + +   AI    P+L  ++ P+    +
Sbjct: 6   QQKLQSLKTQLNYHGHLYYVEDKPELPDAEYDRMMQELLAIEAKHPELVTADSPS---QR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +GG    +  +V H IP LSL+  ++  +L  F  R+       +     F+ EPK+DG 
Sbjct: 63  VGGAPLGAFEQVRHEIPMLSLDNAFDDGELEAFEKRLRDRLNTTE--RFVFSCEPKLDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKN 196
            +++ YE G  V AA RGDG  GE+++  +R I  +P +L     P  +EVRGEV++ K+
Sbjct: 121 AVSLMYENGVLVQAATRGDGTVGENITHNVRTIRNVPLLLQGEGWPVRLEVRGEVFMPKD 180

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQY 255
            F ALN++ I  G K +ANPRNAA+G LR+L+P    TR L F+ + +G  SE F     
Sbjct: 181 GFEALNEKNIKKGEKTFANPRNAAAGSLRQLDPKITATRPLRFYAYSVGVMSEAFGDSHV 240

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
             L++++  G P++  V++ +    + +YY ++ + R+ LPY+IDG+V KVD    Q++L
Sbjct: 241 GRLEQLKQWGIPLSPEVKKVDGLENVKAYYQDIAARRNDLPYEIDGVVIKVDNIDTQERL 300

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  ++NATLHN
Sbjct: 301 GFVARAPRWAIAYKFPAQEEITVLQDVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLHN 360

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I  L            +++GD V+++RAG+VIP++V ++ + R  DA+   FP  CP
Sbjct: 361 ADEIARL-----------GVKIGDTVIIRRAGDVIPQIVSVVESRRPDDAKEVVFPHECP 409

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           +CQS+V R      G+ VA  RCTGGL C AQ+ E +KHF SR A +I+GLG + ++   
Sbjct: 410 VCQSQVER----VEGEAVA--RCTGGLICRAQRKEAIKHFSSRKALDIDGLGDKIVEQLI 463

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
           + E     I+ PAD+F L   Q T   ++      G  S  NL D+++K +  +L RFI+
Sbjct: 464 EKE----LIKTPADLFKLTAGQVTMLDRM------GPKSAQNLVDALSKAKETTLPRFIY 513

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           SLGIR VG   A +LA ++ +++   +               LI V  VG I+A+ +V F
Sbjct: 514 SLGIREVGEATAANLANHFFTFEAIREATEE----------QLIEVQDVGVIVAKHVVNF 563

Query: 616 YQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           +    N   ++ALL      P+I + ++N    +  K +V TGTL ++ R+ A+  +  L
Sbjct: 564 FNEEHNKTVIDALLACGITWPAIEQPDENKPQPLAGKTVVLTGTLSQMSRNDAKAALQAL 623

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           GA V+  +S KTD++I G+  GSKL KAQQLG++I++E+  + LL +
Sbjct: 624 GAKVTGSVSAKTDLLIAGEAAGSKLTKAQQLGIEIVDEDGMMRLLSR 670


>gi|217970592|ref|YP_002355826.1| DNA ligase, NAD-dependent [Thauera sp. MZ1T]
 gi|217507919|gb|ACK54930.1| DNA ligase, NAD-dependent [Thauera sp. MZ1T]
          Length = 693

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 273/703 (38%), Positives = 396/703 (56%), Gaps = 51/703 (7%)

Query: 31  HDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVT 90
           HD  YY    P I D+EYD L R   AI  A+P L RS D   P  ++GG+       V 
Sbjct: 30  HDHAYYVLDAPTIPDAEYDRLFRELQAIERAYPAL-RSAD--SPTQRVGGKALAQFATVR 86

Query: 91  HSIPTLSLEKIWNIEDLRKFI--TRIYR-FWQKKDDNSIFFTLEPKIDGTMITIRYEKGK 147
           H +P LS+    + E    F    R+ R     +DD ++ +  E K DG  I++RYE G 
Sbjct: 87  HRVPMLSISTETDTEASGAFAFDARVRRALGLDEDDAAVAYAAELKFDGLAISLRYEDGV 146

Query: 148 FVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIA 207
            V AA RGDG +GEDV++ +R +  IP  L    P ++EVRGE+Y+ ++DF  LN     
Sbjct: 147 LVQAATRGDGETGEDVTSNVRTVKAIPLRLLGEAPPVLEVRGEIYLRRDDFERLNARQAE 206

Query: 208 VGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSE-IFAKGQYEMLQKMRCLG 265
            G K + NPRNAA+G +R+L+P    R  L+F+ +GLG+ +       Q E+L  +   G
Sbjct: 207 AGEKIFVNPRNAAAGSIRQLDPGIAARRPLSFYAYGLGEVAGWTLPATQTEVLDALAAFG 266

Query: 266 FPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWM 325
            PV     Q     G+ +++  + ++R TLP+DIDG+VYKVD  +LQ+QLG   R PRW 
Sbjct: 267 LPVCGHRAQVRGAEGLAAFHARIGALRDTLPFDIDGVVYKVDALALQQQLGFVTREPRWA 326

Query: 326 ISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDAS 385
           ++HK+  ++A T L DI++Q+GRTG LTPVARLEPV +GG  +TNATLHN+D I      
Sbjct: 327 VAHKYPAQEAVTLLRDIEVQVGRTGALTPVARLEPVFVGGVTVTNATLHNQDEID----- 381

Query: 386 GKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF----SFPSFCPICQSRV 441
                  +D+R+GD V+V+RAG+VIP+VV  I+  R  +   F     FP+ CP+C S V
Sbjct: 382 ------RKDVRIGDWVIVRRAGDVIPEVVAPILERRGGELPRFVLLDRFPT-CPVCGSHV 434

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
           VR      G+  A  RCTGGL C AQ+ + L HF  R A +IEGLG + +D        A
Sbjct: 435 VR------GEDEAVARCTGGLFCPAQRKQALLHFAGRRAMDIEGLGDKLVDQLVD----A 484

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             ++ P D++ L          + N+   G+ S  NL  +I K R  +L RFIF+LGIR+
Sbjct: 485 AIVKTPVDLYRL------GVLALANLERMGEKSAQNLLMAIEKSRGTTLARFIFALGIRN 538

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           VG   AR LA+++        +++ +IA + D   +L +VP VG I+A+ I EF+  P N
Sbjct: 539 VGEATARDLARHF-------GKLDALIAADVD---ALQQVPDVGPIVAKCIAEFFAEPHN 588

Query: 622 ICAVEAL-LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
              +E L    V  + G  + +V+  +  K  V TGTL  + R +A+  +   G  V+  
Sbjct: 589 REVIEQLRAAGVHWAEGEPQGSVAGALAGKTFVLTGTLPTLSRDEAKARIEARGGKVAGS 648

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
           +S+KT  ++ G   GSKL+KAQ LG+ I++E+    LL + +T
Sbjct: 649 VSKKTHYVVAGAEAGSKLDKAQALGLAILDEDGLRVLLNETDT 691


>gi|90416525|ref|ZP_01224456.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2207]
 gi|90331724|gb|EAS46952.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2207]
          Length = 677

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 270/719 (37%), Positives = 410/719 (57%), Gaps = 58/719 (8%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +EQ R E   L+ E++ H+  YY   +P I DSEYD   RR   I    P+L   + P+ 
Sbjct: 5   LEQVRAEYEQLKDELNQHNHRYYVLDEPTIPDSEYDRSMRRLQDIEQQHPELLSDDSPS- 63

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
              ++GG    S  +V+H++P LSL+  ++ E+L  F  RI      KDD  I +  EPK
Sbjct: 64  --QRVGGAALPSFSQVSHAVPMLSLDNAFSEEELEAFDRRISDRLNYKDDQQIDYVCEPK 121

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ Y +G  V  A RGDG  GED++A +R I +IP R+    IPE++EVRGE+Y
Sbjct: 122 LDGVAVSLLYNQGLLVRGATRGDGKVGEDITANVRTINSIPLRLNGDGIPELLEVRGEIY 181

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F  +N   IA G KP+ NPRNAA+G LR+L+     +R L    + +G+    F 
Sbjct: 182 LPRGGFDKINAAAIAKGDKPFVNPRNAAAGSLRQLDSKITASRPLEMCAYSVGQ----FQ 237

Query: 252 KGQ-----YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
            G+       ML+ +   GF +N  V          +YY  M+  R  LPYDIDG+VYKV
Sbjct: 238 GGETPDSHLNMLKALGSWGFKINTYVEAVQGIAACEAYYERMQKRRDQLPYDIDGIVYKV 297

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++  LQ++LG  A++PRW I+ KF  ++  T+L+D++ Q+GRTG LTPVARL PV +GG 
Sbjct: 298 NDLGLQQRLGFVAKAPRWAIARKFPAQEEMTQLVDVEFQVGRTGALTPVARLAPVFVGGV 357

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHN D I  L            + +GD V+++RAG+VIPKV  ++++ R  +AQ
Sbjct: 358 TVSNATLHNGDEIARL-----------GLCIGDTVIIRRAGDVIPKVAAVVLDRRPENAQ 406

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P  FP  CP+CQS V R      G+ VA  RC+GGL C AQ  E +KHF SR A +I+GL
Sbjct: 407 PIVFPENCPVCQSSVRR----VEGEAVA--RCSGGLFCGAQSKEAIKHFASRKAMDIDGL 460

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + ++      D    I  PAD++ L      S TKI ++   G+ S  NL DSI   R
Sbjct: 461 GDKLVELLV---DRGL-IYSPADLYEL------SATKIADLERMGEKSAQNLIDSIAVSR 510

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
             +L +F+F+LGIR VG    ++LA+ + S       +  II    D   +L+ V  +G 
Sbjct: 511 QTTLAKFLFALGIREVGEATGQTLARNFGS-------LEAIIEAEQD---ALLEVDDIGP 560

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE----IENKKLVFTGTLQKIQ 662
           ++A  I +F++NP N+  + AL +     +   + +++++    ++ +  V TG ++ + 
Sbjct: 561 VVAYYIRDFFRNPDNLSIINALRES---GVSWDDIDITAQDSQPLKGQTWVLTGGMEIMS 617

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           R +A++ + +LGA V+  +S KT  ++ G   GSKL KAQ L + + +EEQFL  L+ +
Sbjct: 618 RAEAKDRLQELGAKVAGSVSAKTSQVVAGPGAGSKLTKAQSLDIPVFDEEQFLAFLEGH 676


>gi|254468809|ref|ZP_05082215.1| DNA ligase, NAD-dependent [beta proteobacterium KB13]
 gi|207087619|gb|EDZ64902.1| DNA ligase, NAD-dependent [beta proteobacterium KB13]
          Length = 669

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 267/707 (37%), Positives = 417/707 (58%), Gaps = 49/707 (6%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           K++S L+  I  HD CYY    P I D EYD+L R    I  + P+L     P+ P  ++
Sbjct: 7   KKISYLKSVIQEHDHCYYVLDDPQISDHEYDSLLRELKNIEDSNPELIT---PDSPTQRV 63

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           GG       ++ H+ P LSL   + I +L  F  RI       D N + F  E K DG  
Sbjct: 64  GGSPISEFNQIQHNKPMLSLGNAFGINELEAFNKRINDTL---DVNDVEFNAELKFDGLA 120

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKND 197
           +TI YE G   YAA RGDG+ GEDV+  I+ I TIP ++   N P   EVRGEV + KND
Sbjct: 121 VTILYENGLMKYAATRGDGNVGEDVTHNIKTIKTIPLKLYGDNHPRTFEVRGEVLMDKND 180

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IFAKGQY 255
           F  LN+  I++G+K +ANPRNAA+G LR+L+P     R L F+ + LG+  + +      
Sbjct: 181 FKELNEYQISLGQKTFANPRNAAAGSLRQLDPKITAKRKLKFYAYSLGQVDQDLELTNHT 240

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           ++L+ +   G P+++  ++    + +  +Y ++   R+ LP+DIDG+VYKV+    Q+ L
Sbjct: 241 DILKYIHNSGIPISSYSQRVVGINQMQHFYEDILKKRNDLPFDIDGIVYKVNSIKNQENL 300

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  +++PRW I++KF  ++A T + DI++Q+GRTG++TPVARL+PV + G  +TNATLHN
Sbjct: 301 GYVSKAPRWAIAYKFPAEEAETVVNDINVQVGRTGVITPVARLQPVFVSGVTVTNATLHN 360

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
           ED         +++R  +DIR+GD V+V+RAG+V+P++V +I  +R  +A+ F  P +CP
Sbjct: 361 ED---------EMLR--KDIRIGDSVIVRRAGDVVPEIVRVIKEKRPSNAKVFEMPQYCP 409

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           IC S+V+R      G+  AA RCTG L C AQ  + + H+VSR A NIEGLG + +D FF
Sbjct: 410 ICNSQVIR----IDGE--AAQRCTGQLKCEAQAKQAISHYVSRKAMNIEGLGAKIIDHFF 463

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
           +       I+  +DI+ L   +      I+ + GFG+ S  NL ++I   +  +L +FI+
Sbjct: 464 EKG----LIKNISDIYHLDYEE------IQKMEGFGERSAENLKEAIESSKKTTLAKFIY 513

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR+VG   ++ + K   +       ++N++  + DD+L    +  VG ++AQ++ +F
Sbjct: 514 ALGIRNVGEATSKDIVKKLGT-------LDNVMKASIDDFL---EINDVGPVVAQSLHQF 563

Query: 616 YQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKIQRHKAQEYVTQL 673
           +Q   N   +  ++ E         +NVS++  +  +  V TGTL+   R + +E +   
Sbjct: 564 FQEDENKAIINNIV-EFGVKWEDQAQNVSNDQKLNQQTFVVTGTLENFSRDEIKELIENN 622

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           G  VS  +S+KT  +I+GDNPGSK +KA +LGVK++NE+Q + LL +
Sbjct: 623 GGKVSGSVSKKTSYVIIGDNPGSKADKAAELGVKVINEKQLMELLNE 669


>gi|307261779|ref|ZP_07543445.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306868597|gb|EFN00408.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 676

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 268/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 11  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 67

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 68  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 126

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 127 SILYVDGVLSQAATRGDGTTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 186

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
             LN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 187 ETLNERALEKGEKTFANPRNAAAGSLRQLDP-KITRQRPLVLNAYGIGVYESDDELPVTH 245

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 246 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 305

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 306 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 365

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 366 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 414

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 415 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 468

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G+ S  N  +SI K +N +L RF+
Sbjct: 469 MERE----LVHTPADLFKL---EHTTLMRLERM---GEKSAQNALNSIEKAKNTTLARFL 518

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 519 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 568

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H +NV       + ++ K +V TGTL ++ R +A+ 
Sbjct: 569 FWQEPHNVAVVEDLI-----SQGVHWQNVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 623

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 624 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLTEQEFIAL 672


>gi|190570889|ref|YP_001975247.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019404|ref|ZP_03335210.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|254782310|sp|B3CPS1|DNLJ_WOLPP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190357161|emb|CAQ54574.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994826|gb|EEB55468.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 651

 Score =  468 bits (1205), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 285/695 (41%), Positives = 413/695 (59%), Gaps = 62/695 (8%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ +I+YH+  YYQ SKP I D+EYD LK++  AI    P+   ++D       +G   +
Sbjct: 11  LQNQINYHNILYYQKSKPEISDAEYDELKKKLAAIE---PEAYATQDS------VGAPPD 61

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H  P LSLE  ++ + + KF+++I RF      + I    EPKIDG   +  Y
Sbjct: 62  ERFSKVEHQEPMLSLENAYDEQGVEKFLSKIKRFLIA---DEIEILCEPKIDGLSFSAIY 118

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E GKFV AA RGDG  GEDV+  +  I   P+ L  ++   +EVRGE+YIS +DFL LN+
Sbjct: 119 EDGKFVKAATRGDGFVGEDVTHNVATIKGFPKFLQ-DVQGRLEVRGEIYISNSDFLKLNE 177

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAKGQYEMLQKM 261
                    +ANPRNAA+G L++LN  +IT  R L +F + L    E   K Q E+L+K+
Sbjct: 178 ------NNEFANPRNAAAGSLKQLN-ANITAKRPLRYFAYSLIGGIE---KSQSEVLEKL 227

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
             LGF VN      ++ +G++ +YNE+   R  L YDIDG+VYKV++  LQ +LG   ++
Sbjct: 228 EKLGFCVNEHRSLTSSLNGMLKFYNEIYDCRYNLDYDIDGIVYKVNDLVLQSRLGSTHKA 287

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PR  +++KF+   A T+L  I IQ+GRTG+LTPVA L PVNIGG L++ A+LHN+D IK 
Sbjct: 288 PRSALAYKFSAIYAKTKLNKIFIQVGRTGVLTPVADLVPVNIGGVLVSRASLHNQDEIK- 346

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRV 441
                      +DIR GD V +KRAG+VIP++V +    RH +   F FP  CP C S+V
Sbjct: 347 ----------RKDIREGDVVTIKRAGDVIPQIVKVDEGSRHTNMPEFVFPDICPECGSKV 396

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
             +          A RC     C AQ +E+LKHFVS+DAF+I GLG++Q+ FF+  E   
Sbjct: 397 QIE--------GVAVRCPEEFNCKAQIVEKLKHFVSKDAFDIVGLGEKQIKFFYDLE--- 445

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             IR   DIF L+ R +  + K  +  G+G+ S+ NL  +I  RR ISL+RFIFSLGIR 
Sbjct: 446 -LIRQIPDIFILEERLKEFSLKEHH--GWGEKSIANLLSAIQSRRVISLDRFIFSLGIRF 502

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           +G  +A  LA YY+SY N+   ++     +ND  + L+ +  +G+ +A+++  F+   RN
Sbjct: 503 IGQVVAELLANYYVSYDNWYNSMS-----SND--VELVGIDGIGEKVAESLKSFFSQERN 555

Query: 622 ICAVEALLK--EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSA 679
           I  +  L    ++ P       +  S + NK +VFTG L+ + R +A+     LGA +S+
Sbjct: 556 IKMLNDLTAYLQILPV---SSNSSDSFLNNKIIVFTGKLRAMSRGEAKVRAKVLGAKISS 612

Query: 680 ILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
            LS KTD +I G++PGSK +KA +LGV+I++EEQ+
Sbjct: 613 SLSTKTDYLIAGEDPGSKYKKAMELGVEILDEEQW 647


>gi|307257368|ref|ZP_07539138.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306864218|gb|EFM96131.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
          Length = 682

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 269/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
            ALN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EALNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPVTH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGAVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G  S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GGKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H +NV       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVAVVEDLI-----SQGVHWQNVIQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLVKAQELGVKVLTEQEFIAL 678


>gi|307250556|ref|ZP_07532498.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306857372|gb|EFM89486.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 682

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 267/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR +  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTVRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
             LN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 ETLNERALEKGEKTFANPRNAAAGSLRQLDP-KITRQRPLVLNAYGIGVYESDDELPVTH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G+ S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GEKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H +NV       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVAVVEDLI-----SQGVHWQNVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLTKAQELGVKVLTEQEFIAL 678


>gi|303250616|ref|ZP_07336813.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252937|ref|ZP_07534825.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302650604|gb|EFL80763.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859575|gb|EFM91600.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 682

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/709 (37%), Positives = 422/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
            ALN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EALNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPATH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G+ S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GEKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVTVVEDLI-----SQGIHWQDVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLTKAQELGVKVLTEQEFIAL 678


>gi|307248328|ref|ZP_07530352.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306855149|gb|EFM87328.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 682

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
            ALN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EALNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPATH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L     T+  ++E +   G+ S  N  +SI K +N +L RF+
Sbjct: 475 MECE----LVHTPADLFKL---DHTTLMRLERM---GEKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVAVVEDLI-----SQGIHWQDVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLTEQEFIAL 678


>gi|114319842|ref|YP_741525.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312282|sp|Q0AAV2|DNLJ_ALHEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114226236|gb|ABI56035.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
          Length = 673

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 269/715 (37%), Positives = 406/715 (56%), Gaps = 59/715 (8%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           QAR E  +L +EI  HD  YY    P+I D+EYDAL     A+    P+L     P+ P 
Sbjct: 9   QARIE--ALRREIREHDHRYYVLDAPVIADAEYDALMAELQALEAEHPELI---TPDSPS 63

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++ G       +VTH+ P LSL+  +   DL +F  R+    Q    + + +  EPK+D
Sbjct: 64  QRVAGRPAEGFGEVTHAEPMLSLDNAFEEADLAEFDRRVR---QALGLDPVVYVAEPKLD 120

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYIS 194
           G  ++IRYE G+ V A  RGDG  GE ++  +R I ++P R+     P ++EVRGEV I 
Sbjct: 121 GLSVSIRYEDGRLVRAGTRGDGRVGEAITENVRTIRSVPLRLRGEGWPPVMEVRGEVVIR 180

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKG 253
           + DF  LN++ +A G +P+ANPRNAA+G LR+L+P     R L FF  G+     + A  
Sbjct: 181 RADFERLNEQRLADGERPFANPRNAAAGSLRQLDPRITARRRLTFFTFGVAAAGRL-AAS 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +E+L K+   GF VN  V +     G   YY  + + R  L ++IDG+VYKVD+   ++
Sbjct: 240 HHEVLDKLAGWGFRVNERVERVRGLDGCREYYQRLLADRDELSFEIDGVVYKVDDLDARE 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  AR+PRW I+ K   ++A+T +  I   +GRTG +TPVA LEPV +GG  ++ ATL
Sbjct: 300 ELGFTARAPRWAIAWKLPAQEATTVVRRILPSVGRTGAITPVAELEPVGVGGVTVSRATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D ++            +D+R GD V+V+RAG+VIP++  ++  +R   A+P++ P+ 
Sbjct: 360 HNLDEVR-----------RKDVRKGDTVMVRRAGDVIPEITAVVTEKRPEGAEPWAMPAE 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S V+R L+ +     A HRC GGL C AQ+   L HF SR A +I+GLG++ +  
Sbjct: 409 CPVCGSEVLR-LDDE-----AVHRCMGGLYCPAQREGALLHFASRKALDIDGLGEKVVSQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             +       +R PAD+FTL+  Q     ++      GD S  NL  +++K R  +L RF
Sbjct: 463 LVER----GMVRSPADLFTLEHCQLAGLERM------GDKSADNLVAALDKARRTTLPRF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +++LGI+HVG   AR LA+++ S +          A  N D  +L   P VG ++AQAI 
Sbjct: 513 LYALGIQHVGEVTARRLAEHFGSLE----------AIMNADESALAETPDVGPVVAQAIA 562

Query: 614 EFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            F+  P N   V+AL       +EV P+  R E+ ++     +  V TGTL  + R +A+
Sbjct: 563 HFFAEPHNREVVQALRAAGVTWEEVDPA-ERGEQPLA----GRTFVLTGTLSGMTRDEAK 617

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
             +  LGA VS  +S+KTD ++ G+  GSKL KA+ LGV++++E+    LLQ++ 
Sbjct: 618 AALEALGARVSGSVSKKTDYLVAGEKAGSKLAKAESLGVEVLDEQALQALLQEHG 672


>gi|103486042|ref|YP_615603.1| DNA ligase, NAD-dependent [Sphingopyxis alaskensis RB2256]
 gi|123078573|sp|Q1GVQ2|DNLJ_SPHAL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|98976119|gb|ABF52270.1| DNA ligase, NAD-dependent [Sphingopyxis alaskensis RB2256]
          Length = 714

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 281/730 (38%), Positives = 415/730 (56%), Gaps = 57/730 (7%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + +L+  +A  EL  L ++I++H+  Y+    P I D++YDAL RR  AI  AFP L R+
Sbjct: 4   VGSLTEAEAANELMRLAKQIAHHNKLYHAEDSPEISDADYDALVRRNTAIEEAFPHLIRA 63

Query: 69  EDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           + PN     +G  +  S L KVTH+   +SL+  +  ED+ +F  R+ RF    +   + 
Sbjct: 64  DSPN---RLVGAAVEASPLAKVTHAQRMMSLDNAFAAEDVEEFAARVRRFLNLDEGEPLA 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT E KIDG   ++RYEKG  V AA RGDG  GEDV+  +R I  IP+ L  +IP+I E+
Sbjct: 121 FTAEDKIDGLSCSLRYEKGVLVQAATRGDGTVGEDVTPNVRTIADIPQNLKGDIPDIFEI 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKP-----YANPRNAASGILRRLNPT-DITRYLNFFVH 241
           RGEVY++K DF ALN  ++A    P     +ANPRNAA+G LR+ + +   +R L F  H
Sbjct: 181 RGEVYMAKADFAALNARLLAEADDPDKARQFANPRNAAAGSLRQKDASVTASRPLRFLAH 240

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
           G G+ S + A  QY +++ +   G PV+  +++ +    ++ +Y  +++ R+ LPYDIDG
Sbjct: 241 GWGEVSALPADTQYAVMKAIESWGVPVSPLLKRCDGVADLLDHYRMIEAERAELPYDIDG 300

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD    Q +LG  AR+PRW I+HKF  ++A T L  IDIQ+GRTG LTPV RL PV
Sbjct: 301 VVYKVDRLDWQARLGFVARAPRWAIAHKFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPV 360

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG +++N TLHN D I  L            +R GDR++V+RAG+VIP+VV+ +   R
Sbjct: 361 TVGGVVVSNVTLHNRDEIARL-----------GVRPGDRIIVQRAGDVIPQVVENLT--R 407

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
               +P+ FP  CP+C S  V     + G++    RCTGGL C+AQ+ ERL+HFVSR A 
Sbjct: 408 DEPREPYVFPDHCPVCGSEAV----AEDGEVDV--RCTGGLICNAQKFERLRHFVSRGAL 461

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG++ +  F +     +  + PADIF L+  ++    +     G+ + SV NL  +
Sbjct: 462 DIEGLGEKSIAEFLEL---GWLEKGPADIFRLKSHREELLAR----EGWKERSVDNLLAA 514

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF---AQEINNIIAHNND----- 593
           I  +R     R +F LGIRHVGA  AR L K           A E+   +  N       
Sbjct: 515 IEAKRQPDAARLLFGLGIRHVGAVTARDLLKGIGDIARLPGKAAELRAWVEANPRIEGES 574

Query: 594 ------------DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEK 641
                         +  +R   +G  +A+A+ +F+  P N    + LL EVSP     E 
Sbjct: 575 EGKYAARRLEAIKAILDVRADGIGPAVAEALGDFFHEPHNRVLWDDLLSEVSPPPYVVET 634

Query: 642 NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKA 701
              SE+  K +VFTG L+ + R +A+     LGA  +  +S KTD+++ G   GSKL++A
Sbjct: 635 R-DSEVSGKTVVFTGKLETMSRDEAKAQAEALGAKAAGSVSAKTDLVVAGPGAGSKLKQA 693

Query: 702 QQLGVKIMNE 711
             LG+++++E
Sbjct: 694 ASLGIRVIDE 703


>gi|326403263|ref|YP_004283344.1| DNA ligase [Acidiphilium multivorum AIU301]
 gi|325050124|dbj|BAJ80462.1| DNA ligase [Acidiphilium multivorum AIU301]
          Length = 682

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 265/677 (39%), Positives = 394/677 (58%), Gaps = 44/677 (6%)

Query: 41  PIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEK 100
           PI+ D+ YDAL+R   ++  A PDLA +      L+++G   + +  KV H IP LSL+ 
Sbjct: 38  PIMDDAAYDALRREAASLRAAHPDLAAA------LDQVGTTPSGAFGKVRHRIPMLSLDN 91

Query: 101 IWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSG 160
           ++   D  +F   I RF        + F  EPKIDG  I++ YE  +FV  A RGDG  G
Sbjct: 92  VFEPADFVEFCASIRRFL-GLGTAPLAFVAEPKIDGLSISLTYENRRFVRGATRGDGTEG 150

Query: 161 EDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAA 220
           EDV+  +R +  +P  L  + P+ IE+RGEVY++K DF+ALN        + +ANPRNAA
Sbjct: 151 EDVTENLRTLRELPATLPDDAPDFIEIRGEVYMTKTDFIALNQGQA----RQFANPRNAA 206

Query: 221 SGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFH 279
           +G LR+L+P    +R L+ F +  G +SE   +  ++ L  +R  GFPVN    + +   
Sbjct: 207 AGSLRQLDPAVTASRRLSLFAYARGASSEAVGETHWDYLATLRRWGFPVNPLAERVSE-A 265

Query: 280 GIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRL 339
               +   +   R+ L YDIDG+VYK+D+ +LQ++LG   R+PRW ++ KF  ++A T L
Sbjct: 266 AAEPFQRSIGERRAGLDYDIDGVVYKIDDLALQERLGFAGRAPRWAVAWKFPAERALTTL 325

Query: 340 LDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGD 399
             IDIQ+GRTG LTP ARL+PVN+GG L+++ATLHNED I             +D+R+GD
Sbjct: 326 RGIDIQVGRTGALTPRARLDPVNVGGVLVSHATLHNEDEI-----------ARKDVRIGD 374

Query: 400 RVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCT 459
            V ++RAG+VIP+++  +   R  D+ PF FP  CP C +  +R      G++V   RCT
Sbjct: 375 TVELQRAGDVIPQILRALPERRPADSVPFVFPDHCPACGALAIR----PAGEVV--RRCT 428

Query: 460 GGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQT 519
           GGL+C AQ +ERL HF SR AF+IEG+G++ +  F         +  PADIFTL+ R+  
Sbjct: 429 GGLSCPAQVVERLIHFCSRLAFDIEGMGEKTVQEFHG----LGWLESPADIFTLRDRE-- 482

Query: 520 STTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQN 579
               I  + G+G+VS   L  +I+ RR ISL RFI++LGIR +G + A+ LA++Y SY  
Sbjct: 483 --AAIAALEGWGEVSARKLIAAIDARRRISLARFIYALGIRRIGEQNAKLLARHYSSYAV 540

Query: 580 FAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSP--SIG 637
           + +++       +D  L L  +  +G  IA+ +  F+  P N      LL  + P  +I 
Sbjct: 541 WRRQMEEAGVIGSDARLELGSISGIGPSIAEELAGFFAEPHN----RDLLDRLVPILTIE 596

Query: 638 RHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSK 697
                    +  K +VFTGTL+ + R +A+     LGA V+  +S+KTD ++VG + GSK
Sbjct: 597 DEVAAAGGALAGKTIVFTGTLESLTRPEAKARAEALGARVTESVSKKTDFVVVGADAGSK 656

Query: 698 LEKAQQLGVKIMNEEQF 714
             KA  LGV +++E +F
Sbjct: 657 AAKATSLGVTVLSEAEF 673


>gi|89900985|ref|YP_523456.1| DNA ligase [Rhodoferax ferrireducens T118]
 gi|123397178|sp|Q21WC8|DNLJ_RHOFD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|89345722|gb|ABD69925.1| DNA ligase, NAD-dependent [Rhodoferax ferrireducens T118]
          Length = 690

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 264/712 (37%), Positives = 398/712 (55%), Gaps = 50/712 (7%)

Query: 21  LSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG 80
           ++ L + +  H   YY    P I D+EYD + +   AI    P+L     P+ P  ++GG
Sbjct: 19  VAQLRRALHEHAHHYYVEDAPTIPDAEYDRMFQELQAIEAQHPELI---TPDSPTQRVGG 75

Query: 81  EMNLSLFKVTHSIPTLSLEKIWNIE--DLRKFITRIYR-FWQKKDDNSIFFTLEPKIDGT 137
                   V H++P LS+    + E    R F TR+ R     +   ++ +  EPK DG 
Sbjct: 76  RALEQFASVRHAVPMLSIRTETDTEASGARNFDTRVRRELGLDEAAPAVAYVAEPKFDGL 135

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKND 197
            + +RYE G  V AA RGDG  GEDV+  +R I  IP  L  + P I+EVRGEVY+ ++D
Sbjct: 136 AMNLRYESGILVQAATRGDGEVGEDVTQNVRTIGQIPLRLPADAPSILEVRGEVYMRRDD 195

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG--- 253
           F  LN++  A G+K + NPRNAA+G +R+L+P     R L+FF +GLG+ +   A G   
Sbjct: 196 FEKLNEQQRARGQKTFVNPRNAAAGAVRQLDPAIAAQRPLSFFAYGLGEVTPEQAGGPAF 255

Query: 254 --QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
              YE+LQ ++  GFPV+  V  A     +V+YY  +   R  LP+DIDG+VYKV+  +L
Sbjct: 256 GTHYELLQALKTWGFPVSALVGLAQGATELVAYYESIARQRDALPFDIDGVVYKVNSLAL 315

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q+++G   R PRW ++HKF  ++  T +LDID+Q+GRTG LTPVA+L PV +GG  +TNA
Sbjct: 316 QRRMGFVTREPRWAVAHKFPAQEQFTTVLDIDVQVGRTGKLTPVAKLAPVFVGGVTVTNA 375

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHNED  +            +D+RVGD V+V+RAG+VIP+VV +++++R P A  F+ P
Sbjct: 376 TLHNEDEAR-----------RKDVRVGDTVIVRRAGDVIPEVVSVLLDKRQPGATEFTMP 424

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
             CP+C S  VR+     G++   +RCTGGL CSAQ+ + + HF  R A  +EGLG++ +
Sbjct: 425 RQCPVCGSAAVRE----EGEV--DYRCTGGLFCSAQRKQAILHFAQRRAVEVEGLGEKLV 478

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           D           IRI  D++ L        T + ++    D S  N+  ++ K +  +L 
Sbjct: 479 DQLVDGH----VIRILPDLYRL------GLTALASLDRMADKSAQNILQALEKSKQTTLP 528

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RF+F LGIRHVG   A+ LA+++           ++ A  +     L++V  +G I+AQ+
Sbjct: 529 RFLFGLGIRHVGEATAKELARHF----------GSLDAVMDASLEQLLQVNDIGPIVAQS 578

Query: 612 IVEFYQNPRNICAVEALLK-EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +  F+  P N   VE L    V+   G       + +  K  V TGTL  + R +A++ +
Sbjct: 579 LRTFFDQPHNREVVEQLRACGVTWQEGPPAPVTPTPLSGKTFVITGTLPSMSRDEAKDLI 638

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
              G  V+  +S+KT  ++ G   GSKL KAQ+LGV +++E     LL  ++
Sbjct: 639 EAAGGKVAGSVSKKTTFVVAGTEAGSKLTKAQELGVAVLDEAGLKELLDGHS 690


>gi|307246220|ref|ZP_07528301.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307255203|ref|ZP_07537019.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259638|ref|ZP_07541362.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306852829|gb|EFM85053.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306861831|gb|EFM93809.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866283|gb|EFM98147.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 682

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 267/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR +  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTVRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
            ALN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EALNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPVTH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGAVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G  S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GGKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVTVVEDLI-----SQGIHWQDVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLTEQEFIAL 678


>gi|261496584|ref|ZP_05992964.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307787|gb|EEY09110.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 685

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 273/712 (38%), Positives = 416/712 (58%), Gaps = 56/712 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           +++ ++ Q +  ++  Y+    P + D+EYD L      +    P+L  ++ P     ++
Sbjct: 20  EKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPT---QRV 76

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G +      +VTH IP LSL+  ++ EDL  F+ R+  +      + + F  EPK+DG  
Sbjct: 77  GAKPLAGFAQVTHEIPMLSLDNAFSDEDLDGFLRRMESYI-TASPSQLEFCCEPKLDGLA 135

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKND 197
           ++I YE G    AA RGDG +GE+++A IR I  IP  L + N P  +EVRGEV++ ++ 
Sbjct: 136 VSILYENGILTRAATRGDGTTGEEITANIRTIRNIPLKLNTTNPPARLEVRGEVFMPQSG 195

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKG 253
           F  LN++ +A G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +     
Sbjct: 196 FNELNEKALAKGEKTFANPRNAAAGSLRQLDP-KITRQRPLVLNAYGIGVYESDDELPAT 254

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +E LQ ++ LG PVNN +R       +++YY E+++ R TL YDIDG V KV++ +LQ+
Sbjct: 255 HFERLQWLKSLGIPVNNEIRLVQGKAALLAYYAEIQAKRPTLGYDIDGTVLKVNDIALQE 314

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  +RS RW I++KF  ++  T L ++D Q+GRTG +TPVA+LEPV + G  ++NATL
Sbjct: 315 QLGFISRSSRWAIAYKFPAQEEMTILKEVDFQVGRTGAITPVAKLEPVFVAGVTVSNATL 374

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            I +GD V+++RAG+VIP++  +++  R  +A+   FP+ 
Sbjct: 375 HNGDEIERL-----------GIVIGDTVIIRRAGDVIPQITGVVLERRPENAKKIEFPTA 423

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPIC S V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++ 
Sbjct: 424 CPICHSAVTR----VEGEAVA--RCTGGLFCEAQRKEALKHFVSRKAMDIDGVGEKLIEQ 477

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     I  PAD+F L     T+  ++E +   G+ S  N  +SI K +N +L RF
Sbjct: 478 LMARE----LIETPADLFKL---DHTTLMRLERM---GEKSAQNALNSIEKAKNTTLPRF 527

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +FSLGIR VG   A +LA ++ S +   Q            +  L  V  VG+++A  IV
Sbjct: 528 LFSLGIREVGEATALNLANHFGSLEAIRQAT----------FEQLKEVQDVGEVVANRIV 577

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI-----ENKKLVFTGTLQKIQRHKAQE 668
            F+Q P N+  VE L+ +      R E  V +EI     ++K +V TGTL ++ R +A+ 
Sbjct: 578 SFWQEPHNVEVVEDLIAQGV----RWENVVKAEIVDNPLKDKNVVLTGTLTQLTRDEAKA 633

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LG  VS  +S KTD +I G+  GSKL KAQ+LG++I++E+QF+ L Q 
Sbjct: 634 LLQSLGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGIQILSEQQFIELTQH 685


>gi|301155433|emb|CBW14899.1| DNA ligase, NAD(+)-dependent [Haemophilus parainfluenzae T3T1]
          Length = 667

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/707 (37%), Positives = 417/707 (58%), Gaps = 55/707 (7%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++ +L Q++  ++  Y+    P I D+EYD L  +  A+  A P+L  ++ P     +
Sbjct: 4   QQQIDTLRQDLRRYEYEYHVLDNPTIPDAEYDRLFHQLKALEAAHPELITADSPT---QR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G +      ++ H IP LSL+  ++ E+   F+ RI     +  D  + F  EPK+DG 
Sbjct: 61  VGAKPLSGFAQIRHEIPMLSLDNAFSDEEFYAFVKRIEDRLIRLPD-PLTFCCEPKLDGL 119

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            ++I Y  G    AA RGDG +GED++A IR I  IP ++L  N P  +EVRGEV++   
Sbjct: 120 AVSILYVNGVLTQAATRGDGTTGEDITANIRTIRNIPLQLLMDNPPARLEVRGEVFMPHE 179

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKTSEI-FAKGQ 254
            F  LN + +  G K +ANPRNAA+G LR+L+P   + R L    +G+G    +      
Sbjct: 180 GFERLNQQALEKGEKTFANPRNAAAGSLRQLDPKITSKRPLVLNAYGIGIAEGVDLPNTH 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           Y+ LQ ++ +G PVN  +R  N    ++ +Y ++++ RS+L YDIDG V K+++ +LQ++
Sbjct: 240 YDRLQWLKSIGIPVNPEIRLCNGTDEVLDFYRDIQNKRSSLGYDIDGTVLKINDIALQEK 299

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +++PRW I++KF  ++  TRL D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 300 LGFISKAPRWAIAYKFPAQEELTRLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 359

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L           DI +GD V+++RAG+VIP+++ ++ + R  DA+P  FP  C
Sbjct: 360 NGDEIERL-----------DIAIGDMVVIRRAGDVIPQIIGVLHDRRPADARPIVFPETC 408

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S +VR      G+ VA  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++  
Sbjct: 409 PVCDSAIVR----IEGEAVA--RCTGGLFCAAQRKEALKHFVSRKAMDIDGVGGKLIEQL 462

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
              E     I  PAD+F L     T+ T++E +   G  S  N   S+ K +N +L RF+
Sbjct: 463 VDRE----LIHTPADLFKLDL---TALTRLERM---GTKSAENALASLEKAKNTTLARFV 512

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A +LA ++ + +          A  N D  +L +VP VG+++A  I+ 
Sbjct: 513 FALGIREVGEATALNLANHFKTLE----------ALQNADLEALQQVPDVGEVVANRILA 562

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IEN----KKLVFTGTLQKIQRHKAQE 668
           F+  P N+  V  L+ +     G H + V ++  IEN    K +V TGTL ++ R++A+ 
Sbjct: 563 FWHEPHNVAVVNDLIAQ-----GVHWETVEAKEVIENRFKGKTVVLTGTLTQMGRNEAKA 617

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
            +  +GA VS  +S KTD +I GD  GSKL KAQ+LGV ++ EE+FL
Sbjct: 618 LLQDMGAKVSGSVSAKTDFVIAGDAAGSKLTKAQELGVTVLTEEEFL 664


>gi|190150622|ref|YP_001969147.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263969|ref|ZP_07545570.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|254781246|sp|B3H275|DNLJ_ACTP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189915753|gb|ACE62005.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306870658|gb|EFN02401.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 682

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/709 (37%), Positives = 421/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLNQAATRGDGSTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
            ALN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EALNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPVTH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGAVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G  S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GGKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVTVVEDLI-----SQGIHWQDVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLTKAQELGVKVLTEQEFIAL 678


>gi|46143448|ref|ZP_00135242.2| COG0272: NAD-dependent DNA ligase (contains BRCT domain type II)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208768|ref|YP_001053993.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae L20]
 gi|166215385|sp|A3N1V2|DNLJ_ACTP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126097560|gb|ABN74388.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 5b str. L20]
          Length = 683

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/709 (37%), Positives = 419/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+    + P     ++G
Sbjct: 18  QLEALRQKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITVDSPT---QRVG 74

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 75  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 133

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 134 SILYVDGVLSQAATRGDGSTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 193

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
             LN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 194 EELNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPATH 252

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y  +++ R TL YDIDG V KV++  LQ+Q
Sbjct: 253 FERLQWLKSIGIPVNNEIRLATGREQLLAFYANIQAKRPTLGYDIDGTVLKVNDIGLQEQ 312

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 313 LGFISRSPRWAIAYKFPSQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 372

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V ++++ R  +A+   FP+ C
Sbjct: 373 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMDRRPENAKKIEFPTAC 421

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 422 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 475

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L     T+  ++E +   G+ S  N  +SI K +N +L RF+
Sbjct: 476 MERE----LVHTPADLFKL---DHTTLMRLERM---GEKSAQNALNSIEKAKNTTLARFL 525

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 526 FALGIRDVGEATAQNLANHF----------HNLAAIRTATFEQLQAVQDVGEVVANRIVR 575

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 576 FWQEPHNVAVVEDLI-----SQGVHWQDVIQVEIADNPLKGKNVVLTGTLTQLTRDQAKA 630

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVKI+ E++F+ L
Sbjct: 631 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKILTEQEFIAL 679


>gi|171463268|ref|YP_001797381.1| DNA ligase, NAD-dependent [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|254781389|sp|B1XTU0|DNLJ_POLNS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|171192806|gb|ACB43767.1| DNA ligase, NAD-dependent [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 671

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 272/701 (38%), Positives = 402/701 (57%), Gaps = 50/701 (7%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ E++  +  YY    P++ D EYD L R    I    P+   SE  +    ++GG   
Sbjct: 16  LQAELARLEHAYYVLDNPLLPDIEYDRLYRELLDIEAVHPEWVTSESLS---QRVGGAAL 72

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
                VTH++P LSL   +   +L  F  R       +    + +  E K DG  I++RY
Sbjct: 73  KEFDSVTHAVPMLSLNNAFEDAELIAFDRRCREVLHAE---HMAYAGELKFDGLAISLRY 129

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDFLALN 202
           E G  V AA RGDG SGEDV+A I+ I  IP  L+  NIP+++EVRGEV++   DF  +N
Sbjct: 130 ENGLLVTAATRGDGASGEDVTANIKTIRAIPLKLTRKNIPQVLEVRGEVFMYLKDFEKMN 189

Query: 203 DEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG--KTSEIFAKGQYEML 258
            +   +G K +ANPRNAA+G LR+L+ + IT  R L+FF +GLG  +      K   E+L
Sbjct: 190 RQAAELGEKEFANPRNAAAGSLRQLD-SKITAKRPLSFFAYGLGALEPQSWLPKTHEELL 248

Query: 259 QKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGER 318
                LG PV +  +  ++   I+++Y+E+   R +LPYDIDG+VYKV+ F+ Q +LG  
Sbjct: 249 NAYIELGLPVCSERKVLHSVQEILAFYSEIDDKRDSLPYDIDGVVYKVNSFAEQAKLGFA 308

Query: 319 ARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDY 378
           +R+PR+ ++HK+  ++A T +L ID+Q+GRTG +TPVARL PV +GG  +TNATLHNED 
Sbjct: 309 SRAPRFALAHKYPAQEALTTVLGIDVQVGRTGAITPVARLAPVEVGGVTVTNATLHNEDE 368

Query: 379 IKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQ 438
           IK            +D+R+GD V V+RAG+VIP+VV +I + R  DA+ F  PS CP+C 
Sbjct: 369 IK-----------RKDVRIGDTVSVRRAGDVIPEVVSVIKDRRPADAKEFQMPSRCPVCD 417

Query: 439 SRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSE 498
           S + R  +       A  RC+GGL C AQ+ + L HF  R A +IEGLG++ +D      
Sbjct: 418 SHIERLADE------AVARCSGGLFCGAQRKQALIHFAHRRAMDIEGLGEKIVDQLVDQN 471

Query: 499 DPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLG 558
                +R PAD++ L        T + N+   G+ S  NL  +IN+ RN +L RFIF+LG
Sbjct: 472 ----LVRTPADLYRL------GFTALANLERMGEKSADNLIKAINQSRNTTLARFIFALG 521

Query: 559 IRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQN 618
           IRHVG   A+ LA +Y       Q ++ ++    +D L+   V  VG ++A +I  F Q 
Sbjct: 522 IRHVGETTAKDLANHY-------QSMHALMDAGVEDLLT---VKDVGPVVADSITSFMQE 571

Query: 619 PRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678
             N   +E LL      +   EK +S+ +  K  V TGT   + R +A++ + + GA V+
Sbjct: 572 AHNREVIEQLLAS-GMRLAVEEKVISAAVAGKTFVLTGTFPTMTRDEAKDLLEKAGAKVA 630

Query: 679 AILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +S+KTD ++ G + GSKL KA++LGV +++E   L LL+
Sbjct: 631 GSVSKKTDYVVAGTDAGSKLTKAEELGVPVIDEAAMLDLLK 671


>gi|261493319|ref|ZP_05989845.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261310963|gb|EEY12140.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 685

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 272/712 (38%), Positives = 416/712 (58%), Gaps = 56/712 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           +++ ++ Q +  ++  Y+    P + D+EYD L      +    P+L  ++ P     ++
Sbjct: 20  EKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPT---QRV 76

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G +      +VTH IP LSL+  ++ EDL  F+ R+  +      + + F  EPK+DG  
Sbjct: 77  GAKPLAGFAQVTHEIPMLSLDNAFSDEDLDGFLRRMESYI-TASPSQLEFCCEPKLDGLA 135

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKND 197
           ++I YE G    AA RGDG +GE+++A IR I  IP  L + N P  +EVRGEV++ ++ 
Sbjct: 136 VSILYENGILTRAATRGDGTTGEEITANIRTIRNIPLKLNTTNPPARLEVRGEVFMPQSG 195

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKG 253
           F  LN++ +A G K ++NPRNAA+G LR+L+P  ITR     LN +  G+ ++ +     
Sbjct: 196 FNELNEKALAKGEKTFSNPRNAAAGSLRQLDP-KITRQRPLVLNAYGIGVYESDDELPAT 254

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +E LQ ++ LG PVNN +R       +++YY E+++ R TL YDIDG V KV++ +LQ+
Sbjct: 255 HFERLQWLKSLGIPVNNEIRLVQGKAALLAYYAEIQAKRPTLGYDIDGTVLKVNDIALQE 314

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  +RS RW I++KF  ++  T L ++D Q+GRTG +TPVA+LEPV + G  ++NATL
Sbjct: 315 QLGFISRSSRWAIAYKFPAQEEMTILKEVDFQVGRTGAITPVAKLEPVFVAGVTVSNATL 374

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            I +GD V+++RAG+VIP++  +++  R  +A+   FP+ 
Sbjct: 375 HNGDEIERL-----------GIVIGDTVIIRRAGDVIPQITGVVLERRPENAKKIEFPTA 423

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPIC S V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++ 
Sbjct: 424 CPICHSAVTR----VEGEAVA--RCTGGLFCEAQRKEALKHFVSRKAMDIDGVGEKLIEQ 477

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     I  PAD+F L     T+  ++E +   G+ S  N  +SI K +N +L RF
Sbjct: 478 LMARE----LIETPADLFKL---DHTTLMRLERM---GEKSAQNALNSIEKAKNTTLPRF 527

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +FSLGIR VG   A +LA ++ S +   Q            +  L  V  VG+++A  IV
Sbjct: 528 LFSLGIREVGEATALNLANHFGSLEAIRQAT----------FEQLKEVQDVGEVVANRIV 577

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI-----ENKKLVFTGTLQKIQRHKAQE 668
            F+Q P N+  VE L+ +      R E  V +EI     ++K +V TGTL ++ R +A+ 
Sbjct: 578 SFWQEPHNVEVVEDLIAQGV----RWENVVKAEIVDNPLKDKNVVLTGTLTQLTRDEAKA 633

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LG  VS  +S KTD +I G+  GSKL KAQ+LG++I++E+QF+ L Q 
Sbjct: 634 LLQSLGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGIQILSEQQFIELTQH 685


>gi|219850499|ref|YP_002464932.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
 gi|254781282|sp|B8GAC1|DNLJ_CHLAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219544758|gb|ACL26496.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
          Length = 681

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 269/722 (37%), Positives = 395/722 (54%), Gaps = 58/722 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           + + Q   EL +L +   YH   YY    PI+ D+EYDAL     A+  A P+L     P
Sbjct: 4   IDVTQRINELRTLIRRYDYH---YYVLDDPIVSDAEYDALMNELRALEAAHPELI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++ G       KV H  P LSL   +   DL  +  R+ R   +  D ++ + +E
Sbjct: 58  DSPTQRVSGTPASQFAKVQHPQPMLSLGNAFTTTDLLAWRDRVLRLLGQ--DTAVAYVVE 115

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-----------RVLSLN 180
           PKIDG  + + Y  G+FV  A RGDG  GEDV+A +R I +IP           R +   
Sbjct: 116 PKIDGLAVALTYHDGQFVQGATRGDGEVGEDVTANLRTISSIPLLLHPPDGGHDRDVPTA 175

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +IEVRGEVY+   DF ALND + A G K +ANPRNAA+G LR+ +P     R L FF
Sbjct: 176 LPSLIEVRGEVYMRTADFEALNDRLAAAGEKIFANPRNAAAGSLRQKDPAITAARPLRFF 235

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +G+G    +   GQ++ L+ +R LGFPVN  VR+   F  +++Y  +  + R  L Y+ 
Sbjct: 236 AYGVGPVEGVELTGQWQTLRYLRMLGFPVNQDVRRFTDFDEVLAYCEQWMARRDELTYEA 295

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+V K+D+F+ Q++LG   R PRW I+ KF  ++A TRLL+I + +GRTG++TP A LE
Sbjct: 296 DGMVIKIDDFAQQRELGVVGRDPRWAIAFKFPPREAITRLLNITVNVGRTGVVTPNAELE 355

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV IGG ++ NA+LHN DYI             RDIR+GD V+VKRAG+VIP VV  +V 
Sbjct: 356 PVQIGGVIVRNASLHNADYI-----------AQRDIRIGDYVIVKRAGDVIPYVVGPVVA 404

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
            R    +P+ FP+ CP C S + R+         AA RC     C AQ + RL+HF SR 
Sbjct: 405 RRDGSERPWQFPTHCPACGSPLEREPGE------AAWRCNNFGICPAQLVRRLEHFASRA 458

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           A +I GLG++Q + F +       +R  AD+F L+            + GFG   + NL 
Sbjct: 459 ALDIVGLGERQAELFVQRG----LVRDVADLFYLK------AEDFAGLEGFGPKRIANLL 508

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
           ++I+  R   L+R I  LGIR+VG+  A++L             + ++ A  N     L 
Sbjct: 509 NAIDAARQRPLDRLIVGLGIRYVGSVAAQALVN----------SLGSLDAIMNARQEELE 558

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEAL-LKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
           ++P +G ++A +IV+F+ +P N   +E L    V  + G   +  S  +  +  V TGTL
Sbjct: 559 QIPGIGPVVAASIVDFFAHPENRQLIEKLRAAGVQMNAGPQRERKSDVLAGQTFVLTGTL 618

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + R +A   +   G  V+  +S+KT+ ++ G N GSKL KAQQLG+ +++E   L L+
Sbjct: 619 PSLTREQASALIIAHGGKVTDSVSKKTNYVVAGVNAGSKLAKAQQLGIPVLDEAALLALI 678

Query: 719 QQ 720
            +
Sbjct: 679 GE 680


>gi|58617448|ref|YP_196647.1| DNA ligase [Ehrlichia ruminantium str. Gardel]
 gi|75356732|sp|Q5FG20|DNLJ_EHRRG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|58417060|emb|CAI28173.1| DNA ligase [Ehrlichia ruminantium str. Gardel]
          Length = 674

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 268/706 (37%), Positives = 409/706 (57%), Gaps = 41/706 (5%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A+  L  L ++I YHD  YY    P I D+EYD L  +   I   FP L         
Sbjct: 5   EEAKLILDKLNEKIRYHDLLYYTQDSPEISDAEYDDLCHQRSIILEKFPSLNSYYQ---- 60

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
            + IGG+ +    KV H+   LSL+  +N +D+ KF+ R  +    K++ S+ F+ E KI
Sbjct: 61  -DYIGGDPDSRFSKVKHNERMLSLDNAFNKQDVEKFMVRTRKLLDMKENESLCFSCELKI 119

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG   +I Y+ GK   A+ RG+G+ GE+++  ++ I  +P  +  N P+ +EVRGEVYI 
Sbjct: 120 DGLSFSIIYKNGKLFQASTRGNGYFGENITNNVKTIENLPHTIQ-NAPDFLEVRGEVYID 178

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
           +NDF+ LN+E      K +ANPRNAA+G +R+L+PT    R L + ++ +  ++ +    
Sbjct: 179 RNDFIQLNNE-----GKNFANPRNAAAGSIRQLDPTITAQRKLKYCMYTIVNSNCL---T 230

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
           Q E L  +   GF  N      + F   +++YN+M + RS + YDIDG++YK++   LQ 
Sbjct: 231 QTESLNLLNSWGFCTNEHTISTDNFEEAINFYNKMYNNRSNISYDIDGIIYKINNIKLQH 290

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
            LG  ++SPRW I++KF   +  T+L  I IQ+GRTG+LTP+A L P+NIGG +IT A+L
Sbjct: 291 ILGTTSKSPRWAIAYKFPAIEGKTKLNKISIQVGRTGVLTPIAELAPINIGGVVITRASL 350

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN+  I+            +DIR GD V+VKRAG+VIP+VVD+  + R  +   F+FP+ 
Sbjct: 351 HNKSEIE-----------RKDIREGDYVIVKRAGDVIPQVVDVDKSLRTVELAEFNFPTA 399

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C S V +       +   +  C GGL C  Q LE+++HFVS+DAFNI GLGK+QL F
Sbjct: 400 CPACGSTVYQ------AQQEVSIYCMGGLFCHNQILEKIRHFVSKDAFNIIGLGKKQLLF 453

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
           F++       I    DIFTL+ +      ++ +  G+G+ S+ NL  +IN  + I+LE F
Sbjct: 454 FYEYG----LITNIIDIFTLEEKINNKNIQLSSFNGWGEKSINNLLSAINNSKVINLENF 509

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IFSLGIR VG  IA+ LA +++SY+N+  E+  +      D    I +  VG     ++ 
Sbjct: 510 IFSLGIRFVGKHIAKILANHFISYKNWYTEMLKLA----QDVNYTINIQQVGLKTINSLR 565

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
            F+    N+  +  L++ ++  I     +  S I  K +VFTG L  + R +A+      
Sbjct: 566 TFFTEQHNLNMINNLVEHLTI-IDAQSNSYVSLIHGKTIVFTGELSSMSRSEAKLKSETA 624

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           GA VS+ LS+ TD +I+G+NPGSK +KAQ L ++I++E+ +L  +Q
Sbjct: 625 GAKVSSSLSKNTDFLIIGNNPGSKYKKAQSLNIQILSEDIWLQYIQ 670


>gi|165976722|ref|YP_001652315.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190359223|sp|B0BQN6|DNLJ_ACTPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|165876823|gb|ABY69871.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
          Length = 682

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 266/709 (37%), Positives = 420/709 (59%), Gaps = 58/709 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ E+L  F+ R+  +   +D +++ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEELDGFLRRMESYI-TEDPHTLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR +  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTVRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
             LN+  +  G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 ETLNERALEKGEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPATH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R A     ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLATGREQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAKKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     +  PAD+F L   + T+  ++E +   G  S  N  +SI K +N +L RF+
Sbjct: 475 MERE----LVHTPADLFKL---EHTTLMRLERM---GGKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLDAIRAATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+     S G H ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVTVVEDLI-----SQGIHWQDVVQVEIADNPLKGKSVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++F+ L
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLTEQEFIAL 678


>gi|310823543|ref|YP_003955901.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309396615|gb|ADO74074.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
          Length = 673

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 260/718 (36%), Positives = 411/718 (57%), Gaps = 60/718 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           + ++ A      L +E+++H+  YY    P + D+EYD L R    +   FP LA    P
Sbjct: 1   MDLKTAETRARDLRRELAHHNHRYYVLDSPEVSDAEYDRLMRELQGLEAQFPALA---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE      KV H  P LSL  ++N E+  +F  RI +     D   + +  E
Sbjct: 58  DSPTQRVGGEAAEKFAKVVHRAPMLSLANVFNDEEFTEFDERIRKVVGPAD---VTYVCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL----SLNIPEIIEV 187
           PK+DG  IT+RYE G+F+  A RGDG +GEDV+  +R +  +P  L     + +P ++EV
Sbjct: 115 PKLDGLAITLRYENGRFLQGATRGDGTTGEDVTGNLRTVRPLPLELLPEAGMAVPPVLEV 174

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEV+I K DF  LN++    G   +ANPRNAA+G LR+L+P    +R L+  ++ +  T
Sbjct: 175 RGEVFIRKEDFKKLNEKREEEGEALFANPRNAAAGSLRQLDPKITASRPLSVSLYEIVPT 234

Query: 247 SEIFA----KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
             + A      + E LQK   LG PVN+  R A    G+ + Y      R  L +++DG+
Sbjct: 235 EGVPAFDTHTAKLEYLQK---LGLPVNHHER-AQGLEGVRAAYQAALKGRHALKFEVDGM 290

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           V KVD    +++LG+ ++SPRW +++KF  ++ STR+  I++Q+GRTG LTPVA L+PV 
Sbjct: 291 VVKVDSEDQRRRLGQVSKSPRWAVAYKFPPEEESTRVEAIEVQVGRTGALTPVAHLKPVK 350

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG  ++ ATLHNED ++            +D+R GD V V+RAG+VIP++V ++ N+R 
Sbjct: 351 VGGVTVSRATLHNEDELR-----------RKDVRQGDTVFVRRAGDVIPEIVSVVPNQRP 399

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
            D++P+ FP  CP+C ++ V+D   + G ++   RCTG  +C AQ +E+++HF SR A +
Sbjct: 400 ADSKPYEFPQHCPVCGAQAVKD---EEGAII---RCTGA-SCPAQLVEKVRHFASRPAMD 452

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           I+G+G +       S      ++  AD++ L R Q  S  ++      G+ S  NL  +I
Sbjct: 453 IDGVGDKLAAQLVAS----GRVKTFADLYALTREQLLSLERM------GEKSADNLLAAI 502

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
            + +  +  RF+++LGIRHVG   A++LA+ +                   D  +L RV 
Sbjct: 503 ERSKQTTQRRFLYALGIRHVGEATAKALAEAFPEAPLL----------YTADMEALTRVK 552

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
            VG  +AQ +  F+Q P+N  A++ALL   V+P+    + N       K +V TG +  +
Sbjct: 553 DVGPTMAQVLHAFFQEPQNRAAIDALLAAGVTPAP--PQVNTGGPFAGKTVVLTGGMTGM 610

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            R +A+E + + G  VS  +SRKTD ++ G++ GSKL+KAQ+LGV++++E+ FL LLQ
Sbjct: 611 SRDQAKEEIERRGGKVSGSVSRKTDFVVAGEDAGSKLKKAQELGVRVLDEQAFLKLLQ 668


>gi|254292786|ref|YP_003058809.1| DNA ligase, NAD-dependent [Hirschia baltica ATCC 49814]
 gi|254041317|gb|ACT58112.1| DNA ligase, NAD-dependent [Hirschia baltica ATCC 49814]
          Length = 792

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 257/642 (40%), Positives = 381/642 (59%), Gaps = 35/642 (5%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           +L+++QAR+    L + I   D  YY++  P + D++YDAL++   A+   FP L   + 
Sbjct: 15  SLTLDQARERWEELAETIRQADSAYYEHDAPHLSDADYDALRQDLLALESEFPQLVAQDS 74

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+     +G + +    K+TH  P LSL+  ++ ED+ +F+ RI R+        +  T 
Sbjct: 75  PS---QSVGVKPSGRFAKITHLQPMLSLDNAFSDEDVSEFLGRIRRYLGMDASVELHVTA 131

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPKIDG   ++ YE G  +  A RGDG  GEDV+A ++ I  IP  L  +  PE IE+RG
Sbjct: 132 EPKIDGLSASLLYENGVLISGATRGDGRVGEDVTANLKTIADIPHTLEGDDWPERIEIRG 191

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTS 247
           EVY+S  DF ALN+   A GRK +ANPRNAA+G LR+L+  ++T  R L FF +  G TS
Sbjct: 192 EVYMSHADFAALNEREAAAGRKTFANPRNAAAGSLRQLD-VEVTKSRPLRFFAYAWGDTS 250

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           + F+  Q   ++     GF +N  ++ A++   ++  YN++ + R++L YDIDG+VYKVD
Sbjct: 251 KEFSVNQMGAVEAFSKWGFSINPLMKCADSASQLIEIYNQIANDRASLGYDIDGVVYKVD 310

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               Q +LG  +R PRW I+HKF  +QA+T L +I+IQ+GRTG LTPVA+LEPV +GG +
Sbjct: 311 RLDWQARLGFVSRFPRWAIAHKFPAEQATTILREIEIQVGRTGSLTPVAKLEPVTVGGVV 370

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHNED I             +DIRVGD+V+++RAG+VIP++V +I  ER   ++P
Sbjct: 371 VSNATLHNEDEI-----------ARKDIRVGDKVVIQRAGDVIPQIVRVIAEERPSHSKP 419

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           + FP+ CP C S  VR+++ K G+  A  RCTGGL C AQ  ERLKHFVSR A +I+GLG
Sbjct: 420 YEFPTTCPACGSHAVREMDEK-GEEDARRRCTGGLICPAQAKERLKHFVSRKALDIDGLG 478

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRR-QQTSTTKIENILGFGDVSVTNLYDSINKRR 546
            +Q++ FF        +  P  IF L++R  + +   +E   GFG  S  N++ +IN +R
Sbjct: 479 AKQIELFFDKG----VVTAPQHIFQLEQRINELNLPPLEEWEGFGKTSSENIFAAINAKR 534

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII-AHNNDDWLSLIRVPLVG 605
            I   RF+  LGI+HVG   +  LA+ +LS+  F   ++  I A     +L L  +  +G
Sbjct: 535 QIPFARFLIGLGIQHVGQTNSGLLAQNFLSFDAFQTAMHAAIDARPGPAYLKLSSIDRIG 594

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI 647
           D   + I+ F +        E  L E  P+    E N+S +I
Sbjct: 595 DTTLENILNFVE--------ENGLPETPPA--SLEPNLSGQI 626



 Score = 88.2 bits (217), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 107/201 (53%), Gaps = 10/201 (4%)

Query: 522 TKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFA 581
           T +ENIL F  V    L ++       +L   I +L ++ V +    ++A+ Y ++  F 
Sbjct: 596 TTLENILNF--VEENGLPETPPASLEPNLSGQIPALQMKGVNSAACEAMARRYGNWDEFR 653

Query: 582 QEINNIIAHNN----DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIG 637
              N ++  N+      + S+  +  +GD+ A+A+++F+  P N   +  LL E+     
Sbjct: 654 ---NELLKANDTKPASAFKSISNIDGMGDVSAEALIDFFMEPHNQDMLTQLLAEIEIEAA 710

Query: 638 RHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSK 697
           +  +     +  K +VFTG+L+ + R +A+     LGA V++ +S+KTD ++ G   GSK
Sbjct: 711 QAIQ-TDGAVAGKTVVFTGSLELMSRDEAKSKAQSLGAKVASSVSKKTDYVVAGPGAGSK 769

Query: 698 LEKAQQLGVKIMNEEQFLFLL 718
           L+KAQ LGV ++ E+ +L ++
Sbjct: 770 LKKAQDLGVTVLTEQAWLDMI 790


>gi|238919178|ref|YP_002932692.1| NAD-dependent DNA ligase LigA [Edwardsiella ictaluri 93-146]
 gi|238868746|gb|ACR68457.1| DNA ligase, NAD-dependent, putative [Edwardsiella ictaluri 93-146]
          Length = 672

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 267/711 (37%), Positives = 405/711 (56%), Gaps = 55/711 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           ++L  L   + +H+  YY    P I D+EYD L  +   +    P L   + P+    ++
Sbjct: 4   QQLEQLRDALRHHEYQYYVLDDPQITDAEYDRLMMQLKQLEAVHPALVTVDSPS---QRV 60

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           GG    +  +V H +P LSL+ +++ E  + F  R++   + K D  + F  EPK+DG  
Sbjct: 61  GGAPLAAFGQVHHEVPMLSLDNVFDEESYQAFDKRLHE--RLKSDEPLTFCCEPKLDGLA 118

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKND 197
           +++ YE+G  V AA RGDG +GED+++ ++ I  IP R+    IP  IEVRGEV++ ++ 
Sbjct: 119 VSLLYEQGVLVRAATRGDGTTGEDITSNVKTIRAIPLRLQGEAIPARIEVRGEVFMPQDG 178

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK-TSEIFAKGQY 255
           F A+N+E    G K +ANPRNAA+G LR+L+P     R L F+ +G G+          Y
Sbjct: 179 FEAMNEEARRRGAKIFANPRNAAAGSLRQLDPRITAQRPLTFYCYGTGQLEGGALPDSHY 238

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           + LQ+ +  G PV+  VR       +++YY ++   R TL +DIDG+V KVD+ ++Q++L
Sbjct: 239 QCLQRFKSWGLPVSERVRLCCGSAEVLAYYRQIGQARPTLGFDIDGVVIKVDDIAIQERL 298

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  AR+PRW  + KF  ++  TRL  ++ Q+GRTG +TPVARLEPV + G  ++NATLHN
Sbjct: 299 GFVARAPRWATAFKFPAQEQMTRLNGVEFQVGRTGAITPVARLEPVLVAGVTVSNATLHN 358

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I+ L           D+R+GD V+V+RAG+VIP+VV ++   R  DA    FP+ CP
Sbjct: 359 ADEIERL-----------DLRIGDTVIVRRAGDVIPQVVGVVEAMRPRDAHEIGFPTHCP 407

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           +C S V R      G+ VA  RC+GGL C+AQ+ E LKHFVSR A ++EG+G + ++   
Sbjct: 408 VCGSEVER----TEGEAVA--RCSGGLICAAQRKESLKHFVSRRAMDVEGMGDKVIEQLV 461

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
             E     +  PAD++ L      S  K+  +   G  S T L  ++++ R  +L RF+F
Sbjct: 462 DKE----YVATPADLYRL------SAGKLTGLERMGPKSATKLIAALDRSRETTLARFLF 511

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR VG   A +LA ++ S Q          A    D  SL RVP VG+++A  IV F
Sbjct: 512 ALGIREVGEATAANLASHFGSLQ----------ALRAADLESLKRVPEVGEVVASHIVHF 561

Query: 616 YQNPRNICAVEALLK--------EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
                N   ++ L+         E +P+  +    V S    K +V TG+L  + R +A+
Sbjct: 562 LSEEHNRQVIDELISDEVGIRWPEGAPA--QSAPAVDSPFAGKTVVLTGSLSVLSRDEAK 619

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + +T LGA VS  +S+KTD++I GD  GSKL KA  LG+++++E Q L +L
Sbjct: 620 DRLTALGARVSGSVSKKTDLVIAGDAAGSKLAKANILGIEVIDEAQMLRML 670


>gi|57239421|ref|YP_180557.1| DNA ligase [Ehrlichia ruminantium str. Welgevonden]
 gi|58579393|ref|YP_197605.1| DNA ligase [Ehrlichia ruminantium str. Welgevonden]
 gi|81352823|sp|Q5HAI7|DNLJ_EHRRW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|57161500|emb|CAH58426.1| NAD-dependent DNA ligase [Ehrlichia ruminantium str. Welgevonden]
 gi|58418019|emb|CAI27223.1| DNA ligase [Ehrlichia ruminantium str. Welgevonden]
          Length = 674

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 268/706 (37%), Positives = 409/706 (57%), Gaps = 41/706 (5%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A+  L  L ++I YHD  YY    P I D+EYD L  +   I   FP L         
Sbjct: 5   EEAKLILDKLNEKIRYHDLLYYTQDSPEISDAEYDDLCHQRSIILEKFPSLNSYYQ---- 60

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
            + IGG+ +    KV H+   LSL+  +N +D+ KF+ R  +    K++ S+ F+ E KI
Sbjct: 61  -DYIGGDPDSRFSKVKHNERMLSLDNAFNKQDVEKFMVRTRKLLDMKENESLCFSCELKI 119

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG   +I Y+ GK   A+ RG+G+ GE+++  ++ I  +P  +  N P+ +EVRGEVYI 
Sbjct: 120 DGLSFSIIYKNGKLFQASTRGNGYFGENITNNVKTIENLPHTIQ-NAPDFLEVRGEVYID 178

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
           +NDF+ LN+E      K +ANPRNAA+G +R+L+PT    R L + ++ +  ++ +    
Sbjct: 179 RNDFIQLNNE-----GKNFANPRNAAAGSIRQLDPTITAQRKLKYCMYTIVNSNCL---T 230

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
           Q E L  +   GF  N      + F   +++YN+M + RS + YDIDG++YK++   LQ 
Sbjct: 231 QTESLNLLNSWGFCTNEHTISTDNFEEAINFYNKMYNNRSNISYDIDGIIYKINNIKLQH 290

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
            LG  ++SPRW I++KF   +  T+L  I IQ+GRTG+LTP+A L P+NIGG +IT A+L
Sbjct: 291 ILGTTSKSPRWAIAYKFPAIEGKTKLNKISIQVGRTGVLTPIAELAPINIGGVVITRASL 350

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN+  I+            +DIR GD V+VKRAG+VIP+VVD+  + R  +   F+FP+ 
Sbjct: 351 HNKSEIE-----------RKDIREGDYVIVKRAGDVIPQVVDVDKSLRTVELAEFNFPTA 399

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C S V +       +   +  C GGL C  Q LE+++HFVS+DAFNI GLGK+QL F
Sbjct: 400 CPACGSTVYQ------AQQEVSIYCMGGLFCHNQILEKIRHFVSKDAFNIIGLGKKQLLF 453

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
           F++       I    DIFTL+ +      ++ +  G+G+ S+ NL  +IN  + I+LE F
Sbjct: 454 FYEYG----LITNIIDIFTLEEKINNKNIQLSSFNGWGEKSINNLLSAINNSKVINLENF 509

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IFSLGIR VG  IA+ LA +++SY+N+  E+  +    N      I +  VG     ++ 
Sbjct: 510 IFSLGIRFVGKHIAKILANHFISYKNWYTEMLKLAQDVN----YTINIQQVGLKTINSLR 565

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
            F+    N+  +  L++ ++  I     +  S I  K +VFTG L  + R +A+      
Sbjct: 566 TFFIEQHNLNMINNLVEHLTI-IDAQSNSYVSLIHGKTIVFTGELSSMSRSEAKLKSETA 624

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           GA VS+ LS+ TD +I+G+NPGSK +KAQ L ++I++E+ +L  +Q
Sbjct: 625 GAKVSSSLSKNTDFLIIGNNPGSKYKKAQSLNIQILSEDIWLQYIQ 670


>gi|189425977|ref|YP_001953154.1| DNA ligase, NAD-dependent [Geobacter lovleyi SZ]
 gi|254781338|sp|B3E8F8|DNLJ_GEOLS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189422236|gb|ACD96634.1| DNA ligase, NAD-dependent [Geobacter lovleyi SZ]
          Length = 683

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 262/700 (37%), Positives = 394/700 (56%), Gaps = 46/700 (6%)

Query: 22  SSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGE 81
           + L + + +H+ CYY+   P I D+EYDAL R    I  A PDL     P+ P  ++GG+
Sbjct: 21  AELRRLLEHHNRCYYELDSPEISDAEYDALFRELQVIEAARPDLL---TPDSPTLRVGGK 77

Query: 82  MNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITI 141
                 +V H +P LSLE     +++R F  RI       D  ++ +  EPK+DG  + +
Sbjct: 78  PLARFSQVRHRMPMLSLENAMQEDEIRGFEQRIRSLLALPDTVALQYQCEPKMDGLAVEL 137

Query: 142 RYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLA 200
            Y+ G  V A+ RGDG  GE+V+A IR +  +P R+   N+P ++EVRGEVY+    F  
Sbjct: 138 VYQDGLLVQASTRGDGEVGEEVTANIRTVRNVPLRLTGDNLPALLEVRGEVYLPLAAFQQ 197

Query: 201 LNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSEIFAKGQYEMLQ 259
           LN +    G  P+ANPRNAA+G +R+L+P  + R  L    +G+G   E  A+ Q E++ 
Sbjct: 198 LNQQREEAGEPPFANPRNAAAGSIRQLDPAVVARRPLAMVCYGVG-VMETEARTQTELMS 256

Query: 260 KMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERA 319
           ++   G PV++  RQ +   G ++ + +++  R +L Y+IDG+V KVD+  LQ++LGE++
Sbjct: 257 QLAAWGLPVSDQARQVSGIEGAIACFQDLQERRDSLLYEIDGMVIKVDDLRLQQELGEKS 316

Query: 320 RSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYI 379
           RSPRW I+ KF  +QA+TR+ +I + +GRTG++TPVA LEPV + G  ++ ATLHN D I
Sbjct: 317 RSPRWAIACKFPPRQATTRINEIILSVGRTGVITPVASLEPVELSGVTVSRATLHNWDEI 376

Query: 380 KGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQS 439
           +            +DIRVGDRV+V+RAG+VIP VV +++++R    Q    P  CP+C S
Sbjct: 377 R-----------RKDIRVGDRVIVERAGDVIPAVVKVLLDKRSGTEQELPEPETCPVCGS 425

Query: 440 RVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSED 499
           R  R+     G++  A RC GGLAC  Q  E + HF SRDA +I+GLG + ++       
Sbjct: 426 RAARE----AGEV--AVRCQGGLACPPQLAESIIHFASRDAMDIDGLGSKYIEQL----- 474

Query: 500 PAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGI 559
              S+ +  DI  L R  +    + E +   GD    NL  +I   +   L RFIF+LGI
Sbjct: 475 --ISLGLVKDIADLYRLTRDDFMQFERM---GDKLAENLLAAIASSKQQELSRFIFALGI 529

Query: 560 RHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNP 619
           RHVG   AR+LA+ + S  N        +    D          VG  +A +I  F+  P
Sbjct: 530 RHVGERTARTLAERFGSIDNLQTATLEELTSIRD----------VGPAVAISIRSFFDAP 579

Query: 620 RNICAVEAL-LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678
            N   ++ L    V+P++   EK V   +     VFTGTL  + R +A++ V   G  V+
Sbjct: 580 ANQTVLQRLKAAGVAPTV--EEKRVGGRLAGLTFVFTGTLATLGRDEAKKLVEAEGGNVT 637

Query: 679 AILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +S+KTD ++ G   GSKLEKA+ LG+ +++E+ F  LL
Sbjct: 638 GSVSKKTDYVVAGSEAGSKLEKARNLGITVLSEDAFSKLL 677


>gi|254360665|ref|ZP_04976814.1| DNA ligase (NAD(+)) [Mannheimia haemolytica PHL213]
 gi|153091205|gb|EDN73210.1| DNA ligase (NAD(+)) [Mannheimia haemolytica PHL213]
          Length = 685

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 272/712 (38%), Positives = 415/712 (58%), Gaps = 56/712 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           +++ ++ Q +  ++  Y+    P + D+EYD L      +    P+L  ++ P     ++
Sbjct: 20  EKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPT---QRV 76

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G +      +VTH IP LSL+  ++ EDL  F+ R+  +      + + F  EPK+DG  
Sbjct: 77  GAKPLAGFAQVTHEIPMLSLDNAFSDEDLDGFLRRMESYI-TASPSQLEFCCEPKLDGLA 135

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKND 197
           ++I YE G    AA RGDG +GE+++A IR I  IP  L + N P  +EVRGEV++ ++ 
Sbjct: 136 VSILYENGILTRAATRGDGTTGEEITANIRTIRNIPLKLNTTNPPARLEVRGEVFMPQSG 195

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKG 253
           F  LN++ +A G K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +     
Sbjct: 196 FNELNEKALAKGEKTFANPRNAAAGSLRQLDP-KITRQRPLVLNAYGIGVYESDDELPAT 254

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +E LQ ++ LG PVNN +R       +++YY E+++ R TL YDIDG V KV++ +LQ+
Sbjct: 255 HFERLQWLKSLGIPVNNEIRLVQGKAALLAYYAEIQAKRPTLGYDIDGTVLKVNDIALQE 314

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  +RS RW I++KF  ++  T L ++  Q+GRTG +TPVA+LEPV + G  ++NATL
Sbjct: 315 QLGFISRSSRWAIAYKFPAQEEMTILKEVGFQVGRTGAITPVAKLEPVFVAGVTVSNATL 374

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            I +GD V+++RAG+VIP++  +++  R  +A+   FP+ 
Sbjct: 375 HNGDEIERL-----------GIVIGDTVIIRRAGDVIPQITGVMLERRPENAKKIEFPTA 423

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPIC S V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++ 
Sbjct: 424 CPICHSAVTR----VEGEAVA--RCTGGLFCEAQRKEALKHFVSRKAMDIDGVGEKLIEQ 477

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     I  PAD+F L     T+  ++E +   G+ S  N  +SI K +N +L RF
Sbjct: 478 LMARE----LIETPADLFKL---DHTTLMRLERM---GEKSAQNALNSIEKAKNTTLPRF 527

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +FSLGIR VG   A +LA ++ S +   Q            +  L  V  VG+++A  IV
Sbjct: 528 LFSLGIREVGEATALNLANHFGSLEAIRQAT----------FEQLKEVQDVGEVVANRIV 577

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI-----ENKKLVFTGTLQKIQRHKAQE 668
            F+Q P N+  VE L+ +      R E  V +EI     ++K +V TGTL ++ R +A+ 
Sbjct: 578 SFWQEPHNVEVVEDLIAQGV----RWENVVKAEIVDNPLKDKNVVLTGTLTQLTRDEAKA 633

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LG  VS  +S KTD +I G+  GSKL KAQ+LG++I++E+QF+ L Q 
Sbjct: 634 LLQSLGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGIQILSEQQFIELTQH 685


>gi|158521726|ref|YP_001529596.1| DNA ligase, NAD-dependent [Desulfococcus oleovorans Hxd3]
 gi|254781314|sp|A9A0L9|DNLJ_DESOH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158510552|gb|ABW67519.1| DNA ligase, NAD-dependent [Desulfococcus oleovorans Hxd3]
          Length = 682

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 273/721 (37%), Positives = 405/721 (56%), Gaps = 60/721 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           L   +A++ ++ L  E+  H+  YY    P I D+EYD L R    +    PDLA   DP
Sbjct: 5   LDKSEAKERVTFLRNELHRHNHLYYIKDAPEISDAEYDRLFRELAELEALHPDLA---DP 61

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
             P  ++G      L  VT +IP LS+   +  E+L KF  R+ R  Q  D   + +  E
Sbjct: 62  ASPTARVGAPPTGDLATVTRTIPMLSISNAFADEELFKFDERVRRSLQTGD--PVTYLAE 119

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS---LNIPEIIEVR 188
           PK+DGT + + YEKG+ V AA RGDG +GE ++   R I ++P  L+   + +P ++EVR
Sbjct: 120 PKLDGTAVELVYEKGRLVMAATRGDGVTGEVITPNARTIGSVPLHLTGDAVPMPNLLEVR 179

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTS 247
           GEV ++K  F  LN   +      +AN RNAA+G LR+L+     +R L    +G+G+ S
Sbjct: 180 GEVVMTKEGFEKLNALRLERDEPLFANARNAAAGSLRQLDSRVTASRPLTLIAYGIGRFS 239

Query: 248 EIFA-KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           EI A   Q+E++ ++   GF  N+ VR      G++ +Y  ++ IR +LPYDIDG+V KV
Sbjct: 240 EIDAISTQHEIVTRLADFGFKTNSHVRWDLDIKGVIDFYRFLEGIRPSLPYDIDGMVVKV 299

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q+ LG  +RSPRW+I++KFA  Q +TRL+ ID+Q+GRTG LTPVA LEPV IGG 
Sbjct: 300 DRLDFQRTLGATSRSPRWVIAYKFAASQETTRLVAIDVQVGRTGALTPVALLEPVTIGGV 359

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++ ATLHNED I             +DIRVGD VLV+RAG+VIP+VV +I   R  +  
Sbjct: 360 TVSRATLHNEDEI-----------ARKDIRVGDAVLVQRAGDVIPEVVQVITGRRTGNET 408

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF  P+ CP+C + VVR+ +       A  RC    AC AQ  ER+KHF ++ AF+I+GL
Sbjct: 409 PFQMPATCPVCGTPVVREPSE------AVTRCVNA-ACPAQVKERIKHFAAKGAFDIDGL 461

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + +D           I   AD+FTL+         +E++   G  S  NL  +I K R
Sbjct: 462 GDKLVDQLVDRG----MIASYADLFTLR------VEDLESLDRMGFKSAQNLVAAIEKSR 511

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYY-----LSYQNFAQEINNIIAHNNDDWLSLIRV 601
           +I+ + F++ LG+RHVGA +A  LA+ +     L+    A ++N+I              
Sbjct: 512 HITFDAFLYGLGMRHVGAHVATLLARAFPGIDQLAEAALAGQLNSIDG------------ 559

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSE--IENKKLVFTGTL 658
             +G +IA+++  F+ NP N   V++L+   V+      E     E  +  K  V TGTL
Sbjct: 560 --IGGVIAESVKNFFSNPENRQTVDSLINHGVALQFPEKEAATGHEMPLAGKTFVLTGTL 617

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A++ +   G  V+  +S +TD ++ G+ PGSK +KA+ LGV I++E   L LL
Sbjct: 618 EKMTRDQARQRIEAAGGKVTGSVSSRTDYVVAGEAPGSKRDKAEALGVAILDEAGLLSLL 677

Query: 719 Q 719
           +
Sbjct: 678 E 678


>gi|85059656|ref|YP_455358.1| NAD-dependent DNA ligase LigA [Sodalis glossinidius str.
           'morsitans']
 gi|123766419|sp|Q2NSC2|DNLJ_SODGM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|84780176|dbj|BAE74953.1| DNA ligase [Sodalis glossinidius str. 'morsitans']
          Length = 678

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 262/719 (36%), Positives = 423/719 (58%), Gaps = 57/719 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +EQ  + +  L +++ + +  YY  + P + DSEYD        +    PDL  ++ P+ 
Sbjct: 1   MEQIEQHILRLRKQLRHWEYLYYVEAAPEVPDSEYDRFMAELRTLEAERPDLLTADSPS- 59

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
              ++GG+   S  +V H +P LSL+ ++       F  R+    ++ DD  + +  E K
Sbjct: 60  --QRVGGQAQSSFGQVRHEVPMLSLDNVFEEPGFLAFDKRVRDRLKRDDD--MTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL--NIPEIIEVRGEV 191
           +DG  +++ YE G+ V AA RGDG +GED++A +R I TIP  L    N+P ++E+RGEV
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGATGEDITANVRTIRTIPLRLQDHDNLPRLLEIRGEV 175

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSE-I 249
           ++S+  FL LN+     G K +ANPRNAA+G LR+L+P+   R  L F+ +G+G   +  
Sbjct: 176 FMSEAGFLRLNETAKREGSKVFANPRNAAAGSLRQLDPSITARRPLTFYCYGVGLLEDGE 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             +  +E LQ+ +  G PV++ VR+      ++ +Y ++   R +L +DIDG+V KVD  
Sbjct: 236 LPESHWERLQQFKAWGVPVSDRVRRCTGSAAVLDFYRQVHEARLSLGFDIDGVVIKVDSL 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LG  AR+PRW I++KF  ++  TR+ D++ Q+GRTG +TPVARLEPV + GA+++
Sbjct: 296 ALQQRLGFVARAPRWAIAYKFPAQEQLTRVRDVEFQVGRTGAITPVARLEPVLVSGAMVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D ++ L            + +GD V+V+RAG+VIP++V ++ +ER  + +P +
Sbjct: 356 NATLHNADEVERL-----------GLMIGDTVIVRRAGDVIPQIVGVVTSERPAEVRPVA 404

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+  A  RCT GL C+AQ+ E LKHFVSR A +I+G+G +
Sbjct: 405 FPTQCPVCSSDVER----VEGE--AVLRCTAGLVCAAQRKEALKHFVSRRAMDIDGMGDK 458

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     ++ PAD+F L +   T   ++      G  S  NL +++ K R  +
Sbjct: 459 IIDQLVERE----LVKTPADLFRLNKEILTRLDRM------GSKSAQNLLEALEKARQTT 508

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A +LA  Y +       ++ +IA + D   SL  V  +G+I+A
Sbjct: 509 FARFLYALGIREVGEATAVNLAAAYGT-------LDALIAADID---SLTGVQDIGNIVA 558

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIG-RHEKNVSSEI-------ENKKLVFTGTLQKI 661
             +  F++   NI  ++ LL   SP+IG R  + V++ +         K +V TG+L  +
Sbjct: 559 THVRHFFEETHNIEVIQDLL---SPAIGIRWPEPVAAPVAASDNPFAGKTIVLTGSLSSL 615

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            R +A++++  LGA VS  +S KTD++I G+  GSKL KAQQL + +M+E + + LL +
Sbjct: 616 SRDEAKDHLVALGARVSGSVSAKTDLLIAGEAAGSKLSKAQQLNIPVMDEAEMMRLLGE 674


>gi|156933031|ref|YP_001436947.1| NAD-dependent DNA ligase LigA [Cronobacter sakazakii ATCC BAA-894]
 gi|166215403|sp|A7MKW4|DNLJ_ENTS8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|156531285|gb|ABU76111.1| hypothetical protein ESA_00834 [Cronobacter sakazakii ATCC BAA-894]
          Length = 672

 Score =  462 bits (1188), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 261/716 (36%), Positives = 417/716 (58%), Gaps = 53/716 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R   A+  A P+L     P+ 
Sbjct: 1   MESIEEKLTQLRTTLRHHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G        +V H +P LSL+ +++      F  R+    + K  +++ +  E K
Sbjct: 58  PTQRVGAAPLTEFSQVRHEVPMLSLDNVFDEASFLAFNKRVQD--RLKSTDALVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GED++  +R I  IP ++   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGLLVRAATRGDGTTGEDITLNVRTIRAIPLKLRGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRVTAKRPLTFFCYGVGLLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             +   E LQ+ +  G PV++ +R   T   ++++Y+++++ R TL +DIDG+V KVD  
Sbjct: 236 -PRSHMERLQQFKAWGLPVSDRIRLVKTPEEVLAFYHQVEADRPTLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++
Sbjct: 295 ELQEQLGFVARAPRWAVAFKFPAQEQMTTVRDVEFQVGRTGAITPVARLEPVQVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  
Sbjct: 355 NATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPAQCPVCGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRAMDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  NL +++ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNLVNALEKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA ++ + +     IN  I    DD   L +VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHFGTLEAL---INASI----DD---LQKVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEV-----SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
             +  F++   N   +  L +EV     +P + + E+ + S    K +V TGTL ++ R 
Sbjct: 558 THVFNFFEEESNRAVIRDLTEEVGIHWPAPQVVKAEE-IDSPFAGKTVVLTGTLSQMSRD 616

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            A+  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL +
Sbjct: 617 DAKARLAALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMLRLLGE 672


>gi|82523924|emb|CAI78646.1| NAD-dependent DNA ligase [uncultured delta proteobacterium]
          Length = 670

 Score =  462 bits (1188), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 271/709 (38%), Positives = 406/709 (57%), Gaps = 54/709 (7%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
           A K +  L Q I YH+  YYQ   P I D+EYD L R    +   FPD    E  + P  
Sbjct: 7   AHKRIIELRQIIEYHNKRYYQQDAPEISDAEYDLLMRELHNLEAQFPD---DELASSPTQ 63

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDG 136
           ++G          TH  P LSL   ++ E++  F  R+ R       ++I +  EPK+DG
Sbjct: 64  RVGAAPLAKFVSFTHPSPMLSLANAFSEEEIIDFDNRLKRLASV---DNISYVAEPKLDG 120

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN----IPEIIEVRGEVY 192
             + I YE G F+  A RGDG +GEDV+  ++ I T+P  +  +    IP  +EVRGEVY
Sbjct: 121 LAVNIIYENGFFIKGATRGDGTTGEDVTQNLKTINTLPLKIKKSGETLIPSFMEVRGEVY 180

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIF 250
           + K  F  LN   +  G +P+ANPRNAA+G LR+L+ + IT  R L+ F++G+G    + 
Sbjct: 181 MEKEPFEKLNQRRVKDGEEPFANPRNAAAGSLRQLD-SKITARRPLSIFLYGIGNIQGMN 239

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               +E+LQ +   GFPVN  + QA   +  + Y+N + + R TLPYDIDG+V KVD  +
Sbjct: 240 FPTHWELLQALSVWGFPVNKLIEQAKDINACIRYFNRIGNARDTLPYDIDGVVLKVDGLA 299

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ  LG  +R+PRW ++ KF  +Q +T + DI IQ+GR G LTPVA +EPVN+GG +++ 
Sbjct: 300 LQNTLGNISRNPRWALACKFPAQQETTIIKDIIIQVGRMGTLTPVAIMEPVNVGGVMVSR 359

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED I             +D+R+GD V+++RAG+VIP+VV +I   R    + F  
Sbjct: 360 ATLHNEDEI-----------SKKDVRIGDAVIIQRAGDVIPEVVKVIDKNRTDRGKKFKM 408

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP C S VVR      G++  A RC   ++C AQ  E ++HF SR A +IEGLG++ 
Sbjct: 409 PSHCPECGSEVVR----FEGEV--AQRCV-NISCPAQLKEHIRHFASRGALDIEGLGEKL 461

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
               F ++     I  PAD++ L +       K+  +    + S   L DSI + +N  L
Sbjct: 462 SAQLFDAK----LIADPADLYFLTK------DKLLELDRQAEKSAQKLIDSIARSKNPPL 511

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           ++FI++LGIRHVG   A+ LA Y+ S       I N+IA  ++D   L  +  +G  I+ 
Sbjct: 512 DKFIYALGIRHVGERTAKLLAGYFGS-------IENLIAAKSED---LTVINEIGPEISA 561

Query: 611 AIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           +IVEF+  P+N   ++   K  V P   + E + ++ +  K  VFTGT++++ R+KA++ 
Sbjct: 562 SIVEFFHEPKNKAVMKKFEKAGVIPQ--KKEISHNAPLAGKAFVFTGTMERMGRNKAKDI 619

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           V  +G  V + +++KT  ++ G  PGSKL+KA   G+KI++E++FL L+
Sbjct: 620 VENMGGTVQSGVTKKTTYVVAGAEPGSKLDKANSSGIKIISEDEFLKLI 668


>gi|237807406|ref|YP_002891846.1| DNA ligase, NAD-dependent [Tolumonas auensis DSM 9187]
 gi|237499667|gb|ACQ92260.1| DNA ligase, NAD-dependent [Tolumonas auensis DSM 9187]
          Length = 686

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 261/717 (36%), Positives = 411/717 (57%), Gaps = 53/717 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           + + +  + +L+Q +  ++  YY + +P + D+EYD L      +  A P      D N 
Sbjct: 1   MNEIQSRMHALQQLLERYNTEYYLHDEPSVPDAEYDRLMNELRELEAANPQWL---DVNS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++GG    S   V H  P LSL+ ++N EDL  F  R+       D  +I F  EPK
Sbjct: 58  PTQRVGGVALTSFGSVQHEQPMLSLDNVFNAEDLAAFGRRVQERLLSND--AITFCCEPK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE+G+ V AA RGDG +GED++  +R I  IP R+   NIP  IEVRGEV+
Sbjct: 116 LDGLAVSILYEQGELVRAATRGDGVTGEDITRNVRTIRVIPLRLSGDNIPARIEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI-- 249
           + K  F   N++ +  G K +ANPRNAA+G LR+L+P     R L F+ + +G   E   
Sbjct: 176 MPKAGFERWNEQALVRGDKVFANPRNAAAGSLRQLDPAITAQRPLAFYAYAIGVVDEATE 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                Y  +Q ++  G PV + +RQ     G   Y++++ + R  LP++IDG+V+KVD  
Sbjct: 236 LPDSHYARMQYLKQFGLPVCDEIRQVVGVEGCQIYHDDILAKRDALPFEIDGVVFKVDTI 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           + Q+ LG  +R+PRW ++HKF  ++  TRL D++ Q+GRTG +TPVARLEPV +GG  ++
Sbjct: 296 AQQQMLGFVSRAPRWAVAHKFPAQEELTRLNDVEFQVGRTGAITPVARLEPVQVGGVTVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +++GD V+V+RAG+VIP++V+++++ R    +   
Sbjct: 356 NATLHNADEITRL-----------GVKIGDWVVVRRAGDVIPQIVNVVLDRRDASCRDID 404

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP+C S+V R      G+ VA  RC+GGL C+AQ+ E LKHFVSR A +I+G+G +
Sbjct: 405 FPERCPVCDSQVER----LPGEAVA--RCSGGLYCAAQRKEALKHFVSRRAMDIDGIGDK 458

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++     E     +  PAD+F L + Q     ++      G+ S   L +++   R  +
Sbjct: 459 LIEQLVDHE----LVHTPADLFALTKAQLLGLERM------GEKSADKLLNALQSARETT 508

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+F+LGIR +G   A++LA+++          +++ A  +    +L++V  VG+++A
Sbjct: 509 FARFLFALGIREIGETTAQTLAQHF----------SDLPALQDASVETLLKVSDVGEVMA 558

Query: 610 QAIVEFYQNPRNICAVEALLKEVSP-SIGRHEKNVSS------EIENKKLVFTGTLQKIQ 662
           + I  F++   N+  ++ LL  +S    G   + V+        +  K LV TGTL ++ 
Sbjct: 559 KHIYYFFRQEHNLEVIQRLLAPISEGGAGISWQPVARVAVDALPLNGKTLVLTGTLSQLN 618

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           R  A++ +  LGA V+  +S KTD++I G+  GSKLEKAQQLGV +  E++ + LLQ
Sbjct: 619 RDAAKQALQALGAKVAGSVSAKTDLVIAGEAAGSKLEKAQQLGVPVWGEDELVALLQ 675


>gi|152979719|ref|YP_001345348.1| NAD-dependent DNA ligase LigA [Actinobacillus succinogenes 130Z]
 gi|190359224|sp|A6VR16|DNLJ_ACTSZ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150841442|gb|ABR75413.1| DNA ligase, NAD-dependent [Actinobacillus succinogenes 130Z]
          Length = 672

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 265/710 (37%), Positives = 413/710 (58%), Gaps = 47/710 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           + +++ L   + +H+  Y+    P I DSEYD L  R  A+    P+L  ++ P     +
Sbjct: 5   QNQINQLRNTLRHHEYQYHVLDNPEIPDSEYDRLFHRLKALEQQHPELISADSPT---QR 61

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G +      ++TH +P LSL+ +++ E+   F+ RI        DN + F  EPK+DG 
Sbjct: 62  VGAKPLAGFAQITHELPMLSLDNVFSDEEFYAFVKRIQERLITLPDN-LEFCCEPKLDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            ++I YE G+ V AA RGDG +GED++  IR I  IP ++L+ N P  +EVRGEV++ + 
Sbjct: 121 AVSILYENGRLVQAATRGDGTTGEDITLNIRTIRNIPLQLLTDNPPVRLEVRGEVFMPQE 180

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGLGKTSEIFAKG 253
            F  LN+  +A G K +ANPRNAA+G LR+L+P   ++     N +  G+ + +++    
Sbjct: 181 GFDRLNEAALARGEKTFANPRNAAAGSLRQLDPKITSQRPLVWNAYSIGIAEGADL-PPT 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            YE LQ ++ +G PVN  +R       ++ +Y  ++  R  L YDIDG V KV+E +LQ+
Sbjct: 240 HYERLQWLKSIGIPVNGEIRLCRGAENVLKFYRTIQEKRPELGYDIDGTVLKVNEIALQE 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  +++PRW I++KF  ++  T L D++ Q+GRTG +TPVA+L+PV + G  ++NATL
Sbjct: 300 RLGFISKAPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLQPVFVAGVTVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I  L           DI +GD V+V+RAG+VIP+++ ++ + R P+A+P  FP+ 
Sbjct: 360 HNGDEIARL-----------DIAIGDTVIVRRAGDVIPQIIGVVHDRRPPNAEPIIFPTL 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S +VR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G + ++ 
Sbjct: 409 CPVCHSAIVR----IEGEAVA--RCTGGLFCDAQRKESLKHFVSRRAMDIDGVGAKLIEQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     IR PAD+F L      +  ++E +   G+ S     DS+ K +  +L RF
Sbjct: 463 LVDRE----LIRTPADLFKLDL---ITLMRLERM---GEKSAQKALDSLEKAKKTTLARF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IF+LGIR VG   A +LA ++           N+ A    D   L  V  VG+++A  I 
Sbjct: 513 IFALGIREVGEATALNLANFF----------KNLTALQTADLEQLQAVSDVGEVVANRIY 562

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVS-SEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
            F++   NI  V  L+ +        EK V+ +  + K +V TGTL ++ R++A+  + Q
Sbjct: 563 VFWREQHNIDVVNDLIAQGVHWDDVEEKQVNENPFKEKTVVLTGTLSQMGRNEAKALLQQ 622

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           +GA V+  +S KT I+I GD+ GSKL KAQ LGV +M+E +FL ++  ++
Sbjct: 623 MGAKVAGSVSAKTHIVIAGDSAGSKLSKAQDLGVAVMSEAEFLEIVNSFS 672


>gi|88810628|ref|ZP_01125885.1| DNA ligase, NAD-dependent [Nitrococcus mobilis Nb-231]
 gi|88792258|gb|EAR23368.1| DNA ligase, NAD-dependent [Nitrococcus mobilis Nb-231]
          Length = 672

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 253/715 (35%), Positives = 409/715 (57%), Gaps = 48/715 (6%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           ++ +E  ++E   + +++L  +I  H+  Y+    P + D++YD L R   A+    PDL
Sbjct: 1   MVRVERAAVE---RRVAALRDQIEQHNYRYFVLDDPQVSDADYDVLMRELQALEADHPDL 57

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
                P+ P  ++G +   +  +  H +P LSL+  ++  +L +F  RI    ++   N 
Sbjct: 58  V---SPDSPTQRVGAKPVEAFGEARHGVPMLSLDNAFDAGELGEFDRRIR---ERLGINR 111

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEI 184
           I +  EPK+DG  + +RYE+G+ V    RGDG  GED++A IR + TIP R+     PE+
Sbjct: 112 IAYMAEPKLDGLSVNLRYEQGRLVQGGTRGDGQVGEDITANIRTLRTIPLRLRGKGWPEL 171

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGL 243
           IEVRGE+ I K DF  LN   +  G + +ANPRNAA+G LR+L+P     R L FF  G+
Sbjct: 172 IEVRGEIVIRKADFKHLNTLRLEAGERLFANPRNAAAGSLRQLDPRVTARRPLTFFAFGI 231

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G++ E+ A  Q ++L+++   GFPV   V+  +     ++YY  + + R TLP++IDG V
Sbjct: 232 GESREVIAGRQSQILERLHGWGFPVYERVQVVSGVEECLAYYRRLMAQRETLPFEIDGTV 291

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKVD+ S Q++LG  AR+PRW +++K   ++  + +LDI+  +GRTG++TPVARLEPV +
Sbjct: 292 YKVDDLSSQQRLGFTARAPRWAVAYKLPAREGLSVVLDIEPSVGRTGVITPVARLEPVPL 351

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG ++ +ATLHNED ++            +D+R+GD V+++RAG+VIP+++ +   +R  
Sbjct: 352 GGVIVRHATLHNEDEVR-----------RKDVRIGDTVMLRRAGDVIPEIIGVQPEKRPQ 400

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
            AQP+  P  CP+C + V+R  +       AAHRC GGL C+AQ+   + HF SR A +I
Sbjct: 401 GAQPWRMPLKCPVCSAEVMRLEHQ------AAHRCLGGLYCAAQRTGAILHFASRRAMDI 454

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +GLG++ ++           +   AD+++L+R Q     ++      G+ S  NL  +I+
Sbjct: 455 DGLGEKLVEQLVGR----GLVATVADLYSLERAQLVELERM------GERSAGNLLRAID 504

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
             R  +L RF+++LGI  VG   A+ LA++Y       +              +L R+P 
Sbjct: 505 ASRATTLARFLYALGIPEVGEVTAKRLAEHYGDLDPLERATEE----------ALTRLPD 554

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G ++AQ I  F+  P N   ++AL +           N S+ +  +  V TGTL+   R
Sbjct: 555 IGPVLAQRITHFFAQPHNREVIDALRRSGLHWSVPDGANQSTPLAGRVFVLTGTLKGYTR 614

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +AQE +  LG  V+  +S+ TD +IVG+ PGSK +KA QLG+ +++E  F  L+
Sbjct: 615 EEAQERIEALGGRVTGHVSKNTDYMIVGEAPGSKRDKAVQLGITLLDESGFRQLI 669


>gi|170718864|ref|YP_001784038.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 2336]
 gi|254781341|sp|B0USD9|DNLJ_HAES2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168826993|gb|ACA32364.1| DNA ligase, NAD-dependent [Haemophilus somnus 2336]
          Length = 667

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 270/712 (37%), Positives = 415/712 (58%), Gaps = 59/712 (8%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++  L Q + +H+  Y+    P I DSEYD L  +  A+   +P+ A     N P  +
Sbjct: 3   KQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYASE---NSPTQR 59

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIY-RFWQKKDDNSIFFTLEPKIDG 136
           +G +   +  +V H IP LSL+  ++ ED   F+ RI  R       +S+ F  EPK+DG
Sbjct: 60  VGAKPLSNFAQVKHDIPMLSLDNAFSDEDFFAFVKRIQDRLIHVH--HSLTFCCEPKLDG 117

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISK 195
             ++I Y  G+ V AA RGDG +GED++A IR I  IP ++L+ N P  +EVRGEV++S+
Sbjct: 118 LAVSILYINGQLVQAATRGDGTTGEDITANIRTIRNIPLQLLTDNPPTRLEVRGEVFMSQ 177

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI-FAK 252
             F  LN   +A G K +ANPRNAA+G LR+L+P  IT  R L    +G+G    +    
Sbjct: 178 AGFEKLNKTALAKGEKTFANPRNAAAGSLRQLDP-KITGQRPLMLNAYGIGIAEGVELPD 236

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             +  LQ ++ +G PVNN ++  +    ++ +Y  +K  RS+L YDIDG V K+++  LQ
Sbjct: 237 THFARLQWLKSIGIPVNNEIQLCHGIEKVLDFYRTIKQKRSSLGYDIDGTVLKINDIDLQ 296

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           +QLG  +++PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV + G  ++NAT
Sbjct: 297 QQLGFISKAPRWAIAYKFPAQEELTILNNVEFQVGRTGAITPVAKLEPVFVAGVTVSNAT 356

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN D I  L           DI +GD V+V+RAG+VIP+++ ++   R  +A+   FP+
Sbjct: 357 LHNGDEIARL-----------DIAIGDTVIVRRAGDVIPQIIGVLHERRPENAKSIIFPT 405

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP+C S + +      G+ VA  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++
Sbjct: 406 NCPVCDSVISK----IEGEAVA--RCTGGLICAAQRKEALKHFVSRKAMDIDGIGAKLIE 459

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
              + E     +  PAD+F L    Q +  ++E +   G  S  N   S+ K +  +L R
Sbjct: 460 QLVERE----LVHTPADLFKL---DQVTLMRLERM---GAKSAENALASLAKAKKTTLAR 509

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR VG   A +LA ++ + + F           N  +  L +V  VG+++A+ I
Sbjct: 510 FIFALGIREVGETTALNLATHFKTLEAF----------ENATFEQLQKVQDVGEVVAKRI 559

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVS------SEIENKKLVFTGTLQKIQRHKA 666
             F+  P N+  V+ L+ +     G H  NV       + ++ K +V TGTL K+ R +A
Sbjct: 560 RSFWSEPHNVAVVKDLIAQ-----GIHWDNVEVKEVRDNPLKGKTVVLTGTLTKMGRSEA 614

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +EY+ QLG  VS  +S KTD +I G++ GSKL KA +LG+ I++E +FL LL
Sbjct: 615 KEYLLQLGCKVSGSVSSKTDFVIAGESAGSKLTKATELGINILSENEFLALL 666


>gi|223041748|ref|ZP_03611941.1| DNA ligase [Actinobacillus minor 202]
 gi|223017432|gb|EEF15850.1| DNA ligase [Actinobacillus minor 202]
          Length = 680

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 268/707 (37%), Positives = 414/707 (58%), Gaps = 48/707 (6%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           E+ +L  ++  ++  Y+    P++ D+EYD L      +    P+L     P+ P  ++G
Sbjct: 15  EIETLRNKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELIT---PDSPTQRVG 71

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH +P LSL+  ++ EDL  F+ R+  +      +S+ F  EPK+DG  +
Sbjct: 72  AKPLDGFSQVTHELPMLSLDNAFSDEDLDGFLRRMESYISVAP-SSLAFCCEPKLDGLAV 130

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI-IEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED++A IR I  IP  L  + P + +EVRGEV++ +  F
Sbjct: 131 SILYVNGVLTQAATRGDGTTGEDITANIRTIRNIPLKLKTDNPPLRLEVRGEVFMPQKGF 190

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGLGKTSEIFAKGQY 255
            ALN + +  G K +ANPRNAA+G LR+L+P    +    LN +  G+  + +      +
Sbjct: 191 EALNQKALEKGEKTFANPRNAAAGSLRQLDPKITAQRPLMLNAYSIGIYDSDDELPSTHF 250

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           E LQ ++ LG PVNN +R       ++ +Y ++++ R TL YDIDG V KV++ +LQ+QL
Sbjct: 251 ERLQWLKSLGIPVNNEIRLEKGRENLLKFYADIQTKRPTLGYDIDGTVLKVNDIALQEQL 310

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLHN
Sbjct: 311 GFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLHN 370

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I+ L            I +GD V+++RAG+VIP+++ I+   R  +A+  +FP+ CP
Sbjct: 371 GDEIERL-----------GIAIGDTVIIRRAGDVIPQIIGIVAERRPKNAKKITFPTACP 419

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           IC S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++   
Sbjct: 420 ICGSAVVR----VEGEAVA--RCTGGLFCEAQRKEALKHFVSRKAMDIDGVGEKLIEQLM 473

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
           + E     +  PAD+F L    Q +  ++E +   G+ S  N  +SI K +N +L RF+F
Sbjct: 474 ERE----LVHTPADLFKL---DQVTLMRLERM---GEKSAQNALNSIEKAKNTTLPRFLF 523

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR VG   A +LA ++ S            A     +  L  V  VG+++A  IV F
Sbjct: 524 ALGIRDVGEATALNLANHFGSLD----------AIRAATFEQLQEVQDVGEVVANRIVRF 573

Query: 616 YQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           +Q P N+  VE L+++  V  +I + E    + +++K +V TGTL  + R +A+  +  L
Sbjct: 574 WQEPHNVEVVEDLIQQGVVWQNIEQVEI-ADNPLKDKNVVLTGTLSVLTRDQAKALLQGL 632

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           G  VS  +S KTD +I G+  GSKL KAQ+LGVK+++E+ FL ++ Q
Sbjct: 633 GCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLSEQDFLAIVGQ 679


>gi|240948595|ref|ZP_04752968.1| NAD-dependent DNA ligase LigA [Actinobacillus minor NM305]
 gi|240297103|gb|EER47674.1| NAD-dependent DNA ligase LigA [Actinobacillus minor NM305]
          Length = 679

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 268/702 (38%), Positives = 413/702 (58%), Gaps = 48/702 (6%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           E+ +L  ++  ++  Y+    P++ D+EYD L      +    P+L     P+ P  ++G
Sbjct: 15  EIETLRNKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELIT---PDSPTQRVG 71

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH +P LSL+  ++ EDL  F+ R+  +      +S+ F  EPK+DG  +
Sbjct: 72  AKPLDGFSQVTHELPMLSLDNAFSDEDLDGFLRRMESYISVTP-SSLDFCCEPKLDGLAV 130

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED++A IR I  IP R+ + N P  +EVRGEV++ +  F
Sbjct: 131 SILYVNGVLTQAATRGDGTTGEDITANIRTIRNIPLRLKTDNPPLRLEVRGEVFMPQKGF 190

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGLGKTSEIFAKGQY 255
            ALN + +  G K +ANPRNAA+G LR+L+P    +    LN +  G+  + +      +
Sbjct: 191 EALNQKALEKGEKTFANPRNAAAGSLRQLDPKITAQRPLMLNAYSIGIYDSDDELPNTHF 250

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           E LQ ++ LG PVNN +R       ++ +Y ++++ R TL YDIDG V KV++ +LQ+QL
Sbjct: 251 ERLQWLKSLGIPVNNEIRLEKGRENLLKFYADIQTKRPTLGYDIDGTVLKVNDIALQEQL 310

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLHN
Sbjct: 311 GFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLHN 370

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I+ L            I +GD V+++RAG+VIP+++ I+   R  +A+  +FP+ CP
Sbjct: 371 GDEIERL-----------GIAIGDTVIIRRAGDVIPQIIGIVAERRPENAKKITFPTACP 419

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           IC S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++   
Sbjct: 420 ICGSAVVR----VEGEAVA--RCTGGLFCEAQRKEALKHFVSRKAMDIDGVGEKLIEQLM 473

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
           + E     +  PAD+F L    Q +  ++E +   G+ S  N  +SI K +N +L RF+F
Sbjct: 474 ERE----LVHTPADLFKL---DQVTLMRLERM---GEKSAQNALNSIEKAKNTTLPRFLF 523

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR VG   A +LA ++ S +          A     +  L  V  VG+++A  IV F
Sbjct: 524 ALGIRDVGEATALNLANHFGSLE----------AIRTATFEQLQEVQDVGEVVANRIVRF 573

Query: 616 YQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           +Q P N+  VE L+++  V  +I + E    + +++K +V TGTL  + R +A+  +  L
Sbjct: 574 WQEPHNVEVVEDLIQQGVVWQNIEQVEI-ADNPLKDKNVVLTGTLSVLTRDQAKALLQGL 632

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           G  VS  +S KTD +I G+  GSKL KAQ+LGVK+++E+ FL
Sbjct: 633 GCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLSEQDFL 674


>gi|289522353|ref|ZP_06439207.1| DNA ligase, NAD-dependent [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289504189|gb|EFD25353.1| DNA ligase, NAD-dependent [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 674

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 263/706 (37%), Positives = 398/706 (56%), Gaps = 46/706 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           +A+K    L +EI  H+  YY    P+I D EYDAL R    +   FP++     P+ P 
Sbjct: 7   EAKKRAEELRKEIEKHNYYYYVLDSPVITDEEYDALYRGLVELERRFPEII---TPDSPT 63

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++GG+      KV H IP LS++ ++  E+L+ F++R+YR  +++ D    FT E K+D
Sbjct: 64  QRVGGKPKEEFRKVVHEIPMLSMDNVFTQEELQSFVSRVYRILEREVD----FTTELKVD 119

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G  +++ YE G+FV  A RGDG  GEDV+  +R I ++P  L   +P  +EVRGEVY++K
Sbjct: 120 GIAVSLVYEDGRFVLGATRGDGRVGEDVTENLRTIKSLPLRLMEPLPGRLEVRGEVYMTK 179

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKGQ 254
            DF +LN      G   +ANPRNAA+G LR+L+P     R L  FV+ +    E     Q
Sbjct: 180 EDFASLNRSREEDGEPLFANPRNAAAGSLRQLDPNVTAQRRLRIFVYQVVHPEEYGLFSQ 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +++L  +R  GFP     R    F  + +Y  E K  R +L Y  DG+V KVD+ +  +Q
Sbjct: 240 FQVLSWLRNKGFPTQGNERLCKNFEELWNYIEEWKEKRHSLAYATDGVVVKVDDLTAYEQ 299

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  A++PRW I+ K+  ++  TRLL I++ +GRTG LTPVA LEPV + G ++  A+LH
Sbjct: 300 LGTTAKAPRWQIAFKYPAEEQRTRLLRIEVSVGRTGALTPVAILEPVRLAGTVVQRASLH 359

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NED IK L           D+RVGD V V++AGE+IP+VV +  + R    +PF+ P  C
Sbjct: 360 NEDEIKRL-----------DVRVGDYVYVRKAGEIIPEVVRVDYSARTGQERPFAIPENC 408

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C + VVR +         A+RC    +C AQ  E +KHF SRDA +I+GLG++ ++  
Sbjct: 409 PVCGATVVRLVGE------VAYRCPNK-SCPAQIKESIKHFASRDAMDIKGLGEKIIEQL 461

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
              +     I   AD++ L++    S  ++      G  S   L ++IN  +N  L R I
Sbjct: 462 VDKK----MIGGFADLYKLKKEDLISLDRM------GPKSAEKLINAINSSKNRPLSRLI 511

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           ++LGIR+VG+  A  LA+ + S  N A+           D   L  +P +G  IA +IV 
Sbjct: 512 YALGIRYVGSRTAEILAERFKSMDNLAKA----------DIQDLSDIPGIGPQIASSIVA 561

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLG 674
           F+++ +N+  ++ L +          +      E  K+VFTG L+K  R++A+  V  LG
Sbjct: 562 FFRDEKNLATIKDLARCGIKMAEEESERQEGPWEGWKIVFTGELEKATRNEAENIVKYLG 621

Query: 675 AVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+ S+ +SR    +++G NPGSKL KAQ+LGVKI++E+ F  L+ +
Sbjct: 622 AIPSSSVSRNVAFVVIGRNPGSKLAKAQELGVKIVDEQTFWKLVDE 667


>gi|113460523|ref|YP_718587.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 129PT]
 gi|122945214|sp|Q0I2H6|DNLJ_HAES1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|112822566|gb|ABI24655.1| DNA ligase (NAD+) [Haemophilus somnus 129PT]
          Length = 673

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 270/712 (37%), Positives = 415/712 (58%), Gaps = 59/712 (8%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++  L Q + +H+  Y+    P I DSEYD L  +  A+   +P+ A     N P  +
Sbjct: 9   KQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYASE---NSPTQR 65

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIY-RFWQKKDDNSIFFTLEPKIDG 136
           +G +   +  +V H IP LSL+  ++ ED   F+ RI  R       +S+ F  EPK+DG
Sbjct: 66  VGAKPLSNFAQVKHDIPMLSLDNAFSDEDFFAFVKRIQDRLIHVH--HSLTFCCEPKLDG 123

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISK 195
             ++I Y  G+ V AA RGDG +GED++A IR I  IP ++L+ N P  +EVRGEV++S+
Sbjct: 124 LAVSILYINGQLVQAATRGDGTTGEDITANIRTIRNIPLQLLTDNPPARLEVRGEVFMSQ 183

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI-FAK 252
             F  LN   +A G K +ANPRNAA+G LR+L+P  IT  R L    +G+G    +    
Sbjct: 184 AGFEKLNKTALAKGEKTFANPRNAAAGSLRQLDP-KITGQRPLMLNAYGIGIAEGVELPD 242

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             +  LQ ++ +G PVNN ++  +    ++ +Y  +K  RS+L YDIDG V K+++  LQ
Sbjct: 243 THFARLQWLKSIGIPVNNEIQLCHGIEKVLDFYRTIKQKRSSLGYDIDGTVLKINDIDLQ 302

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           +QLG  +++PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV + G  ++NAT
Sbjct: 303 QQLGFISKAPRWAIAYKFPAQEELTILNNVEFQVGRTGAITPVAKLEPVFVAGVTVSNAT 362

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN D I  L           DI +GD V+V+RAG+VIP+++ ++   R  +A+   FPS
Sbjct: 363 LHNGDEIARL-----------DIAIGDTVIVRRAGDVIPQIIGVLHERRPENAKSIIFPS 411

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP+C S + +      G+ VA  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++
Sbjct: 412 NCPVCDSVISK----IEGEAVA--RCTGGLICAAQRKEALKHFVSRKAMDIDGIGAKLIE 465

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
              + E     +  PAD+F L    Q +  ++E +   G  S  N   S+ K +  +L R
Sbjct: 466 QLVERE----LVHTPADLFKL---DQVTLMRLERM---GAKSAENALASLAKAKKTTLAR 515

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR VG   A +LA ++ + + F           N  +  L +V  VG+++A+ I
Sbjct: 516 FIFALGIREVGETTALNLATHFKTLEAF----------ENATFEQLQKVQDVGEVVAKRI 565

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVS------SEIENKKLVFTGTLQKIQRHKA 666
             F+  P N+  V+ L+ +     G H  +V       + ++ K +V TGTL K+ R +A
Sbjct: 566 RSFWSEPHNVAVVKDLIAQ-----GIHWDDVEVKEVRDNPLKGKTVVLTGTLTKMGRSEA 620

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +EY+ QLG  VS  +S KTD +I G++ GSKL KA +LG+ I++E +FL LL
Sbjct: 621 KEYLLQLGCKVSGSVSSKTDFVIAGESAGSKLTKATELGINILSENEFLALL 672


>gi|167855687|ref|ZP_02478444.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis 29755]
 gi|167853205|gb|EDS24462.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis 29755]
          Length = 675

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 269/718 (37%), Positives = 422/718 (58%), Gaps = 64/718 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PIE   +E  R++L    +E  YH   Y+    P++ D+EYD L      +    P+L  
Sbjct: 4   PIET-QLEHLREKL----REYEYH---YHVLDNPLVPDAEYDRLMNELKNLEWQHPELIT 55

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           S+ P     ++G +      ++TH IP LSL+  ++ +DL  F+ RI       + N I 
Sbjct: 56  SDSPT---QRVGAKPLDGFAQITHEIPMLSLDNAFSDDDLIGFLRRIEDRI-AINSNQIE 111

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIE 186
           F  EPK+DG  ++I Y  G    AA RGDG +GED++A IR I  IP ++ + N P  +E
Sbjct: 112 FCCEPKLDGLAVSILYVDGVLTQAATRGDGTTGEDITANIRTIRNIPLKLKTNNPPHRLE 171

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGL 243
           VRGEV++ +  F  LN++ +A G K +ANPRNAA+G LR+L+P   ++    LN +  G+
Sbjct: 172 VRGEVFMPQQGFEQLNEKALAKGEKTFANPRNAAAGSLRQLDPKITSQRPLMLNAYNIGV 231

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
            ++ +      ++ LQ ++ LG PVN  +  A     + ++Y ++++ RS+L YDIDG V
Sbjct: 232 YESDDELPTTHFDRLQWLKTLGIPVNAEITLATGSQALTAFYQKIQAKRSSLGYDIDGTV 291

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
            KV+E +LQ+QLG  +++PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +
Sbjct: 292 LKVNEITLQEQLGFISKAPRWAIAYKFPAQEEMTILNDVEFQVGRTGAITPVAKLEPVFV 351

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
            G  ++NATLHN D I+ L            I +GD V+++RAG+VIP++V ++   R  
Sbjct: 352 AGVTVSNATLHNGDEIERL-----------GIAIGDTVIIRRAGDVIPQIVGVVAERRPD 400

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           +A+  +FP+ CP+C S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I
Sbjct: 401 NAKKIAFPTACPVCNSAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDI 454

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +G+G++ ++   + E     I  PAD+F L     T+  ++E +   G+ S  N   SI 
Sbjct: 455 DGVGEKLIEQLMERE----LIHTPADLFKL---DHTTLMRLERM---GEKSANNALQSIE 504

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
           K +N +L RF+F+LGIR VG   A++LA ++ +     Q           D  +L +V  
Sbjct: 505 KAKNTTLARFLFALGIRDVGESTAQNLANHFGTLDAIRQA----------DLDTLKQVQD 554

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALL------KEVSPSIGRHEKNVSSEIENKKLVFTGT 657
           VG+++A  + +F+Q P N+  VE L+      ++V P     ++   + +++K +V TGT
Sbjct: 555 VGEVVANRLFQFWQEPHNVEVVEDLIAQGVKWQDVVP-----QEIADNPLKDKTVVLTGT 609

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           L ++ R +A+  + QLG  VS  +S KTD +I G+  GSKL KAQ+LGVKI++E++ +
Sbjct: 610 LTQLTRDQAKALLQQLGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKILSEDELI 667


>gi|119898292|ref|YP_933505.1| DNA ligase (NAD+) [Azoarcus sp. BH72]
 gi|166215393|sp|A1K713|DNLJ_AZOSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119670705|emb|CAL94618.1| DNA ligase (NAD+) [Azoarcus sp. BH72]
          Length = 693

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 273/708 (38%), Positives = 400/708 (56%), Gaps = 61/708 (8%)

Query: 27  EISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSL 86
           EI+ H+  YY    P I D+EYD L R    I  A P+L     P+ P  ++GG     L
Sbjct: 17  EIARHNHAYYVLDTPTIPDAEYDRLFRELQDIEAAHPELL---TPDSPTQRVGGAPLPEL 73

Query: 87  FKVTHSIPTLSL--EKIWNIEDLRKFITRIYRFWQKKD-DNSIFFTLEPKIDGTMITIRY 143
             V H++P LS+  E     + +R F TR+       D D ++ +  E K DG  I++RY
Sbjct: 74  VPVRHAVPMLSIRTETDTTAQGVRNFDTRVRNALGLGDGDPAVEYLSELKFDGLAISLRY 133

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E G  V AA RGDG +GEDV+  +R I  IP  L    P +IEVRGE+Y+ ++DF ALN+
Sbjct: 134 EHGVLVRAATRGDGETGEDVTHNVRTIQQIPLRLHGAAPAVIEVRGEIYMRRDDFEALNN 193

Query: 204 EMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEI-FAKGQYEMLQKM 261
                G K + NPRNAA+G +R+L+P     R L+FF +GLG+ +       Q E+L ++
Sbjct: 194 RQREAGDKVFVNPRNAAAGAVRQLDPRIAARRPLSFFAYGLGEHAGFDLPATQAELLTRL 253

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
              G PV      ++   G++++++ + ++R+ LPYDIDG+VYKV+   LQ++LG   R 
Sbjct: 254 AAFGVPVCEHREVSSGPEGLIAFHDRIAALRNELPYDIDGVVYKVNRVDLQRELGFVTRE 313

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PRW ++HK+  ++  TRL  ID+Q+GRTG LTPVARLEPV +GG  +TNATLHN+D I  
Sbjct: 314 PRWAVAHKYPAQEEITRLAGIDVQVGRTGALTPVARLEPVFVGGVTVTNATLHNQDEID- 372

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF----SFPSFCPIC 437
                      +D+RVGD V+V+RAG+VIP+VV  ++  R  +   F    S+P+ CP+C
Sbjct: 373 ----------RKDVRVGDWVIVRRAGDVIPEVVGPVLERRVGEPPRFNLLASYPT-CPVC 421

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
            S VVR      G+  A  RC+GGL C AQ+ + L HF  R A +IEGLG + ++     
Sbjct: 422 GSHVVR------GEDEAVARCSGGLFCPAQRKQALLHFAGRRAMDIEGLGDKLVEQLVD- 474

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
              A  ++ PAD++ L          + N+   G+ S  NL  +I K RN +L RFIF+L
Sbjct: 475 ---ASIVKTPADLYKL------GILALANLERMGEKSAQNLLAAIEKSRNTTLARFIFAL 525

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ 617
           GIR+VG   A+ LA+++ S       ++ ++A    D  +L +VP VG ++A+ I EF+ 
Sbjct: 526 GIRNVGEATAKDLARHFGS-------LDALLAA---DEGALQQVPDVGPVVAKCIAEFFA 575

Query: 618 NPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
              N+  VE L       +E +P+        S  +     V TGTL  + R +A+  + 
Sbjct: 576 EAHNVEVVEQLRAAGLRWEEGAPA-----APASGSVAGLTFVITGTLPTLSRDEAKALIE 630

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             G  VS  +S+KTD ++ G   GSKL KAQ LGV I++E+    LL+
Sbjct: 631 AHGGKVSGSVSKKTDYLVAGAEAGSKLAKAQDLGVDIVDEDGLRRLLE 678


>gi|237747723|ref|ZP_04578203.1| DNA ligase [Oxalobacter formigenes OXCC13]
 gi|229379085|gb|EEO29176.1| DNA ligase [Oxalobacter formigenes OXCC13]
          Length = 685

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 270/713 (37%), Positives = 405/713 (56%), Gaps = 61/713 (8%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           ++ + L  EI  ++  YY    PI+ DSEYD L R+   +  A P+L     P+ P  ++
Sbjct: 17  EQAARLRSEIERYNIAYYVLDAPIVPDSEYDRLFRQLQELEKAHPELVV---PDSPTQRV 73

Query: 79  GGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           GG + L+ F KV H IP LSL+   + E++  F  RI     + D  ++ +  E K DG 
Sbjct: 74  GG-LPLAQFEKVEHKIPMLSLQNGLSEEEVAAFDKRIS---DELDGENVEYEAELKFDGL 129

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            + +RYE G  V AA RGDG SGE+++  I+ + TIP R+  L  PE++EVRGEV + K 
Sbjct: 130 AVNLRYENGLLVQAATRGDGTSGENITNNIKTVRTIPLRLSDLAPPEVLEVRGEVLMFKK 189

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIFAKGQ 254
           DF  LN       +K + NPRNAA+G LR+L+     TR L FF +GLG+       + Q
Sbjct: 190 DFHDLNRRQRENEQKEFVNPRNAAAGSLRQLDSQITATRQLRFFAYGLGELKGSPLPRSQ 249

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
             +L     LG PV +  +    F G++ ++N ++  R +LPY+IDG+VYKV+  + Q++
Sbjct: 250 SALLDWFVQLGIPVCDERKVVKGFKGLMGFFNRIEEKRESLPYEIDGVVYKVNSIAEQQK 309

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +R+PR+ I+HKF  ++  T +LDID+Q+GRTG +TPVARL+PV +GG  +TNATLH
Sbjct: 310 LGFISRAPRFAIAHKFPAQEVLTEVLDIDVQVGRTGAITPVARLKPVFVGGVTVTNATLH 369

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NED ++            +D+R+GD V+V+RAG+VIP+V+ ++   R  DA+ F  P+ C
Sbjct: 370 NEDEVR-----------RKDVRIGDTVIVRRAGDVIPEVLAVVPERRQADAREFVMPTVC 418

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGG-LACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           P+C S ++R  +       A  RC+GG + C AQ+   L  FVSR A  IEGLG+Q +D 
Sbjct: 419 PVCGSPIIRPEDE------AIARCSGGWIKCPAQKKGGLLLFVSRKALGIEGLGEQLIDQ 472

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
                     I   AD++TL     +   ++       + S +NL   + K +  +  RF
Sbjct: 473 LVDKN----VINDAADLYTLDLETLSQLDRM------AEKSASNLLGELEKSKKTTFARF 522

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +++LGIRHVG   AR+LA Y+ +  N  Q               L+ V  +G I+A +I 
Sbjct: 523 LYALGIRHVGEATARALAGYFGNLANLRQASEE----------QLLEVADIGPIVAASIK 572

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRH-------EKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +F+ + RN+  V+ LL      +G H       EK      +NKK V TGTL  + R  A
Sbjct: 573 QFFSDERNLALVDKLL-----GVGLHWPEHEMKEKPEELPFQNKKFVLTGTLPSLTRDAA 627

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            E +  LG  VS+ +SR TD ++ G  PGSKL KA++LGV++++E +FL L++
Sbjct: 628 AEIIRNLGGKVSSSVSRNTDYVLAGSEPGSKLAKAEELGVRVIDENEFLQLVK 680


>gi|269138493|ref|YP_003295193.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|267984153|gb|ACY83982.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|304558517|gb|ADM41181.1| DNA ligase [Edwardsiella tarda FL6-60]
          Length = 675

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 265/717 (36%), Positives = 407/717 (56%), Gaps = 58/717 (8%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           +IEQ   +L  L   + +H+  YY   +P + D+EYD L  +   +    P L  ++ P+
Sbjct: 4   TIEQ---QLEQLRDALRHHEYQYYVLDEPQVTDAEYDRLMAQLKQLEAEHPALVTADSPS 60

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
               ++GG    +  +V H +P LSL+ +++ E  + F  R++   + K    + F  EP
Sbjct: 61  ---QRVGGAPLAAFGQVHHEVPMLSLDNVFDEESYQAFDKRLHE--RLKSGEPLTFCCEP 115

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEV 191
           K+DG  +++ YE+G  V AA RGDG +GED++A ++ I  IP R+  + IP  IEVRGEV
Sbjct: 116 KLDGLAVSLLYEQGMLVRAATRGDGSTGEDITANVKTIRAIPLRLQGVAIPARIEVRGEV 175

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK-TSEI 249
           ++ ++ F A+N+E    G K +ANPRNAA+G LR+L+P     R L F+ +G G      
Sbjct: 176 FMPQDGFEAMNEEARRRGAKIFANPRNAAAGSLRQLDPRITAQRPLTFYCYGSGLLEGGT 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                Y+ LQ+ +  G PV+  V+       +++YY + +  R  L +DIDG+V KVD+ 
Sbjct: 236 LPDSHYQCLQRFKSWGLPVSERVKLCCGSAEVLAYYRQTEQDRPGLGFDIDGVVIKVDDI 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           ++Q++LG  AR+PRW  + KF  ++  TRL  ++ Q+GRTG +TPVARLEPV + G  ++
Sbjct: 296 AIQERLGFVARAPRWATAFKFPAQEQMTRLNGVEFQVGRTGAITPVARLEPVQVAGVTVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L           D+R+GD V+V+RAG+VIP+VV ++   R  DA    
Sbjct: 356 NATLHNADEIERL-----------DLRIGDTVIVRRAGDVIPQVVGVVEAMRPRDALEIG 404

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+ VA  RC+GGL C+AQ+ E LKHFVSR A ++EG+G +
Sbjct: 405 FPTHCPVCGSEVER----TEGEAVA--RCSGGLICAAQRKESLKHFVSRRAMDVEGMGDK 458

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++     E     +  PAD++ L      S  K+  +   G  S T L  ++ + R  +
Sbjct: 459 VIEQLVDKE----YVATPADLYRL------SAGKLTGLERMGPKSATKLIAALERSRETT 508

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RF+F+LGIR VG   A +LA ++ S Q          A    D  SL RVP VG+++A
Sbjct: 509 LARFLFALGIREVGEATAANLASHFGSLQ----------ALRAADLESLKRVPEVGEVVA 558

Query: 610 QAIVEFYQNPRNICAVEALLK--------EVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             IV F     N   ++ L+         E +P+  +    + S    K +V TG+L  +
Sbjct: 559 SHIVHFLSEAHNRQVIDELISDEVGIRWPEGAPA--QSAPAIDSPFAGKTVVLTGSLSVL 616

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A++ +T LGA VS  +S+KTD++I G+  GSKL KA  LG+++++E Q L +L
Sbjct: 617 SRDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKANALGIEVIDEAQMLRML 673


>gi|227356188|ref|ZP_03840577.1| DNA ligase [Proteus mirabilis ATCC 29906]
 gi|227163652|gb|EEI48568.1| DNA ligase [Proteus mirabilis ATCC 29906]
          Length = 675

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 257/712 (36%), Positives = 417/712 (58%), Gaps = 53/712 (7%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++  L   + +H+  Y+    P I D+EYD L  +  A+    P+L     P+ P  +
Sbjct: 6   QQQIDELRVTLRHHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELI---TPDSPTQR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G     +  +V H IP LSL+  ++      F  R+    + K++  I F  E K+DG 
Sbjct: 63  VGALPLTAFEQVRHEIPMLSLDNAFDETTYLAFDKRLRE--RLKNNEEITFCCELKLDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            +++ YE G+ V AA RGDG +GE+++  +R I  IP R+   NIP  IE+RGEV++++ 
Sbjct: 121 AVSLLYENGRLVQAATRGDGTTGENITENVRTIKAIPLRLYGDNIPARIEIRGEVFMTEK 180

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKG 253
            F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+    
Sbjct: 181 GFEHLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL-PTS 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            Y  LQ+ +  G PV++ ++       ++ +Y+ +  IR  L +DIDG+V KVD+ +LQ+
Sbjct: 240 HYARLQQFKKWGLPVSDAIKLCTGTKAVLDFYHHVAEIRPNLGFDIDGVVIKVDDIALQE 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  +R+PRW I++KF  ++  T + D++ Q+GRTG +TPVARL+PV + G +++NATL
Sbjct: 300 ELGFVSRAPRWAIAYKFQAQEQMTVIKDVEFQVGRTGAITPVARLDPVQVAGVIVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            +R+GD V+++RAG+VIP+VV +I  +R  +AQ   FP+ 
Sbjct: 360 HNADEIERL-----------GLRIGDTVVIRRAGDVIPQVVSVIEEKRPENAQEIVFPTQ 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPICQS    D+    G+ VA  RCTGGL C+AQ+ E LKHFVSR A +++G+G + +D 
Sbjct: 409 CPICQS----DIERIEGEAVA--RCTGGLICAAQRKEALKHFVSRRAMDVDGMGDKIIDQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + E     ++ PAD+F L  +  +   ++      G+ S   L +++ K ++ +  RF
Sbjct: 463 LVEKE----YVKTPADLFRLDEKILSGLERM------GEKSAKKLLNALEKAKSTTFARF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           I++LGIR VG   A  L  +++S +   +   NI A        L  VP VGDI+A+ +V
Sbjct: 513 IYALGIREVGEATANGLTAHFVSLEALREA--NIEA--------LKAVPDVGDIVAKHVV 562

Query: 614 EFYQNPRNICAVEALLKEV-----SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            F+Q   N   ++ L+ ++     +P +  HE    +    K +V TG+L ++ R +A++
Sbjct: 563 NFFQEEHNKNVIDQLVNDIGITWPAPVVATHEAG-DNPFAGKTVVLTGSLSQLTRDEAKD 621

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LGA VS  +S+KTD++I G+  GSKL KA +LG+ +++E++ + LL+Q
Sbjct: 622 RLVALGAKVSGSVSKKTDMVIAGEAAGSKLAKANELGITVIDEDEMIRLLEQ 673


>gi|325576592|ref|ZP_08147310.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
 gi|325161155|gb|EGC73270.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
          Length = 675

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 264/712 (37%), Positives = 416/712 (58%), Gaps = 47/712 (6%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  +I   ++++ +L  ++  ++  Y+    P I D+EYD L  +  A+  A P+L  
Sbjct: 4   PLE--NIMSLQQQIDTLRHDLRRYEYEYHVLDNPTIPDAEYDRLFHQLKALEAAHPELIT 61

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           ++ P     ++G +      ++ H IP LSL+  ++ E+   F+ RI     +  +  + 
Sbjct: 62  ADSPT---QRVGAKPLSGFAQIRHEIPMLSLDNAFSDEEFYAFVKRIEDRLIRLPE-PLT 117

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIE 186
           F  EPK+DG  ++I Y  G    AA RGDG +GED++A IR I  IP ++L  N P  +E
Sbjct: 118 FCCEPKLDGLAVSILYVNGILTQAATRGDGATGEDITANIRTIRNIPLQLLMDNPPARLE 177

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGK 245
           VRGEV++    F  LN + +  G K +ANPRNAA+G LR+L+P   + R L    +G+G 
Sbjct: 178 VRGEVFMPHAGFERLNQQALEKGEKTFANPRNAAAGSLRQLDPKITSKRPLVLNAYGIGI 237

Query: 246 TSEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
              +      Y+ LQ ++ +G PVN  +R  N    ++ +Y ++++ RS L YDIDG V 
Sbjct: 238 AEGVDLPNTHYDRLQWLKSIGIPVNPEIRLCNGTDEVLDFYRDIQNKRSALGYDIDGTVL 297

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           K+++ +LQ++LG  +++PRW I++KF  ++  TRL D++ Q+GRTG +TPVA+LEPV + 
Sbjct: 298 KINDIALQEKLGFISKAPRWAIAYKFPAQEELTRLNDVEFQVGRTGAITPVAKLEPVFVA 357

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G  ++NATLHN D I+ L           DI +GD V+++RAG+VIP+++ ++ + R  D
Sbjct: 358 GVTVSNATLHNGDEIERL-----------DIAIGDTVVIRRAGDVIPQIIGVLHDRRPAD 406

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+P  FP  CP+C S +VR      G+ VA  RCTGGL C+AQ+ E LKHFVSR A +I+
Sbjct: 407 ARPIVFPKTCPVCDSAIVR----IEGEAVA--RCTGGLFCAAQRKEALKHFVSRKAMDID 460

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           G+G + ++     E     +  PAD+F L     T+ T++E +   G  S  N   S+ K
Sbjct: 461 GVGGKLIEQLVDRE----LVHTPADLFKL---DLTTLTRLERM---GAKSAENALASLEK 510

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
            +N +L RFIF+LGIR VG   A +LA ++ + +          A  N D  +L +VP V
Sbjct: 511 AKNTTLARFIFALGIREVGEATALNLANHFKTLE----------ALQNADLEALQQVPDV 560

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           G+++A  I+ F+  P N+  V  L+ + V       ++   +  + K +V TGTL ++ R
Sbjct: 561 GEVVANRILAFWHEPHNVAVVNDLIAQGVRWETVETKEVAENRFKGKTVVLTGTLTQMGR 620

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           ++A+  +  +GA VS  +S KTD +I GD  GSKL KAQ+LGV ++ EE+FL
Sbjct: 621 NEAKALLQDMGAKVSGSVSAKTDFVIAGDAAGSKLTKAQELGVTVLTEEEFL 672


>gi|163845839|ref|YP_001633883.1| DNA ligase [Chloroflexus aurantiacus J-10-fl]
 gi|222523550|ref|YP_002568020.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
 gi|190359243|sp|A9WCA1|DNLJ_CHLAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781286|sp|B9LHI6|DNLJ_CHLSY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163667128|gb|ABY33494.1| DNA ligase, NAD-dependent [Chloroflexus aurantiacus J-10-fl]
 gi|222447429|gb|ACM51695.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
          Length = 709

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 270/713 (37%), Positives = 384/713 (53%), Gaps = 60/713 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           EL SL +   YH   YY    PI+ D+EYDAL     A+  A P+L     P+ P  ++ 
Sbjct: 12  ELRSLIRRYDYH---YYVLDDPIVSDAEYDALMTELRALEAAHPELI---TPDSPTQRVS 65

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
           G       KV H  P LSL   +   DL  +  R+ R      D  + + +EPKIDG  +
Sbjct: 66  GTPASQFAKVQHPQPMLSLGNAFTKADLLAWRDRVLRLLGP--DAIVAYVVEPKIDGLAV 123

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-----------LNIPEIIEVR 188
            + Y  G+ V  A RGDG  GEDV+A +R I +IP  L              +P  IEVR
Sbjct: 124 ALTYRDGRLVQGATRGDGEVGEDVTANLRTIGSIPLTLQATSTPQDDDLPTTLPTTIEVR 183

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+   DF  LND + A G K +ANPRNAA+G LR+ +PT    R L FF +G+G   
Sbjct: 184 GEVYMRTADFETLNDRLAAAGEKIFANPRNAAAGSLRQKDPTITAARPLRFFAYGVGVVE 243

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
            I    Q++ L+ +R LGFPVN  VR+   F  +++Y     + R  LPY+ DG+V K+D
Sbjct: 244 GISLSSQWQTLRYLRALGFPVNQDVRRFTDFAEVLAYCEAWMAKRDDLPYEADGVVIKID 303

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +F+ Q++LG   R PRW I+ KF  ++A TRLLDI + +GRTG++TP A LEPV IGG  
Sbjct: 304 DFAQQRELGVVGRDPRWAIAFKFPAREAITRLLDITVNVGRTGVVTPNAELEPVQIGGVT 363

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           + NA+LHN DYI             RDIR+GD V+VKRAG+VIP VV  ++  R    +P
Sbjct: 364 VRNASLHNADYI-----------AQRDIRIGDYVIVKRAGDVIPYVVGPVIARRDGSERP 412

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           + FP+ CP C S + R+         AA RC     C AQ + R++HFVSR A +I G+G
Sbjct: 413 WQFPTHCPACGSPLEREEGE------AAWRCNNFSICPAQLVRRVEHFVSRSALDIVGMG 466

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q + F +       IR  ADIF L+  Q      +  + GFG   + NL  +I+  R 
Sbjct: 467 ERQAELFVQRG----LIRDVADIFFLKADQ------LAELEGFGPKRIANLLAAIDAARQ 516

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
             L+R +  LGIR+VG   A++L     S       ++ I+A   ++   L ++P +G +
Sbjct: 517 RPLDRLLVGLGIRYVGTVAAQTLVAALGS-------LDAIMAARQEE---LEQIPGIGPV 566

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIG--RHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +A +IV+F+  P N   +E  L+     +G        S  +  K  V TGTL  + R +
Sbjct: 567 VAASIVDFFSRPANRALIEK-LRAAGVQMGGVSGPTRQSDTLAGKTFVLTGTLPSLSREQ 625

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A   +   G  V+  +S+KT  ++ G N GSKL KA QLG+ +++E   L L+
Sbjct: 626 ASALIVAHGGKVTDSVSKKTSYVVAGANAGSKLAKALQLGIPVIDEAGLLALI 678


>gi|219870289|ref|YP_002474664.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis SH0165]
 gi|254781340|sp|B8F314|DNLJ_HAEPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219690493|gb|ACL31716.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis SH0165]
          Length = 675

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 265/708 (37%), Positives = 417/708 (58%), Gaps = 49/708 (6%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           SIE   + L    +E  YH   Y+    P++ D+EYD L      +    P+L  S+ P 
Sbjct: 4   SIETQLEHLREKLREYEYH---YHVLDNPLVPDAEYDRLMNELKNLEWQHPELITSDSPT 60

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
               ++G +      ++TH IP LSL+  ++ +DL  F+ RI       + N I F  EP
Sbjct: 61  ---QRVGAKPLDGFAQITHEIPMLSLDNAFSDDDLTGFLRRIEDRI-AINSNQIEFCCEP 116

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEV 191
           K+DG  ++I Y  G    AA RGDG +GED++A IR I  IP ++ + N P  +EVRGEV
Sbjct: 117 KLDGLAVSILYVDGVLTQAATRGDGTTGEDITANIRTIRNIPLKLKTNNPPHRLEVRGEV 176

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGLGKTSE 248
           ++ +  F  LN++ +A G K +ANPRNAA+G LR+L+P   ++    LN +  G+ ++ +
Sbjct: 177 FMPQQGFEQLNEKALAKGEKTFANPRNAAAGSLRQLDPKITSQRPLMLNAYNIGVYESDD 236

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 ++ LQ ++ LG PVN  +  A     + ++Y ++++ RS+L YDIDG V KV+E
Sbjct: 237 ELPTTHFDRLQWLKTLGIPVNAEITLATGSQALTAFYQKIQAKRSSLGYDIDGTVLKVNE 296

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  +++PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  +
Sbjct: 297 ITLQEQLGFISKAPRWAIAYKFPAQEEMTILNDVEFQVGRTGAITPVAKLEPVFVAGVTV 356

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            I +GD V+++RAG+VIP++V ++   R  +A+  
Sbjct: 357 SNATLHNGDEIERL-----------GIAIGDTVIIRRAGDVIPQIVGVVAERRPDNAKKI 405

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
           +FP+ CP+C S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G+
Sbjct: 406 AFPTACPVCNSAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGE 459

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++   + E     I  PAD+F L     T+  +++ +   G+ S  N   SI K +N 
Sbjct: 460 KLIEQLMERE----LIHTPADLFKL---DHTTLMRLDRM---GEKSANNALQSIEKAKNT 509

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF+F+LGIR VG   A++LA ++ +     Q           D  +L +V  VG+++
Sbjct: 510 TLARFLFALGIRDVGESTAQNLANHFGTLDAIRQA----------DLDTLKQVQDVGEVV 559

Query: 609 AQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           A  + +F+Q P N+  VE L+ + V+      ++   + +++K +V TGTL ++ R +A+
Sbjct: 560 ANRLFQFWQEPHNVEVVEDLIAQGVTWQDVVPQEIADNPLKDKTVVLTGTLTQLTRDQAK 619

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
             + QLG  VS  +S KTD +I G+  GSKL KAQ+LGVKI++E++ +
Sbjct: 620 ALLQQLGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKILSEDELI 667


>gi|260598800|ref|YP_003211371.1| NAD-dependent DNA ligase LigA [Cronobacter turicensis z3032]
 gi|260217977|emb|CBA32625.1| DNA ligase [Cronobacter turicensis z3032]
          Length = 672

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 259/716 (36%), Positives = 416/716 (58%), Gaps = 53/716 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R   A+  A P+L     P+ 
Sbjct: 1   MESIEEKLTQLRTTLRHHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++      F  R+    + K+ +++ +  E K
Sbjct: 58  PTQRVGAAPLTAFSQVRHEVPMLSLDNVFDEASFLAFNKRVQD--RLKNTDALVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GED++  +R I  IP ++   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVRAATRGDGTTGEDITLNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQTGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRVTAKRPLTFFCYGVGLLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             +     LQ+ +  G PV++ +R   T   ++++Y ++++ R TL +DIDG+V KVD  
Sbjct: 236 -PRSHMARLQQFKAWGLPVSDRIRLVKTPEDVLAFYRQVEADRPTLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++
Sbjct: 295 ELQEQLGFVARAPRWAVAFKFPAQEQLTTVRDVEFQVGRTGAITPVARLEPVQVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  
Sbjct: 355 NATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+  A  RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPTQCPVCGSDVER----VEGE--AVTRCTGGLICGAQRKEALKHFVSRRAMDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  NL  ++ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNLVTALEKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA ++ + +     IN  I    DD   L +VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHFGTLEAL---INASI----DD---LQKVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEV-----SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
             +  F++   N   +  L +EV     +P + + E+ + S    K +V TG+L ++ R 
Sbjct: 558 THVFNFFEEESNRAVIRDLTEEVGIHWPAPQVVKAEE-IDSPFAGKTVVLTGSLSQMSRD 616

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            A+  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL +
Sbjct: 617 DAKARLAALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMLRLLGE 672


>gi|319941620|ref|ZP_08015944.1| DNA ligase [Sutterella wadsworthensis 3_1_45B]
 gi|319804850|gb|EFW01704.1| DNA ligase [Sutterella wadsworthensis 3_1_45B]
          Length = 745

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 266/722 (36%), Positives = 402/722 (55%), Gaps = 53/722 (7%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ALS +QA   +  LE E+   +  YY   +P + D+EYD       A+   FP+L   + 
Sbjct: 51  ALSPDQAPARMHQLETELERWNYEYYVLDEPSVPDAEYDRAFNELKALEARFPEL---KS 107

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSL--EKIWNIEDLRKFITRIYR-FWQKKDDNSIF 127
              P  ++GG +     KV H +P LS+  E  ++      F  R+        +D  + 
Sbjct: 108 RTSPTLRVGGAVRTGFKKVRHDVPMLSIHTETDFSAAGAAAFDERVRSALGLSPEDPPVE 167

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           +  E K DG    +RYEKG    A+ RGDG  GEDV+A +R I TIP  L+  +P+I+EV
Sbjct: 168 YDCELKFDGLATNLRYEKGVLTEASTRGDGVEGEDVTANVRTIRTIPLRLNGKVPDILEV 227

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGE  + K DFLALN    A G KP+ANPRNAA+G LR+L+ +    R L+F+ + LG+ 
Sbjct: 228 RGECIMHKADFLALNARQEAAGEKPFANPRNAAAGSLRQLDSSVTAQRTLHFYGYSLGEV 287

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE FA+ Q  +L +   LGFPV +          + ++++++ + R++LP++IDG+VYKV
Sbjct: 288 SEPFAETQSGVLDRFAELGFPVAHMREVVKGPEALAAFHDKVAAARASLPFEIDGVVYKV 347

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +   L+++LG  AR PRW  +HK+  ++  T++L ID+Q+GRTG LTPVARL PV +GG 
Sbjct: 348 NSLELEEELGFIAREPRWACAHKYPPEEVLTQVLGIDVQVGRTGRLTPVARLAPVYVGGV 407

Query: 367 LITNATLHNEDY-IKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++NATLHNED+ +K L           D+RVGD V+++RAG+VIP+++ ++   R    
Sbjct: 408 TVSNATLHNEDHVVKDL-----------DLRVGDTVVLRRAGDVIPEILRVVKERRPAGT 456

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + F  P  CPIC S V+RD   K        RCTGGL C AQ    + HF +R A  I+G
Sbjct: 457 KVFEMPHVCPICGSAVIRDEEEKD------MRCTGGLVCPAQMKLSIVHFAARRAMGIDG 510

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQ-------RRQQTSTTKIENILGFGDVSVTNL 538
           LG++ +D      D    ++ PAD+F L              + K E  +  G  +  NL
Sbjct: 511 LGEKIVDMLV---DEGL-VKTPADLFGLTLEALTAPTTATAGSEKPEKRM--GPKAAANL 564

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
             SI    + +L RF+F+LG RHVG   A  LA ++            + A  N    +L
Sbjct: 565 LASIQASTHTTLARFVFALGCRHVGEATALGLANHF----------GTLSAIENASMEAL 614

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV--SPSIGRHEKNVSSEIENKKLVFTG 656
             VP VG+++A++I  F++ P N   ++AL+      P++   EK   S +  K  V TG
Sbjct: 615 TGVPDVGEVVAESIYAFFREPHNRTVIDALIARGIRWPAV---EKTAPSLVSGKTFVLTG 671

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           TL  + R +A++ +T  GA V+  +SR+T  ++ G + GSKL KA++LG+ +++E + L 
Sbjct: 672 TLPTLSRDEAKDRLTAQGAKVAGSVSRRTWCVVAGADAGSKLSKAEELGIPVIDEAKLLM 731

Query: 717 LL 718
           LL
Sbjct: 732 LL 733


>gi|187477571|ref|YP_785595.1| DNA ligase [Bordetella avium 197N]
 gi|123752160|sp|Q2KUU5|DNLJ_BORA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115422157|emb|CAJ48681.1| DNA ligase [Bordetella avium 197N]
          Length = 695

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 278/735 (37%), Positives = 408/735 (55%), Gaps = 74/735 (10%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           + AR++ + L  EI+ H+  YY Y +P I D++YDAL R   A+    P+L     P+ P
Sbjct: 6   QAAREQAARLRAEIAQHNIRYYVYDEPSITDADYDALMRELMALEAQHPELV---TPDSP 62

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD-----DNSIFFT 129
             ++G         V H++P LSL   +  ED+  F  R+    ++       + + +F 
Sbjct: 63  TQRVGAAPLAEFGSVRHAVPMLSLGNGFEDEDVLAFDKRVSDTLREAGLLGPAEQAHYFC 122

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            E K+DG  I++RYE G+ V AA RGDG  GEDV+A IR I  IP  L    P ++EVRG
Sbjct: 123 -ELKLDGLAISLRYENGELVQAATRGDGQEGEDVTANIRTIRAIPLQLRAGAPAVLEVRG 181

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFF------VHG 242
           EV +++ DF  LN +  A G K + NPRNAA+G LR+L+P     R L FF      V G
Sbjct: 182 EVLMNRADFEKLNQKQAARGEKIFVNPRNAAAGSLRQLDPRVTAQRPLRFFAYSWGEVQG 241

Query: 243 L-------------GKTSEIFAKGQYEMLQKMRCLGFPVNNGVR---QANTFHGIVSYYN 286
           L             G  S +       ML  +  LG PVN  VR   +A    G++++Y 
Sbjct: 242 LSRDDAPAFDEASPGLVSTLPRDTHGGMLDWLAGLGLPVN--VRFNHKAQGAEGLLAFYR 299

Query: 287 EMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQI 346
            + + R +LPYDIDGLVYKVD  + Q+ LG  AR+PRW ++HKF  ++A+T LLDI++Q+
Sbjct: 300 RIGAERGSLPYDIDGLVYKVDALAAQRVLGYVARAPRWALAHKFPAEEATTELLDIEVQV 359

Query: 347 GRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRA 406
           GRTG +TPVARL+PV +GG  +TNATLHNED I+            +D+R+GDRV+V+RA
Sbjct: 360 GRTGAITPVARLKPVFVGGVTVTNATLHNEDEIR-----------RKDVRIGDRVIVRRA 408

Query: 407 GEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSA 466
           G+VIP+VV  ++ +R  +   F  P+ CPIC S + R ++       A  RCTGGL C A
Sbjct: 409 GDVIPEVVGPVLEKRSGELPQFVMPTHCPICGSAIERLVDE------AIARCTGGLFCPA 462

Query: 467 QQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIEN 526
           Q+ + L H   R A +IEGLG++ ++    +     S++  AD+F L   +  +  ++  
Sbjct: 463 QRKQTLLHAAGRKALDIEGLGEKLVEQLVDNG----SLKTLADVFRLNAFELAALDRM-- 516

Query: 527 ILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINN 586
               G  S  NL  +I++ R  SL R +F+LGIRHVG   AR +A+++           N
Sbjct: 517 ----GKKSADNLVAAIDQARRPSLGRLLFALGIRHVGETTARDVARHF----------GN 562

Query: 587 IIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSS 645
           I A  + D  +L+ VP VG ++A +I  F+Q   N   +  L K+ V P      +  S 
Sbjct: 563 IDAIMDADEAALLAVPDVGPVVAGSIHRFFQEAHNREVIRELEKQGVHPQA--EAQLQSG 620

Query: 646 EIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG 705
           ++  K  V TGT+    R +A  ++   G  VS  +S+KT  ++ G+  GSKL KA++LG
Sbjct: 621 DLAGKTFVLTGTMPTWSRDEATRHILAAGGKVSGSVSKKTAYVVAGEEAGSKLVKARELG 680

Query: 706 VKIMNEEQFLFLLQQ 720
           V I++E+    LL Q
Sbjct: 681 VTILDEDGLKALLSQ 695


>gi|149374973|ref|ZP_01892746.1| DNA ligase, NAD-dependent [Marinobacter algicola DG893]
 gi|149360862|gb|EDM49313.1| DNA ligase, NAD-dependent [Marinobacter algicola DG893]
          Length = 676

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 258/699 (36%), Positives = 400/699 (57%), Gaps = 47/699 (6%)

Query: 28  ISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLF 87
           I+ H+  YY    P + D+EYD L R    +   +PD+     P+ P  ++GG +  +  
Sbjct: 19  ITEHNYQYYVLDDPRVPDAEYDRLFRELQDLETQYPDIVT---PDTPTRRVGGSVETTFE 75

Query: 88  KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGK 147
           +V H IP LSL+  ++ E+LR F  R+    +  DD  I +  EPK+DG  +++ YE G 
Sbjct: 76  EVVHRIPMLSLDNAFSDEELRDFDRRVKDRLKTGDD--IEYVCEPKLDGLAVSLHYESGV 133

Query: 148 FVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMI 206
              AA RGDG++GED++A IR IP++P R+    +PE++EVRGEVY+ +  F ALN  + 
Sbjct: 134 LTRAATRGDGYTGEDITANIRTIPSVPLRLRGDKVPELVEVRGEVYMPREGFEALNRRLA 193

Query: 207 AVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGKTSE-IFAKGQYEMLQKMRCL 264
             G K + NPRNAA+G LR+  PT   R  L    + +    E +     +E LQ++   
Sbjct: 194 NKGEKTFVNPRNAAAGSLRQKKPTVTARRPLELCAYSVALEDESLLPATHWEGLQQVSAW 253

Query: 265 GFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRW 324
           GF +N  +R+A      +  YNE+   R++LPY+IDG+V+KV+  +LQ+QLG  +R+PRW
Sbjct: 254 GFRINPEMRRATGAEDCLQAYNELMGKRASLPYEIDGIVFKVNSLALQQQLGFVSRAPRW 313

Query: 325 MISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDA 384
            I+ KF  ++  T + D++ Q+GRTG +TPVARL+PV +GG  ++NATLHN D I+ LDA
Sbjct: 314 AIAQKFPAQEELTVIEDVEFQVGRTGAITPVARLKPVFVGGVTVSNATLHNMDEIRRLDA 373

Query: 385 SGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRD 444
                      R+GD V V+RAG+VIP+VV ++   R  +A+    P  CP+CQS +V+ 
Sbjct: 374 -----------RIGDTVFVRRAGDVIPQVVKVVAERRPANAREVELPDACPVCQSDIVQ- 421

Query: 445 LNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSI 504
                G++VA  RC+GGL C AQ+ E ++H+ SR A +IEGLG + +D     E     +
Sbjct: 422 ---IEGEVVA--RCSGGLFCPAQRKEAIRHYASRKALDIEGLGDKWIDILVDRE----LV 472

Query: 505 RIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGA 564
              AD++ L++   T   ++      G+ S  NL D+I++ R   L +F+++LGIR VG 
Sbjct: 473 NTVADLYLLKKADLTGLERM------GEKSAGNLIDAIDRSRKPVLWKFLYALGIREVGE 526

Query: 565 EIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICA 624
             A+ LA Y+ + ++        I+  ++D  +L  VP VG I+A  I  F+    N   
Sbjct: 527 ATAKGLASYFGTLES--------ISEADED--ALQSVPDVGPIVAGHIRSFFDQTHNQET 576

Query: 625 VEALLKEVSPSIGRHEKNVSSE-IENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
           ++A LK+        E   S + ++ +  V TG+L  + R  A+  +  LGA V+  +S 
Sbjct: 577 IQA-LKDAGVQWQAEEITASQKPLKGETWVLTGSLSGMTRDDAKSKLESLGAKVAGSVSG 635

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           KT  ++ G+  GSKL KA+ LGV +M+E  F+  L  + 
Sbjct: 636 KTSCVVAGEAAGSKLTKAENLGVPVMDESAFVDFLATHG 674


>gi|197285679|ref|YP_002151551.1| NAD-dependent DNA ligase LigA [Proteus mirabilis HI4320]
 gi|254781393|sp|B4EZR2|DNLJ_PROMH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194683166|emb|CAR43788.1| DNA ligase [Proteus mirabilis HI4320]
          Length = 675

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 257/712 (36%), Positives = 416/712 (58%), Gaps = 53/712 (7%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++  L   + +H+  Y+    P I D+EYD L  +  A+    P+L     P+ P  +
Sbjct: 6   QQQIDELRVTLRHHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELIT---PDSPTQR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G     +  +V H IP LSL+  ++      F  R+    + K++  I F  E K+DG 
Sbjct: 63  VGALPLTAFEQVRHEIPMLSLDNAFDETTYLAFDKRLRE--RLKNNEEITFCCELKLDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            +++ YE G+ V AA RGDG +GE+++  +R I  IP R+   NIP  IE+RGEV++++ 
Sbjct: 121 AVSLLYENGRLVQAATRGDGTTGENITENVRTIKAIPLRLYGDNIPARIEIRGEVFMTEK 180

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKG 253
            F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+    
Sbjct: 181 GFEHLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL-PTS 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            Y  LQ+ +  G PV++ ++       ++ +Y+ +  IR  L +DIDG+V KVD+ +LQ+
Sbjct: 240 HYARLQQFKKWGLPVSDAIKLCTGTKAVLDFYHHVAEIRPNLGFDIDGVVIKVDDIALQE 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  +R+PRW I++KF  ++  T + D++ Q+GRTG +TPVARL+PV + G +++NATL
Sbjct: 300 ELGFVSRAPRWAIAYKFQAQEQMTVIKDVEFQVGRTGAITPVARLDPVQVAGVIVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            +R+GD V+++RAG+VIP+VV +I  +R  +AQ   FP+ 
Sbjct: 360 HNADEIERL-----------GLRIGDTVVIRRAGDVIPQVVSVIEEKRPENAQEIVFPTQ 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPICQS    D+    G+ VA  RCTGGL C+AQ+ E LKHFVSR A +++G+G + +D 
Sbjct: 409 CPICQS----DIERIEGEAVA--RCTGGLICAAQRKEALKHFVSRRAMDVDGMGDKIIDQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + E     ++ PAD+F L  +  +   ++      G+ S   L +++ K ++ +  RF
Sbjct: 463 LVEKE----YVKTPADLFRLDEKILSGLERM------GEKSAKKLLNALEKAKSTTFARF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           I++LGIR VG   A  L  +++S +   +   NI A        L  VP VGDI+A+ +V
Sbjct: 513 IYALGIREVGEATANGLTAHFVSLEALREA--NIEA--------LKAVPDVGDIVAKHVV 562

Query: 614 EFYQNPRNICAVEALLKEV-----SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            F+Q   N   ++ L+ ++     +P +  HE    +    K +V TG+L ++ R +A++
Sbjct: 563 NFFQEEHNKNVIDQLVNDIGITWPAPVVATHEAG-DNPFAGKTVVLTGSLSQLTRDEAKD 621

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LGA VS  +S+KTD++I G+  GSKL KA +LG+ +++E++ + LL Q
Sbjct: 622 RLVALGAKVSGSVSKKTDMVIAGEAAGSKLAKANELGITVIDEDEMIRLLDQ 673


>gi|88607345|ref|YP_504763.1| DNA ligase, NAD-dependent [Anaplasma phagocytophilum HZ]
 gi|123736456|sp|Q2GLI8|DNLJ_ANAPZ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|88598408|gb|ABD43878.1| DNA ligase, NAD-dependent [Anaplasma phagocytophilum HZ]
          Length = 677

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 263/716 (36%), Positives = 413/716 (57%), Gaps = 43/716 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S   +R+ L+ L  ++  HD  Y+++  P I D++YDAL +    +   FP+L+   D 
Sbjct: 1   MSDNDSRRRLADLNAQLKLHDVLYHEHDAPEISDAQYDALVQEKRELLEKFPELSAYNDY 60

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
            G +  +   ++  L K+ H  P LSLE  + I+D+ KFI+R+ R      + SI    E
Sbjct: 61  EGVIGAL--TVDARLPKIAHREPMLSLENSFTIQDVEKFISRVKRSLNMDPEVSITIACE 118

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG      YEKG  +  A RG+GH GED++   + I  +P  ++ N PE++EVRGE+
Sbjct: 119 PKIDGLSFAALYEKGSLIRVATRGNGHLGEDITNTAKVIRKLPHKIA-NAPEVLEVRGEI 177

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKTSEIF 250
           Y+  +DF  L D         +ANPRNAA+G +R+LNP     R L +  + +  ++   
Sbjct: 178 YMHHSDFEKLKDVC------NFANPRNAAAGSIRQLNPKIAEERNLRYVAYCIVNSA--- 228

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
              Q  +L+++   GF  +  V  A+     +S++  M + RSTL YDIDG+VYKV++  
Sbjct: 229 LASQEAILKQLAEWGFCTHTEVLFADNMDDALSFHTRMYNTRSTLGYDIDGIVYKVNDTH 288

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQK LG  ++ PRW  +HKF   +A T+L DI +Q+GRTG++TP+A LEP+NIGG L++ 
Sbjct: 289 LQKLLGSTSKYPRWATAHKFPSTEAITKLRDISVQVGRTGVITPIAELEPINIGGTLVSR 348

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP--F 428
           A+LHN + I             +DIR+GD V+VKRAGEVIP+VV +    R   A P  +
Sbjct: 349 ASLHNLNEI-----------ARKDIRIGDSVIVKRAGEVIPQVVGVDHTARCNSAVPEEY 397

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FPS CP C S + R      G++  A RCT  L+C AQ LER+KHFVSRD  NI GLG+
Sbjct: 398 VFPSHCPSCGSTLSR----APGEV--AMRCTAELSCQAQVLERVKHFVSRDGLNIVGLGE 451

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           +Q++FF      A  I   ADIF+L  R++ S   +    G+G+ S+  L ++IN    +
Sbjct: 452 KQIEFFCN----ASYISNVADIFSL--REKISHMNLSAEHGWGEKSIALLINAINASTTV 505

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
            L  FIF+LGIR +G   A+ +A++Y SY  + + + ++    + D +  I +  +    
Sbjct: 506 KLSNFIFALGIRFIGKGAAKLIAEHYRSYSAWVRAMTSLANGEDPDNIHGIGLKSI---- 561

Query: 609 AQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            +++  F+ +  N+  ++ L ++++          +S I  K +VFTG L+ + R++A +
Sbjct: 562 -ESLRAFFSSEDNLRVLQTLEEKLNILNEIANTETASPISGKTIVFTGVLEDMSRNEAAK 620

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTT 724
           Y   LGA V   ++ KTDI++ G N GSKL+ A++LG+++MNE ++  LL+  + +
Sbjct: 621 YAETLGAKVGNTVTTKTDILVAGSNSGSKLDTARKLGIQVMNESEWKDLLKTVSNS 676


>gi|332306125|ref|YP_004433976.1| DNA ligase, NAD-dependent [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173454|gb|AEE22708.1| DNA ligase, NAD-dependent [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 677

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 272/721 (37%), Positives = 413/721 (57%), Gaps = 57/721 (7%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ALS  Q   +L +   E +Y    YY    P + D+EYD L R    I  A PDL RS  
Sbjct: 4   ALSPAQRLTQLINTINEYNYQ---YYVQDNPSVPDAEYDRLMRELLDIEKAHPDL-RS-- 57

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+ P  K+GG    +  +V H +P LSL+  ++ +D+  F  RI    + K  + I F+ 
Sbjct: 58  PDSPSQKVGGAALSAFEQVEHEVPMLSLDNAFDEDDMFAFEKRIKD--RLKITSEISFSC 115

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL---NIPEIIEV 187
           EPK+DG  ++I YE GK V AA RGDG  GE+++  +R I  +P  LSL   + P+ +EV
Sbjct: 116 EPKLDGLAVSILYEDGKLVRAATRGDGRVGENITTNVRTIANVP--LSLRGEDFPQRLEV 173

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG-- 244
           RGEV +++  F  LN+  I  G+KP+ NPRNAA+G LR+L+P     R L F+ + LG  
Sbjct: 174 RGEVIMTRAGFDILNEAQIKKGKKPFVNPRNAAAGSLRQLDPKITAARPLLFYSYSLGLV 233

Query: 245 -KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
               +         L+++   G P++  +  A      ++Y++++  +RS L YDIDG+V
Sbjct: 234 ENEQQPLGTTHSARLKQLSDWGLPLSKELEVAQGAKECLTYFHKIGELRSQLSYDIDGVV 293

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           +KVD+ ++Q+ LG  AR+PRW I+HKFA ++  + LLD++ Q+GRTG +TPVARL P  +
Sbjct: 294 FKVDDIAMQQTLGFVARAPRWAIAHKFAAQEEMSTLLDVEFQVGRTGAITPVARLAPTFV 353

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG  ++NATLHN+D I  L            I++GD V+++RAG+VIP++V I+ ++R  
Sbjct: 354 GGVTVSNATLHNQDEINRL-----------GIKIGDSVIIRRAGDVIPQIVAIVADKRPD 402

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           DA+   FP  CP+C S V +      G+ VA  RCTGGL C AQ+ E +KHF SR A +I
Sbjct: 403 DAKDILFPESCPVCSSAVEK----LEGEAVA--RCTGGLYCKAQRKEAMKHFASRKALDI 456

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +GLG + ++    ++     ++ PAD F L     +S  ++      G+ S  NL +S+ 
Sbjct: 457 DGLGDKLIEQLVDAD----MVKSPADFFALDIAPLSSMERM------GEKSAVNLVNSLG 506

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
           K +  +L +F++SLGIR VG   A++LA ++L+     Q           D  +L  V  
Sbjct: 507 KSKKTTLAKFLYSLGIREVGEATAQNLALHFLTLDAIEQA----------DLDALQAVSD 556

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKI 661
           VG I+AQ +V F++   N+  + A L+E      + EK    E  +  +  V TGTL  +
Sbjct: 557 VGIIVAQHVVNFFKEEHNLEVISA-LQEAGVHWPKIEKIAVDELPLAGQVYVLTGTLNVM 615

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R++A+  +  LGA VS  +S KTD ++ G+  GSKL KAQ LGVK+MNE++ L +  + 
Sbjct: 616 DRNQAKAKLQSLGAKVSGSVSAKTDCLVAGEKAGSKLTKAQDLGVKVMNEDEMLAMFAEL 675

Query: 722 N 722
           +
Sbjct: 676 D 676


>gi|148259769|ref|YP_001233896.1| DNA ligase, NAD-dependent [Acidiphilium cryptum JF-5]
 gi|166215383|sp|A5FWJ5|DNLJ_ACICJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146401450|gb|ABQ29977.1| DNA ligase, NAD-dependent [Acidiphilium cryptum JF-5]
          Length = 682

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 269/700 (38%), Positives = 407/700 (58%), Gaps = 44/700 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           +  L+ L + ++  D  YY+   PI+ D+ YDAL+R  +++  A PDLA +      L++
Sbjct: 15  KARLAELVERLAAADAAYYRDDAPIMDDAAYDALRREAESLRAAHPDLAAA------LDQ 68

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G   + +  KV H +P LSL+ ++   D  +F   I RF        + F  EPKIDG 
Sbjct: 69  VGAAPSGAFGKVRHRLPMLSLDNVFEPADFVEFCASIRRFL-GLGAAPLAFVAEPKIDGL 127

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKND 197
            I++ YE  +FV  A RGDG  GEDV+  +R +  +P  L  + P+ IE+RGEVY++K D
Sbjct: 128 SISLTYENRRFVRGATRGDGTEGEDVTENLRTLRELPATLPDDAPDFIEIRGEVYMTKTD 187

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYE 256
           F+ LN        + +ANPRNAA+G LR+L+P    +R L+ F +  G  S+   +  ++
Sbjct: 188 FITLNQGQA----RQFANPRNAAAGSLRQLDPAVTASRRLSLFAYARGAASQAVGETHWD 243

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L  +R  GFPVN    + +   G   +   +   R+ L YDIDG+VYK+D+ +LQ++LG
Sbjct: 244 YLAILRRWGFPVNPLAERVSE-AGAEPFQRSIGERRAGLDYDIDGVVYKIDDLALQERLG 302

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
              R+PRW ++ KF  ++A T LL IDIQ+GRTG LTP ARL+PVN+GG L+++ATLHNE
Sbjct: 303 FAGRAPRWAVAWKFPAERALTTLLGIDIQVGRTGALTPRARLDPVNVGGVLVSHATLHNE 362

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I             +D+R+GD V ++RAG+VIP+++  +   R  D+ PF FP  CP+
Sbjct: 363 DEI-----------ARKDVRIGDTVELQRAGDVIPQILRALPERRPADSVPFVFPDHCPV 411

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C +  +R      G++V   RCTGGL+C AQ +ERL HF SR AF+IEG+G++ +  F  
Sbjct: 412 CGALAIR----PAGEVV--RRCTGGLSCPAQVVERLIHFCSRLAFDIEGMGEKTVQEFHG 465

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
                  +  PADIFTL+ R+      I  + G+G+VS   L  +I+ RR ISL RFI++
Sbjct: 466 ----LGWLESPADIFTLRDRE----AAIAALEGWGEVSARKLIAAIDARRRISLARFIYA 517

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR +G + A+ LA++Y SY  + +++       +D  L L  +  +G  IA+ +  F+
Sbjct: 518 LGIRRIGEQNAKLLARHYSSYAVWRRQMEEAGVIGSDARLELGSISGIGPSIAEELAGFF 577

Query: 617 QNPRNICAVEALLKEVSP--SIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLG 674
             P N      LL  + P  +I          +  K +VFTGTL+ + R +A+     LG
Sbjct: 578 AEPHN----RDLLDRLVPMLTIEDEVAAAGGALAGKTIVFTGTLESLTRPEAKARAEALG 633

Query: 675 AVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           A V+  +S+KTD ++VG + GSK  KA  LGV +++E +F
Sbjct: 634 ARVTESVSKKTDFVVVGADAGSKAAKAASLGVTVLSEAEF 673


>gi|312796238|ref|YP_004029160.1| NAD-dependent DNA ligase [Burkholderia rhizoxinica HKI 454]
 gi|312168013|emb|CBW75016.1| NAD-dependent DNA ligase (EC 6.5.1.2) [Burkholderia rhizoxinica HKI
           454]
          Length = 681

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 267/717 (37%), Positives = 409/717 (57%), Gaps = 58/717 (8%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           S ++  +  + L  E+   +  YY   +P I D+EYD L +  + I    PDL     P+
Sbjct: 9   SADRPAERAAWLRTELDRANHAYYVLDRPEIPDAEYDKLFKELEQIEADHPDLI---TPD 65

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            P  ++GG +      + H +P LSL   +   D+  F  R+    Q  D   + +  E 
Sbjct: 66  SPTQRVGGAVAEGFAPIVHDVPMLSLNNGFEDSDVDAFDKRVSDVLQHGD---VEYACEL 122

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEV 191
           K DG  I++RYE G+FV A+ RGDG +GEDV+A +R I ++P  L+ N +P++I+VRGEV
Sbjct: 123 KFDGLAISLRYENGRFVQASTRGDGTTGEDVTANVRTIRSLPLTLNGNAVPKVIDVRGEV 182

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI 249
            + K DF  LN      G++ +ANPRNAA+G LR+L+ + IT  R L+FF +G+G    +
Sbjct: 183 LMFKRDFERLNARQREAGQREFANPRNAAAGSLRQLD-SRITAKRPLSFFAYGIGVLDGV 241

Query: 250 -FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                   +L     +G PVN          G++ ++  + + R++LPYDIDG+VYKV+ 
Sbjct: 242 PMPDTHSALLDWYVNMGLPVNKERAVVRGAAGLLVFFRGVGARRASLPYDIDGVVYKVNR 301

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q +LG  +R+PR+ ++HKF  ++A TRLL I++Q+GRTG +TPVARLEP+ +GGA +
Sbjct: 302 RDEQDRLGFVSRAPRFALAHKFPAEEALTRLLAIEVQVGRTGAITPVARLEPIFVGGATV 361

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           TNATLHNED ++            +DI +GD V+V+RAG+VIP+VV  I   R  DA+PF
Sbjct: 362 TNATLHNEDEVR-----------RKDILIGDTVIVRRAGDVIPEVVGAIKERRPVDARPF 410

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
           + P+ CP+C S + R  +       A  RCTGGL C+AQ+ + L HF  R A +I+GLG+
Sbjct: 411 TMPTHCPVCGSAIERLPDE------AIARCTGGLVCAAQRKQALWHFAQRRALDIDGLGE 464

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + +D   +       IR PAD+F+L          +  +  F D S  NL DS+ + R+ 
Sbjct: 465 KIIDQLVEQS----LIRTPADLFSL------GFATVAQLDRFADKSAQNLIDSLERARHT 514

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RFI++LGIRHVG   AR LA+++ S       +N +I  + +   +L+ V  VG ++
Sbjct: 515 TLPRFIYALGIRHVGEATARDLARHFGS-------LNALIDASEE---ALLEVNDVGPVV 564

Query: 609 AQAIVEFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           A+AI  F+  P N   +E L        E  P+     +  +  +    +V TGTL  + 
Sbjct: 565 AEAIRHFFSEPHNRMVIEQLRAAGVQWPEGPPA----PRKPAGPLAGMTVVLTGTLPTLS 620

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           R  A+E +   GA V+  +S+KT+ ++ G + GSKL KA++LG+ I++EE    LL+
Sbjct: 621 REAAKERLEAAGAKVAGSVSKKTNYVVAGADAGSKLTKAEELGIPIVDEEGMRRLLE 677


>gi|332290231|ref|YP_004421083.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
 gi|330433127|gb|AEC18186.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
          Length = 671

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 263/714 (36%), Positives = 403/714 (56%), Gaps = 51/714 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++ +  L  ++ YH+  Y+    P+I D+EYD +  +   +    P+L   + P  
Sbjct: 1   MDDLQQHIEQLRNDLRYHEYQYHVLDNPVIPDAEYDRMMNQLKRLEAEHPELITDDSPT- 59

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
              ++G +      ++ H +P LSL+  ++ E+   FI RI        D    F  EPK
Sbjct: 60  --QRVGAKPANGFQQIRHELPMLSLDNAFSDEEFFAFIRRIEDRLGVLPD-PFTFCCEPK 116

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI-IEVRGEVY 192
           +DG  ++I Y  GK   AA RGDG +GED++A IR I  IP  L    P   +EVRGEV+
Sbjct: 117 LDGLAVSILYVNGKLTQAATRGDGVTGEDITANIRTIRNIPLQLRTATPPARLEVRGEVF 176

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEI-F 250
           +  + F  LN+  +  G K +ANPRNAA+G LR+L+P     R L    +G+G    +  
Sbjct: 177 MPHDGFERLNNHALEHGEKTFANPRNAAAGSLRQLDPQVTYHRPLMLNAYGIGIAEGVEL 236

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               Y+ LQ ++ +G PVN  +R  N    ++ +Y  +   RS+L YDIDG V KV+   
Sbjct: 237 PNTHYDRLQWLKSIGIPVNKEIRLCNGTTEVLDFYRSIAEKRSSLGYDIDGTVLKVNSIP 296

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  +R+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++N
Sbjct: 297 LQEQLGFISRAPRWAIAYKFPAQEELTILNDVEFQVGRTGAITPVAKLEPVYVAGVTVSN 356

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L           DI +GD V+++RAG+VIP+++ ++ + R PDA+P  F
Sbjct: 357 ATLHNGDEIARL-----------DIAIGDTVIIRRAGDVIPQIIGVVHDRRPPDAKPIIF 405

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S +VR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G + 
Sbjct: 406 PTRCPVCDSAIVR----IDGEAVA--RCTGGLVCEAQRKEGLKHFVSRKAMDIDGVGDKL 459

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGF---GDVSVTNLYDSINKRRN 547
           ++     E     +  P D+FTL +         E ++G    G+ S      SI K + 
Sbjct: 460 IEQLVDRE----YLHTPVDLFTLSK---------ETLMGLERMGEKSAEKALASIEKAKK 506

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF+F+LGIR VG   AR+LA ++ + +N            N  +  L +V  +G++
Sbjct: 507 TTLARFLFALGIREVGEATARNLANHFHTLENI----------KNATFEQLQQVQDIGEV 556

Query: 608 IAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +A  I+ F+Q   N   VE L+++ V+       +   + ++ K +V TGTL ++ R +A
Sbjct: 557 VANRIILFWQEQHNRNVVEKLIEQGVTWDDVNATEIADNPLKEKTVVLTGTLTQMTRDQA 616

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +  + QLG  V+  +S KTD +I GDN GSKL+KA+ LGVK++ E+QFL L+ Q
Sbjct: 617 KALLLQLGCKVAGSVSSKTDFVIAGDNAGSKLQKAESLGVKVLTEQQFLDLIPQ 670


>gi|294635487|ref|ZP_06713972.1| DNA ligase, NAD-dependent [Edwardsiella tarda ATCC 23685]
 gi|291091145|gb|EFE23706.1| DNA ligase, NAD-dependent [Edwardsiella tarda ATCC 23685]
          Length = 675

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 263/718 (36%), Positives = 416/718 (57%), Gaps = 60/718 (8%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           +IEQ   +L  L   + +H+  YY   +P + D+EYD L  +  A+   +P L  ++ P+
Sbjct: 4   TIEQ---QLEQLRAALRHHEYQYYVLDEPQVTDAEYDRLMMQLKALESDYPQLVTADSPS 60

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
               ++GG    +  +V H +P LSL+ +++ E  R F  R++   + K D ++ F  E 
Sbjct: 61  ---QRVGGAPLAAFGQVHHEVPMLSLDNVFDEESYRAFDKRLHE--RLKSDAALTFCCEL 115

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEV 191
           K+DG  +++ YE+G  V AA RGDG +GED+++ ++ I  IP R+   +IP+ IEVRGEV
Sbjct: 116 KLDGLAVSLLYEQGVLVRAATRGDGSTGEDITSNVKTIRAIPLRLQGEDIPDRIEVRGEV 175

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVHGLGK-TSEI 249
           ++ +  F A+N+E    G K +ANPRNAA+G LR+L+P    R  L F+ +G G      
Sbjct: 176 FMPQAGFEAMNEEARRRGGKIFANPRNAAAGSLRQLDPRITARRPLTFYCYGAGLLEGGT 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                Y+ LQ+ +  G PV+  V++ +    +++YY + +  R TL +DIDG+V KVD+ 
Sbjct: 236 LPGSHYQCLQRFKSWGLPVSERVKRCHGSDEVLAYYRQTEQDRPTLGFDIDGVVIKVDDI 295

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           + Q+ LG  AR+PRW  + KF  ++  T+L  ++ Q+GRTG +TPVARLEPV + G  ++
Sbjct: 296 ATQEALGFVARAPRWATAFKFPAQEQMTQLNGVEFQVGRTGAITPVARLEPVQVAGVTVS 355

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +R+GD V+V+RAG+VIP+VV ++ ++R  DA    
Sbjct: 356 NATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVESQRPADATEIL 404

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+ VA  RC+GGL C+AQ+ E LKHFVSR A ++EG+G +
Sbjct: 405 FPTHCPVCGSEVER----IEGEAVA--RCSGGLICAAQRKESLKHFVSRRAMDVEGMGDK 458

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++   + E     +  PAD++ L      S  K+  +   G  S   L  ++++ R+ +
Sbjct: 459 VIEQLVERE----YVTTPADLYRL------SAGKLTGLERMGPKSANKLIAALDRSRSTT 508

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RF+F+LGIR VG   A +LA ++           ++ A    D  SL  VP VG+++A
Sbjct: 509 LARFLFALGIREVGEATAANLASHF----------GSLSALRGADLESLKSVPEVGEVVA 558

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS-----SEIEN----KKLVFTGTLQK 660
           + I  F     N   ++ L   +S  IG H  +V+     +EI++    K +V TG+L  
Sbjct: 559 RHIRHFLSEAHNCQVIDEL---ISAEIGIHWPDVTPALQAAEIDSPFAGKTVVLTGSLSV 615

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + R +A++ +  LGA VS  +S+KTD++I G+  GSKL KA  LG+ +++E Q L +L
Sbjct: 616 LSRDEAKDRLVALGAKVSGSVSKKTDLVIAGEAAGSKLVKANTLGITVIDEAQLLQML 673


>gi|148284934|ref|YP_001249024.1| NAD-dependent DNA ligase LigA [Orientia tsutsugamushi str. Boryong]
 gi|166216222|sp|A5CEY0|DNLJ_ORITB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146740373|emb|CAM80812.1| NAD-dependent DNA ligase [Orientia tsutsugamushi str. Boryong]
          Length = 698

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 263/720 (36%), Positives = 424/720 (58%), Gaps = 36/720 (5%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I IE L+ + A+K +  L  E+  +D  YY  + P++ D++YD LK   + I   FP LA
Sbjct: 9   INIEQLTSDHAKKIVDFLALELQKYDQAYYSDNNPLVTDAQYDVLKNLNNKIVAKFPHLA 68

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
              D +    K+G   +    KV H  P LSL   + +ED+  FIT+I  F   K D+  
Sbjct: 69  LVNDHS---KKVGFTPSAQFSKVVHLKPMLSLANGFCVEDISNFITKIQNFL--KIDHCP 123

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
               E KIDG     RYE G    A+ RGDG  GE+++  ++ I + P+ L +   ++ E
Sbjct: 124 KIVCEYKIDGLSFNARYEYGVLTLASTRGDGQIGENITENLKTIQSFPQTLPIT-DKVFE 182

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGE+YI+ NDF  LN +   +G+  ++NPRNAA+G +R+L+P     R L +FV+ LG+
Sbjct: 183 VRGEIYITNNDFRVLNIQQQKLGKALFSNPRNAAAGSIRQLDPAITAQRPLKYFVYALGE 242

Query: 246 -TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
            T+  FA  Q+E+LQK+  L F VN     ++  H ++ +YN + + R+ L ++IDG+VY
Sbjct: 243 VTNHHFASTQFELLQKLSQLKFSVNTDYILSDNLHSMIEFYNNVATERNNLAFEIDGVVY 302

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++F+LQ++LG  + SPR+ I++KF      T++ +I +Q+G+TG +TPVA L P+NI 
Sbjct: 303 KVNDFALQERLGATSTSPRFAIAYKFPALIGRTKITNITLQVGKTGAVTPVALLIPINIA 362

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G  I+ ATLHN+  I+            +DIR+GD V + RAG+VIPK+  + ++ R  D
Sbjct: 363 GVTISRATLHNKQEIE-----------SKDIRIGDYVFLHRAGDVIPKINGVDLSAR--D 409

Query: 425 AQP---FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
           AQ    F FP+ CP C   +V +     G+ VA  RC   LAC AQ  ER+ HFVS+DA 
Sbjct: 410 AQSSTRFIFPATCPSCNQNLVVN----EGETVA--RCGNSLACPAQIYERICHFVSKDAL 463

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ-TSTTKIENILGFGDVSVTNLYD 540
           NI+GLG+Q++ F     D  + + I  DIF L+   +  S+ K+E+I G+G  SV  L+ 
Sbjct: 464 NIDGLGRQRIRFLL---DNKYIVNI-VDIFLLEENNKLLSSNKLEDIAGWGIKSVNKLFK 519

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +IN+ +N+ L+RFI++L ++HVG   A+ LAK + + +NF  +   +  +  + +  L  
Sbjct: 520 NINQAKNVILDRFIYALAVKHVGKYSAKLLAKEFKTAKNFIDQSLKLANNVTEIYEKLCN 579

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G   A  + +F+    N+  +  L+  ++    ++  + +  + N+ +VFTGT   
Sbjct: 580 IEGLGVKTADQLKQFFMVSANVNLITKLVNILTIQDWQYHGD-NLLLSNQTIVFTGTFAT 638

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R + +    +LGA V   +S  TD+++VG+  G+KL+KAQQLG+KI+NEE+++ ++ +
Sbjct: 639 VSRSEIKVQAEKLGAKVGTQVSNNTDLLVVGNKAGNKLQKAQQLGIKIINEEEWIKMVNE 698


>gi|109898096|ref|YP_661351.1| DNA ligase, NAD-dependent [Pseudoalteromonas atlantica T6c]
 gi|122972028|sp|Q15UZ1|DNLJ_PSEA6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|109700377|gb|ABG40297.1| DNA ligase, NAD-dependent [Pseudoalteromonas atlantica T6c]
          Length = 677

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 265/715 (37%), Positives = 409/715 (57%), Gaps = 53/715 (7%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ALS  Q   ++ +   E +Y    YY    P + D+EYD L R    I +  PDL RS  
Sbjct: 4   ALSPAQRLTQIINTINEYNYQ---YYVQDNPSVPDAEYDRLMRELLDIENNHPDL-RS-- 57

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+ P  K+GG    +  +V H +P LSL+  ++ +D++ F  RI    + K  + I F+ 
Sbjct: 58  PDSPSQKVGGAALSAFEQVEHEVPMLSLDNAFDEDDMQAFEKRIKD--RLKISSEISFSC 115

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRG 189
           EPK+DG  ++I YE G+ V AA RGDG  GE+++  +R I  +P R+   N P  +EVRG
Sbjct: 116 EPKLDGLAVSILYENGQLVRAATRGDGRVGENITTNVRTIANVPLRLRGENFPSRLEVRG 175

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG---K 245
           EV +++  F+ LN+  I  G+KP+ NPRNAA+G LR+L+P     R L F+ + LG    
Sbjct: 176 EVIMTRAGFVTLNEAQIKKGKKPFVNPRNAAAGSLRQLDPKITAARPLLFYSYSLGLVEN 235

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
             +   +     L ++   G P++  +         ++Y++++  +RS L YDIDG+V+K
Sbjct: 236 EQQPLGETHSSRLAQLSEWGLPLSKELEVTQGATQCLTYFHKIGELRSQLSYDIDGVVFK 295

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD  ++Q++LG  AR+PRW I+HKF  ++  + LLD++ Q+GRTG +TPVARLEP  +GG
Sbjct: 296 VDNIAMQQELGFVARAPRWAIAHKFPAQEEMSTLLDVEFQVGRTGAITPVARLEPTFVGG 355

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             ++NATLHN+D I  L            I++GD V+++RAG+VIP++V I+ ++R  DA
Sbjct: 356 VTVSNATLHNQDEINRL-----------GIKIGDSVIIRRAGDVIPQIVAIVADKRPDDA 404

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +   FP  CP+C S + +      G+ VA  RCTGGL C AQ+ E +KHF SR A +++G
Sbjct: 405 KDIVFPESCPVCDSAIEK----LEGEAVA--RCTGGLYCKAQRKEAMKHFASRKALDVDG 458

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG + ++    +E     ++ PAD F L     +S  ++      G+ S  NL +++ K 
Sbjct: 459 LGDKLIEQLVDAE----MVKSPADFFALDIAPLSSMERM------GEKSAVNLVNALEKS 508

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           +  +L +F++SLGIR VG   A++LA+++L+ +   Q           D  +L  V  VG
Sbjct: 509 KKTTLAKFLYSLGIREVGEATAQNLAQHFLTLEAIEQA----------DLDALQAVSDVG 558

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKIQR 663
            I+AQ +  F++   N+  + ALL E      + EK    E  +  +  V TGTL  + R
Sbjct: 559 VIVAQHVFNFFKEEHNLEVISALL-EAGVHWPKIEKLALDELPLAGQVYVLTGTLNVMDR 617

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + A+  +  LGA VS  +S KTD ++ G+  GSKL KAQ LGVK+MNE+  L + 
Sbjct: 618 NSAKAKLQSLGAKVSGSVSAKTDCLVAGEKAGSKLTKAQDLGVKVMNEDDMLAMF 672


>gi|225630391|ref|YP_002727182.1| DNA ligase [Wolbachia sp. wRi]
 gi|254782311|sp|C0R399|DNLJ_WOLWR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225592372|gb|ACN95391.1| DNA ligase [Wolbachia sp. wRi]
          Length = 662

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 279/694 (40%), Positives = 416/694 (59%), Gaps = 55/694 (7%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ +I+YH+  Y+Q +KP I D+EYD LK++   +A   P++  +++       +G   +
Sbjct: 11  LQDQINYHNVLYHQKNKPEISDAEYDELKKK---LAEIEPEIYATQE------SVGAPPD 61

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H  P LSLE  ++ + + KF+++I RF     ++ I    EPKIDG   +  Y
Sbjct: 62  ERFSKVEHQEPMLSLENAYDEQGVEKFLSKIKRFLI---EDKIEILCEPKIDGLSFSAIY 118

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E G+FV AA RGDG  GEDV+  +  I   P+ L   +   +EVRGE+YIS +DFL LN+
Sbjct: 119 EDGRFVKAATRGDGFVGEDVTHNVATIKGFPKFLQ-GVQGRLEVRGEIYISNSDFLKLNE 177

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMR 262
                    +ANPRNAA+G L++L+     +R L +F + L   +E   K Q E+L K+ 
Sbjct: 178 ------NDEFANPRNAAAGSLKQLDANITASRPLRYFAYSLIGGAE---KSQSEVLNKLE 228

Query: 263 CLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSP 322
            LGF VN      ++  G++ +YNE+ + R  L YDIDG+VYKV++  LQ +LG   ++P
Sbjct: 229 ALGFCVNEHQSLTSSLDGMLKFYNEVYNCRYNLDYDIDGIVYKVNDLVLQNRLGNTHKAP 288

Query: 323 RWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGL 382
           R  +++KF+   A T+L  I IQ+GRTG+LTPVA L PVNIGG L++ A+LHN+D IK  
Sbjct: 289 RSALAYKFSAVYAKTKLNKIFIQVGRTGVLTPVADLVPVNIGGVLVSRASLHNQDEIK-- 346

Query: 383 DASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVV 442
                     +DIR GD V +KRAG+VIP++V++  + R P+   F FP  CP C S+ V
Sbjct: 347 ---------RKDIREGDIVTIKRAGDVIPQIVEVSRDSRLPNTPEFVFPEVCPECGSK-V 396

Query: 443 RDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAF 502
           R +  +     AA RC    AC AQ +E+LKHFVS+DAF+I GLG +Q++FF+   D   
Sbjct: 397 RQVEGE-----AAVRCPEEFACKAQIIEKLKHFVSKDAFDIVGLGDKQIEFFY---DLGL 448

Query: 503 SIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHV 562
             +IP DIFTL+ R       +E   G+G  S+ +L ++I  RR I+L+RFIFSLGIR +
Sbjct: 449 IKQIP-DIFTLEER--LDEFNLEEQSGWGKKSIAHLLNAIQSRRVITLDRFIFSLGIRFI 505

Query: 563 GAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNI 622
           G   A  LA YY+SY N+    N++I  ++D+   L+ +  +G  +A+++  F+    NI
Sbjct: 506 GQVAAELLADYYVSYDNW---YNSMIELSSDN-TELVGIDGIGKKVAESLESFFSKEHNI 561

Query: 623 CAVEALLK--EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
             +  L    ++ P       + +S + NK +VFTG L  + R +A+     LGA VS+ 
Sbjct: 562 KMLNDLTACLQILPV---SSNSSNSVLNNKIIVFTGKLLAMSRGEAKVRAKTLGAKVSSH 618

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           LS KTD +I G+ PGSK +KA +LGV+I++E+Q+
Sbjct: 619 LSAKTDYLIAGEKPGSKYKKAVELGVEILDEDQW 652


>gi|257095174|ref|YP_003168815.1| NAD-dependent DNA ligase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047698|gb|ACV36886.1| DNA ligase, NAD-dependent [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 675

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 267/707 (37%), Positives = 398/707 (56%), Gaps = 48/707 (6%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           + L SL  EI  +D  YY    P I D++YD L R   A+    P+L   + P     ++
Sbjct: 5   ERLHSLRAEIERYDHEYYVLDAPSIADADYDRLFRELQALEAEHPELVSRDSPT---QRV 61

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           GG        VTH+   LSL   +  +++  F  R+        D  + ++ EPK DG  
Sbjct: 62  GGAPLAEFAAVTHATAMLSLNNAFADDEVAAFDRRVREGLAT--DGEVDYSAEPKFDGLA 119

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKND 197
           + + Y KG  V  A RGDG +GE+V+A +R + ++P R+ + + P  +EVRGEV + ++D
Sbjct: 120 VGLSYAKGILVCGATRGDGSTGENVTANLRTLRSVPLRLRASDWPAALEVRGEVLMWRSD 179

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGL--GKTSEIFAKGQ 254
           F  LN      G K + NPRNAA+G LR+L+P     R L FF +G+  G+ + + A   
Sbjct: 180 FERLNARQREKGEKEFVNPRNAAAGGLRQLDPRITAQRPLRFFAYGIASGERAGLPATHS 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
            ++ Q  R  GFPV    R+     G+++YY +M S R++LPYDIDG+VYK+D+ + Q++
Sbjct: 240 AQLDQLERW-GFPVARERRRVTGLAGLLAYYADMGSRRASLPYDIDGVVYKLDDLAAQER 298

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +R+PR+ ++HKF  ++A T LLDI IQ+GRTG LTPVARL PV +GG  + NATLH
Sbjct: 299 LGFLSRAPRFAVAHKFPAEEAVTELLDISIQVGRTGALTPVARLAPVFVGGVTVNNATLH 358

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NED I+            +++R+GD V+V+RAG+VIP+VV ++ + R   A+ F  P+ C
Sbjct: 359 NEDEIR-----------RKNVRIGDVVVVRRAGDVIPEVVRVVPDRRPAGAREFVMPTSC 407

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C SRVVR  +       A  RC+GGL C AQ+ + L HF SR A +IEGLG + ++  
Sbjct: 408 PVCGSRVVRSADE------AVARCSGGLYCPAQRKQALLHFASRRALDIEGLGDKLVEQL 461

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
             S      +R P D++ L      S  ++       D S  NL  +I + +  +L RFI
Sbjct: 462 VDSA----IVRTPGDLYRLGLLALASLERM------ADKSAGNLLAAIERSKRTTLARFI 511

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR+VG   AR LA+++ S       ++ ++A + D   SL +VP VG  +AQ+I +
Sbjct: 512 FALGIRNVGEATARELARHFGS-------LDRLLAADED---SLRQVPDVGPTVAQSIRQ 561

Query: 615 FYQNPRNICAVEAL-LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           F   P N+  +E L    +  S G            +  V TGTL  + R  A+  +   
Sbjct: 562 FCSEPHNLEVIEQLRAAGLVWSEGEPAVPAGGVFAGQVFVLTGTLPSLTREAAKAMIEAA 621

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           G  VS  +S+KT  ++ G   GSKLE+A QLGV++++E Q L LL+Q
Sbjct: 622 GGKVSGSVSKKTSFVVAGAEAGSKLERALQLGVQVIDEGQLLGLLEQ 668


>gi|189184847|ref|YP_001938632.1| NAD-dependent DNA ligase LigA [Orientia tsutsugamushi str. Ikeda]
 gi|254781383|sp|B3CVK1|DNLJ_ORITI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189181618|dbj|BAG41398.1| DNA ligase [Orientia tsutsugamushi str. Ikeda]
          Length = 699

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 261/718 (36%), Positives = 422/718 (58%), Gaps = 32/718 (4%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I IE L+ + A+K +  L  E+  +D  YY  + P++ D++YD LK   + I   FP LA
Sbjct: 9   INIEQLTSDHAKKIVDFLALELQKYDQAYYSDNNPLVTDAQYDVLKNLNNKIVAKFPHLA 68

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
              D +    K+G   +    KV H  P LSL   + +ED+  FIT+I  F   K D+  
Sbjct: 69  LVNDHS---KKVGFTPSAQFSKVVHLKPMLSLANGFCVEDISNFITKIQNFL--KIDHCP 123

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
               E KIDG     RYE G    A+ RGDG  GE+++  ++ I + P+ L +   ++ E
Sbjct: 124 KIVCEYKIDGLSFNARYEYGVLTLASTRGDGQIGENITENLKTIQSFPQTLPIT-DKVFE 182

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGE+YI+ NDF  LN +   +G+  ++NPRNAA+G +R+L+P     R L +FV+ LG+
Sbjct: 183 VRGEIYITNNDFRVLNIQQQKLGKALFSNPRNAAAGSIRQLDPAITAQRPLKYFVYALGE 242

Query: 246 -TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
            T+  FA  Q+E+LQK+  L F VN     ++  H ++ +YN + + R+ L ++IDG+VY
Sbjct: 243 VTNHHFASTQFELLQKLSQLKFSVNTDYILSDNLHSMIEFYNNVATERNNLAFEIDGVVY 302

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KV++F+LQ++LG  + SPR+ I++KF      T++ +I +Q+G+TG +TPVA L P+NI 
Sbjct: 303 KVNDFALQERLGATSTSPRFAIAYKFPALIGRTKITNITLQVGKTGAVTPVAWLIPINIA 362

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP- 423
           G  I+ ATLHN+  I+            +DIR+GD V + RAG+VIPK+  + ++ R   
Sbjct: 363 GVTISRATLHNKQEIE-----------SKDIRIGDYVFLHRAGDVIPKINGVDLSARDTQ 411

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
            ++ F FP+ CP C   +V +     G+ VA  RC   LAC AQ  ER+ HFVS+DA NI
Sbjct: 412 SSERFIFPTTCPSCNQNLVVN----EGETVA--RCGNSLACQAQIYERICHFVSKDALNI 465

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ-TSTTKIENILGFGDVSVTNLYDSI 542
           +GLGKQ++ F     D  + + I  DIF L+   +   + K+E+I G+G  SV  L+ +I
Sbjct: 466 DGLGKQRIQFLL---DNKYIVNI-VDIFLLEENNKFLYSNKLEDIAGWGIKSVNKLFQNI 521

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           N+ +N+ L++FI++L I+HVG   A+ LAK + + +NF  +   +  +  + +  L  + 
Sbjct: 522 NQAKNVILDKFIYALAIKHVGKYSAKLLAKEFKTAKNFINQSLKLANNATEIYEKLRNIE 581

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            VG   A  + +F+    N+  +  L+  ++    ++  + +  + N+ +VFTGT   + 
Sbjct: 582 GVGVKTADQLKQFFMVSANVNLITKLVNILTIQDWQYHGD-NLLLSNQTIVFTGTFATVS 640

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           R + +    +LGA V   +S  TD+++VG+  G+KL+KAQQLG+KI+NEE+++ ++ +
Sbjct: 641 RSEIKVQAEKLGAKVGTQVSNNTDLLVVGNKAGNKLQKAQQLGIKIINEEEWIKMVNE 698


>gi|311278661|ref|YP_003940892.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
 gi|308747856|gb|ADO47608.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
          Length = 671

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 264/715 (36%), Positives = 414/715 (57%), Gaps = 52/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L++L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MEPIEQQLTALRATLRHHEYLYHVMDAPELPDAEYDRLMRELRELEAKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E   +  +V H IP LSL+ +++ E    F  R+    + K  + + +  E K
Sbjct: 58  PTQRVGAEPLGAFSQVRHEIPMLSLDNVFDEESFLAFNKRVQD--RLKSSDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++A +R I  IP ++   ++P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGLLVRAATRGDGTTGEDITANVRTIRAIPLKLRGDDVPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +NDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQAGFEKINDEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A      L++ +  G PV++ V   N+   +++YY +++  R TL +DIDG+V KVD  
Sbjct: 236 PAS-HLGRLRQFKSWGLPVSSRVTLCNSPEEVLAYYRKVEEDRPTLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++
Sbjct: 295 ELQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   
Sbjct: 355 NATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPDDTREIE 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A ++EG+G +
Sbjct: 404 FPAHCPVCGSDVER----VEGEAVA--RCTGGLICGAQRKESLKHFVSRRALDVEGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  N+ +++ K +  S
Sbjct: 458 IIDQLVEKE----YVLTPADLFRL------TAGKLTGLDRMGPKSAQNVVNALEKAKETS 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA +Y S       +  +IA + DD   L  VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHYGS-------LEALIAASIDD---LQTVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKE----VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             +  F+    N   ++ LL E     +P + + E+ + S    K +V TG+L  + R  
Sbjct: 558 THVFNFFAEESNREVIQQLLAEGIHWPAPVVVKAEE-IDSPFAGKTVVLTGSLSLMSRDD 616

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+  +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L LL +
Sbjct: 617 AKARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIAVIDEAEMLRLLGE 671


>gi|58696662|ref|ZP_00372215.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58537163|gb|EAL60267.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 656

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 279/694 (40%), Positives = 416/694 (59%), Gaps = 55/694 (7%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ +I+YH+  Y+Q +KP I D+EYD LK++   +A   P++  +++       +G   +
Sbjct: 5   LQDQINYHNVLYHQKNKPEISDAEYDELKKK---LAEIEPEIYATQE------SVGAPPD 55

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H  P LSLE  ++ + + KF+++I RF     ++ I    EPKIDG   +  Y
Sbjct: 56  ERFSKVEHQEPMLSLENAYDEQGVEKFLSKIKRFLI---EDKIEILCEPKIDGLSFSAIY 112

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E G+FV AA RGDG  GEDV+  +  I   P+ L   +   +EVRGE+YIS +DFL LN+
Sbjct: 113 EDGRFVKAATRGDGFVGEDVTHNVATIKGFPKFLQ-GVQGRLEVRGEIYISNSDFLKLNE 171

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMR 262
                    +ANPRNAA+G L++L+     +R L +F + L   +E   K Q E+L K+ 
Sbjct: 172 ------NDEFANPRNAAAGSLKQLDANITASRPLRYFAYSLIGGAE---KSQSEVLNKLE 222

Query: 263 CLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSP 322
            LGF VN      ++  G++ +YNE+ + R  L YDIDG+VYKV++  LQ +LG   ++P
Sbjct: 223 ALGFCVNEHQSLTSSLDGMLKFYNEVYNCRYNLDYDIDGIVYKVNDLVLQNRLGNTHKAP 282

Query: 323 RWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGL 382
           R  +++KF+   A T+L  I IQ+GRTG+LTPVA L PVNIGG L++ A+LHN+D IK  
Sbjct: 283 RSALAYKFSAVYAKTKLNKIFIQVGRTGVLTPVADLVPVNIGGVLVSRASLHNQDEIK-- 340

Query: 383 DASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVV 442
                     +DIR GD V +KRAG+VIP++V++  + R P+   F FP  CP C S+ V
Sbjct: 341 ---------RKDIREGDIVTIKRAGDVIPQIVEVSRDSRLPNTPEFVFPEVCPECGSK-V 390

Query: 443 RDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAF 502
           R +  +     AA RC    AC AQ +E+LKHFVS+DAF+I GLG +Q++FF+   D   
Sbjct: 391 RQVEGE-----AAVRCPEEFACKAQIIEKLKHFVSKDAFDIVGLGDKQIEFFY---DLGL 442

Query: 503 SIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHV 562
             +IP DIFTL+ R       +E   G+G  S+ +L ++I  RR I+L+RFIFSLGIR +
Sbjct: 443 IKQIP-DIFTLEER--LDEFNLEEQSGWGKKSIAHLLNAIQSRRVITLDRFIFSLGIRFI 499

Query: 563 GAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNI 622
           G   A  LA YY+SY N+    N++I  ++D+   L+ +  +G  +A+++  F+    NI
Sbjct: 500 GQVAAELLADYYVSYDNW---YNSMIELSSDN-TELVGIDGIGKKVAESLESFFSKEHNI 555

Query: 623 CAVEALLK--EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
             +  L    ++ P       + +S + NK +VFTG L  + R +A+     LGA VS+ 
Sbjct: 556 KMLNDLTACLQILPV---SSNSSNSVLNNKIIVFTGKLLAMSRGEAKVRAKTLGAKVSSH 612

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           LS KTD +I G+ PGSK +KA +LGV+I++E+Q+
Sbjct: 613 LSAKTDYLIAGEKPGSKYKKAVELGVEILDEDQW 646


>gi|322831833|ref|YP_004211860.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
 gi|321167034|gb|ADW72733.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
          Length = 673

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 261/714 (36%), Positives = 413/714 (57%), Gaps = 58/714 (8%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           +++S L  ++ +H+  Y+    P + D+EYD L R    +  A P+L  ++ P     ++
Sbjct: 6   EQISQLRTQLRHHEYQYHVLDAPEVPDAEYDRLMRELRELETAHPELVTADSPT---QRV 62

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G     +  +V H +P LSL+ +++ E    F  R+    + K   ++ F  E K+DG  
Sbjct: 63  GAAPLSAFEQVRHRVPMLSLDNVFDEESYLAFYKRVQD--RLKTAEALTFCCELKLDGLA 120

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKND 197
           +++ YE G+ V AA RGDG +GE+++A +R I  IP R+   NIPE +EVRGEV++ +  
Sbjct: 121 VSLLYENGELVQAATRGDGTTGENITANVRTIRAIPLRLHGDNIPERLEVRGEVFMPQAG 180

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKGQ 254
           F A+NDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+  +  
Sbjct: 181 FEAMNDEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL-PRSH 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +  LQ+ +  G PV++ VR       ++++Y ++++ R +L +DIDG+V K+D   +Q+ 
Sbjct: 240 FARLQQFKAWGLPVSDRVRLCTGSEEVLAFYRQVEADRPSLGFDIDGVVVKIDSLDIQET 299

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  AR+PRW  + KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATLH
Sbjct: 300 LGFVARAPRWATAFKFPAQEQITLVKDVEFQVGRTGAITPVARLEPVLVAGVMVSNATLH 359

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            +R+GD V+V+RAG+VIP+VV ++++ER  DA+   FP+ C
Sbjct: 360 NADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVLDERPEDAREVVFPTHC 408

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S V R      G+ VA  RCT GL C AQ+ E LKHFVSR A +++G+G + +D  
Sbjct: 409 PVCHSDVER----VEGEAVA--RCTAGLICGAQRKEALKHFVSRRALDVDGMGDKIIDQL 462

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     ++ PAD+F L      +  K+  +   G  S  N+  ++ K +  +L RF+
Sbjct: 463 VEKE----YVKTPADLFRL------TAGKLTGLDRMGPKSAQNVVRALEKAKETTLARFL 512

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           ++LGIR VG   A +LA +Y S +          A    D  SL  V  VGD++A+ +V 
Sbjct: 513 YALGIREVGEATAANLAAHYGSVE----------ALKAADIESLKGVQDVGDVVAKHVVN 562

Query: 615 FYQNPRNICAVEALLKEVSPSIGRH--------EKNVSSEIENKKLVFTGTLQKIQRHKA 666
           F     N   ++ LL   SP I  H         + + S    K +V TG+L  + R  A
Sbjct: 563 FLSEEHNQQVIDELL---SPEINIHWPEVQVIVPEEIDSPFAGKTVVLTGSLSILSRDDA 619

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           ++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 620 KDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMIRLLGE 673


>gi|332284990|ref|YP_004416901.1| DNA ligase [Pusillimonas sp. T7-7]
 gi|330428943|gb|AEC20277.1| DNA ligase [Pusillimonas sp. T7-7]
          Length = 698

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 259/725 (35%), Positives = 397/725 (54%), Gaps = 63/725 (8%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
           A +   +L  EI+ H+  YY    P++ D+ YD L      +    P+L     P  P  
Sbjct: 11  AAQRAETLRAEINEHNHRYYVQDAPVVSDAAYDKLMTELIELEQTHPELI---TPESPTQ 67

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD----DNSIFFTLEP 132
           ++G E   S   V H++P  SL   ++ ED+  F  R++           +  + +  E 
Sbjct: 68  RVGAEPLPSFDSVRHAVPMRSLGNAFDAEDIHAFSKRVFDTLHGAGMAGAEEKVQYVAEL 127

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVY 192
           K DG  +++RYE+G+ V AA RGDG +GED+++ IR + ++P  L  + P+++EVRGEV 
Sbjct: 128 KFDGLAVSLRYEEGRLVRAATRGDGQTGEDITSNIRTLRSVPLKLKGDYPQVLEVRGEVL 187

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK------ 245
           +++ DF  LN    A G K + NPRNAA+G LR+L+P     R L F+ +G G+      
Sbjct: 188 MNRQDFEKLNQAQQARGEKVFVNPRNAAAGSLRQLDPRITAKRPLRFYAYGWGEIRIVHD 247

Query: 246 -----------TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
                      ++E+  K   +ML  ++ LG PVN+  +      G++ +Y  + S R+ 
Sbjct: 248 GQTELFRQESGSAEMPRKTHAQMLDWLQALGLPVNDSRKLVCGAQGLLDFYEHIGSTRTA 307

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           LP+DIDG+VYKVD    Q+ LG  AR+PR+ I+HKF  ++ +TRLL I++Q+GRTG +TP
Sbjct: 308 LPFDIDGVVYKVDSLEAQEVLGYVARAPRFAIAHKFPAQEETTRLLSIEVQVGRTGAITP 367

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARLEPV +GG  +TNATLHNED I+            +D+RVGD V+V+RAG+VIP+V+
Sbjct: 368 VARLEPVFVGGVTVTNATLHNEDEIR-----------RKDVRVGDTVVVRRAGDVIPEVL 416

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
             +++ R PD   F  P  CP+C S + R  +       A  RCTGGL C+AQ+ + L H
Sbjct: 417 APVLDLRPPDTSLFVMPRQCPVCGSAIERPEDE------AVSRCTGGLFCAAQRKQSLSH 470

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
              R A +IEGLG++ +D    S      ++  AD+FTL   +  +  ++      G  S
Sbjct: 471 AAGRKALDIEGLGEKLVDQLVDS----GRVKSLADLFTLTSDELAAYERM------GRKS 520

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             NL  ++ K R  SLER +++LGIRHVG   AR LA+++ S       ++ ++A    D
Sbjct: 521 ADNLVAALEKARTPSLERLLYALGIRHVGEATARDLARHFGS-------VDAVMAA---D 570

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLV 653
             +L++V  VG ++A +I+ F+  P N   +  L    V  S           +  K LV
Sbjct: 571 ETALLQVHDVGQVVAASILNFFAEPHNRDVIAQLAAAGVHASAPEQASGSDLRLAGKTLV 630

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
            TGT+    R +A   +   G  VS  +S+KT  ++ G+  GSKL KA +LGV +++E+ 
Sbjct: 631 LTGTMPNWTRDEATRRILAAGGKVSGSVSKKTAYVVAGEEAGSKLTKAAELGVPVLDEDG 690

Query: 714 FLFLL 718
              LL
Sbjct: 691 LKALL 695


>gi|251788438|ref|YP_003003159.1| NAD-dependent DNA ligase LigA [Dickeya zeae Ech1591]
 gi|247537059|gb|ACT05680.1| DNA ligase, NAD-dependent [Dickeya zeae Ech1591]
          Length = 682

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 260/717 (36%), Positives = 411/717 (57%), Gaps = 56/717 (7%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           +++ AR+ +  L   I +HD  Y+    P ILDSEYD LKR    +    P L  S+ P 
Sbjct: 10  NVDTARRRIKELRILIRHHDIKYHSEDDPEILDSEYDLLKRELSELEIQHPFLVTSDSPT 69

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
               ++G E  ++   + H +P LSL+ ++N +  + F  R+    + K+D  + F  E 
Sbjct: 70  ---QRVGAEPLVAFGTIKHEVPMLSLDNVFNEDGFKAFSKRVSE--RLKNDKELIFCCEL 124

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEV 191
           K+DG  +++ YE G    A+ RGDG +GE++++ +R I  IP R+   NIP+ +EVRGEV
Sbjct: 125 KLDGLAVSLLYENGILERASTRGDGTTGENITSNVRTIRAIPLRLEGDNIPQRLEVRGEV 184

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT-SEI 249
           ++    F ALN+E    G K +ANPRNAA+G LR+L+P    TR L F  +G+G      
Sbjct: 185 FMKHKGFEALNEEARRTGGKVFANPRNAAAGSLRQLDPRVTATRPLTFLCYGVGLVEGGA 244

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                ++ L + R  G PV++ +R       ++ +Y +++  R  L +DIDG+V KV+E 
Sbjct: 245 LPDTHWQRLMQFRDWGLPVSDRIRLCTGSDAVLDFYRQVEQERGALGFDIDGVVIKVNEL 304

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LG  AR+PRW ++ KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++
Sbjct: 305 TLQERLGFVARAPRWAVAFKFPAQEQLTWLRDVEFQVGRTGAITPVARLEPVAVAGVVVS 364

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +++GDRV V+RAG+VIP++V ++++ER  DA+P  
Sbjct: 365 NATLHNADEIERL-----------GVQIGDRVAVRRAGDVIPQIVSVVLSERPADARPVV 413

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G+ VA  RCTGGL C+AQ+ E LKHFVSR A ++EG+G +
Sbjct: 414 FPTHCPVCGSDVER----VEGEAVA--RCTGGLFCAAQRKEALKHFVSRRALDVEGMGDK 467

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D     E     ++ PAD+  L     T   ++      G  S  NL +++NK ++ +
Sbjct: 468 IIDQLVDKE----YVKTPADLLRLDIGILTRLDRM------GPKSAQNLVNALNKAKSTT 517

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A +LA ++ + +          A    D  +L +V  VG ++A
Sbjct: 518 FARFLYALGIRDVGEATAANLAAHFGTLE----------ALQAADLDALQQVQDVGIVVA 567

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKN--------VSSEIENKKLVFTGTLQKI 661
             +  F     N   ++ L+ +    +G H  +         +S    K +V TG+L  +
Sbjct: 568 THVRNFLDEAHNQQVIQELIGD---DVGLHWPDPVVVDVEASTSPFAGKTVVLTGSLSLL 624

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 625 SRDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLTKAQELGIDVIDEAEMMRLL 681


>gi|330445331|ref|ZP_08308983.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489522|dbj|GAA03480.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 671

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 253/709 (35%), Positives = 410/709 (57%), Gaps = 49/709 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++EL +L +++ YH   YY    P I D+EYD + ++   I    P+    + P+    +
Sbjct: 6   QQELFTLREQLDYHGHRYYVEDNPEIPDAEYDRMMQQLLKIEAEHPEWVTVDSPS---QR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +GG       +V H I  LSL+  +N +DLR F  R+    + +  + + +  EPK+DG 
Sbjct: 63  VGGTALEGFTQVKHEIAMLSLDNAFNDDDLRAFQKRLQD--RLRSGSELNYCCEPKLDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            +++ YE G  V AA RGDG +GE+++  +R I  IP ++   + P  +EVRGEV++ K 
Sbjct: 121 AVSLMYENGVLVQAATRGDGATGENITHNVRTIRAIPLKLQGTDWPARLEVRGEVFMPKK 180

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT-SEIFAKGQ 254
            F ALN++ +  G K +ANPRNAA+G LR+L+P    TR L+F+ + +G       A+ Q
Sbjct: 181 GFEALNEKALKKGEKTFANPRNAAAGSLRQLDPKITATRPLSFYAYAVGVVEGRELAETQ 240

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           YE L +++  G P+   +R+ ++   ++ Y+  +   R +L Y+IDG+V KVD    Q+Q
Sbjct: 241 YERLCQLKAWGLPMCPEIRKVDSIEEVIVYHQSIGEKRQSLGYEIDGVVIKVDGIDTQQQ 300

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  ++NATLH
Sbjct: 301 LGFVARAPRWAIAYKFPAQEEMTVLNNVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLH 360

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D ++ L            + +GD V+++RAG+VIP++  ++ + R   AQ   FP+ C
Sbjct: 361 NADEVERL-----------GVMIGDTVIIRRAGDVIPQIASVVESRRPESAQAIVFPTEC 409

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+CQS++ R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G G++ ++  
Sbjct: 410 PVCQSKIER----IEGEAVA--RCTGGLFCQAQRKEALKHFVSRKALDVDGCGEKVIEQL 463

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
              E     +  PAD+F        S  ++  +   G  S   L D++   +  +L RFI
Sbjct: 464 VDRE----MVATPADLFKF------SAGEVTVLERMGPKSAQKLVDALKASKLTTLPRFI 513

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           +SLGIR VG   A +LA Y+ + +  +Q               LI VP VGD++A  I  
Sbjct: 514 YSLGIREVGEATAANLANYFETLEAISQATKE----------QLIEVPDVGDVVAAHIFN 563

Query: 615 FYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           F++   N+  V+  L+EV    P I + E+ +   +E K +V TG+L ++ R  A+  + 
Sbjct: 564 FFREEHNMAVVKD-LQEVGIHWPEIEKPEEGIELPLEGKTVVLTGSLSQLTRSDAKAALQ 622

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +LGA V+  +S+KTD+++ G+  GSKL KAQ+L ++I +E++ + L+ +
Sbjct: 623 KLGAKVTGSVSKKTDLLVAGEAAGSKLAKAQELDIEIWDEQKLVDLMSK 671


>gi|271501855|ref|YP_003334881.1| DNA ligase [Dickeya dadantii Ech586]
 gi|270345410|gb|ACZ78175.1| DNA ligase, NAD-dependent [Dickeya dadantii Ech586]
          Length = 683

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 261/716 (36%), Positives = 407/716 (56%), Gaps = 56/716 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           I     ++ +L  ++ YH+  Y+    P I D+EYD L      +  A P+L     P+ 
Sbjct: 12  IAAVAAQVEALRAQLRYHEYKYHVEDAPEIPDAEYDTLMNTLKVLEQAHPELVT---PDS 68

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +   V H +P LSL+ +++      F  RI    + K+D  + F  E K
Sbjct: 69  PTQRVGAAPLDAFDTVAHDVPMLSLDNVFDEASFLAFCKRIND--RLKNDAELTFCCELK 126

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE+G  V AA RGDG +GE+++A IR I  IP R+   NIP  +EVRGEV+
Sbjct: 127 LDGLAVSLLYEQGVLVRAATRGDGTTGENITANIRTIGAIPLRLHGDNIPTRLEVRGEVF 186

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT-SEIF 250
           +    F ALN+E    G K +ANPRNAA+G LR+L+P    TR L F  +G+G       
Sbjct: 187 MKHKGFEALNEEARRTGGKVFANPRNAAAGSLRQLDPRITATRPLTFLCYGVGLVEGGTL 246

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               ++ L + R  G PV++ +R       ++++Y +++  R TL +DIDG+V KV+E +
Sbjct: 247 PDTHWQRLMQFRDWGLPVSDRIRLCTGSEAVLNFYRQVEQERETLGFDIDGVVIKVNELA 306

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  AR+PRW ++ KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 307 LQERLGFVARAPRWAVAFKFPAQEQLTWLRDVEFQVGRTGAITPVARLEPVAVAGVVVSN 366

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            I++GDRV V+RAG+VIP++V ++++ER  DA+P  F
Sbjct: 367 ATLHNADEIERL-----------GIQIGDRVAVRRAGDVIPQIVSVVLSERPSDARPIVF 415

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R      G+ V   RCTGGL C+AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 416 PEHCPVCGSELER----VEGEAVT--RCTGGLFCAAQRKEALKHFVSRRALDVEGMGDKI 469

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+  L     T   ++      G  S  NL  +++K ++ + 
Sbjct: 470 IDQLVEKE----YVKTPADLLRLDIGILTRLDRM------GPKSAQNLVSALDKAKSTTF 519

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++            + A    D  +L +VP VG ++A 
Sbjct: 520 ARFLYALGIRDVGEATAANLASHF----------GTLDALQAADLEALQQVPDVGIVVAT 569

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKN--------VSSEIENKKLVFTGTLQKIQ 662
            +  F     N   ++AL   +S  +G H  +         +S    K +V TG+L ++ 
Sbjct: 570 HVRHFLDEAHNQQVIQAL---ISDEVGIHWPDPVRVDVEASTSPFAGKTVVLTGSLSQLS 626

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 627 RDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIAVIDEAEMMRLL 682


>gi|53803401|ref|YP_114852.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
 gi|81681278|sp|Q604U8|DNLJ_METCA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|53757162|gb|AAU91453.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
          Length = 673

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 263/720 (36%), Positives = 403/720 (55%), Gaps = 60/720 (8%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + A  +E+ARK    L +EI +H+  YY+   P+I D+EYD L     AI   +P+L   
Sbjct: 3   VPAEVVEKARK----LREEIEFHNVRYYRLDDPLITDAEYDRLMAELLAIEARYPELV-- 56

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
             P+ P  ++G     +  +V H +P LSLE  ++ EDL  F  R+ +   +   +++ +
Sbjct: 57  -TPDSPTQRVGAPPVEAFTEVRHEVPMLSLENAFSEEDLTAFDRRVRKELSR---DTLEY 112

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEV 187
             EPK+DG  + + Y+ G  V AA RGDG  GEDV+  +RA+  IP R+   + P+  E 
Sbjct: 113 VAEPKLDGLAVNLLYQDGVLVRAATRGDGEVGEDVTHNVRAVRAIPLRLKGEDFPDRFEA 172

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT 246
           RGEV++ K  FLALN+     G K + NPRNAA+G LR+L+     +R L+F+ +G+G  
Sbjct: 173 RGEVFMPKRGFLALNERARRSGEKTFVNPRNAAAGSLRQLDARVTASRPLSFYAYGIGAF 232

Query: 247 SEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            +      Q+E+L+ ++  G PV+   R      G + YY  +   R  LPYDIDG+VYK
Sbjct: 233 PDARLPATQHELLESLQRWGLPVSPEYRVVRGAAGCLEYYRSLGERRHDLPYDIDGVVYK 292

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+   Q  LG  +R+PRW I+HKF  ++A TR++ ID+Q+GRTG+LTPVARLEPV +GG
Sbjct: 293 VDDLKAQAGLGFVSRAPRWAIAHKFPAEEARTRVVGIDVQVGRTGVLTPVARLEPVFVGG 352

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             +TNATLHN D I+            +D+R GD V+V+RAG+VIP++V ++   R P A
Sbjct: 353 VTVTNATLHNADEIR-----------RKDVRPGDTVIVRRAGDVIPEIVRVVPELRKPGA 401

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +PF  P  CP C S V      + G+++A  RC+GGL C AQ  E +KHF SR A +IEG
Sbjct: 402 EPFRMPEVCPECGSAV----EAEPGEVLA--RCSGGLYCPAQHKESIKHFASRRAMDIEG 455

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG + +D     +     I   AD++ L         ++  +   G+ S  NL  ++ + 
Sbjct: 456 LGDKLVDQLVGRK----LIATVADLYRLD------LDRLAGLDRMGEKSAANLLAALERS 505

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           +  +L RF+++LGIR VG   A+ L++++ S +   +               L+ V  VG
Sbjct: 506 KRTTLARFLYALGIRDVGEVTAKVLSEHFGSLEALMEATEE----------ELLAVADVG 555

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIG-RHEKNVSS----EIENKKLVFTGTLQK 660
            ++++ I  F+  P N   +  LL     + G   EK   +     ++    V TGTL  
Sbjct: 556 PVVSRHIRLFFAQPHNREVISQLL-----ACGVSWEKPAPAPRKLPLQGLVFVLTGTLAS 610

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R +A+  +  LGA  +  +SR T  ++ G  PGSKL+KA +LGV +++E+ FL LL++
Sbjct: 611 MSRDEARARLEALGAKCTGSVSRNTSFVVAGSEPGSKLDKASELGVPVLDEKGFLDLLER 670


>gi|302382738|ref|YP_003818561.1| DNA ligase, NAD-dependent [Brevundimonas subvibrioides ATCC 15264]
 gi|302193366|gb|ADL00938.1| DNA ligase, NAD-dependent [Brevundimonas subvibrioides ATCC 15264]
          Length = 777

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 287/760 (37%), Positives = 398/760 (52%), Gaps = 108/760 (14%)

Query: 41  PIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEK 100
           P + D++YDA+K R  AI   FP L RS+ P+    K+G  ++    +V H +P LSL+ 
Sbjct: 42  PTVSDADYDAMKARNLAIETRFPALVRSDSPS---LKVGAPVSTQFTEVRHGVPMLSLDN 98

Query: 101 IWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSG 160
            +   D+  F+ RI RF     D  + FT EPKIDG    +RYE G  V  A RGDG +G
Sbjct: 99  AFEAADVTDFVARIRRFLNLPADEVVAFTAEPKIDGLSANLRYEDGVLVQGATRGDGRAG 158

Query: 161 EDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNA 219
           ED++A ++ I  IP R+     P  IEVRGEVY   + F A N E  A GR+ YANPRN 
Sbjct: 159 EDITANLKTIADIPHRLNGKGWPARIEVRGEVYAPNDAFAAFNAEAEAAGRRTYANPRNF 218

Query: 220 ASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTF 278
           A+G LR+++PT    R L FF +  G+TSE FA+ Q   L+     GFPVN    +    
Sbjct: 219 AAGSLRQIDPTVTAARPLRFFAYAWGETSEPFAETQAGALEAFEAWGFPVNPRSVRVEGS 278

Query: 279 HGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTR 338
            G++  Y  +++ R+ L YDIDG+VYKVD    Q +LG  +RSPRW I+HKF  +QA+T 
Sbjct: 279 DGLIDVYRGLETDRAGLGYDIDGVVYKVDRLDWQTRLGFVSRSPRWAIAHKFPAQQATTV 338

Query: 339 LLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVG 398
           L  IDIQ+GRTG LTPVARL PV +GG ++ NATLHNED I             +D+R+G
Sbjct: 339 LEGIDIQVGRTGSLTPVARLAPVTVGGVVVRNATLHNEDEI-----------ARKDVRIG 387

Query: 399 DRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRC 458
           D V+++RAG+VIP++V +++++R  DA P+ FP+ CP+C S  VR+ +          RC
Sbjct: 388 DTVVLQRAGDVIPQIVSVVLDKRPADALPYVFPTHCPVCGSEAVREGDD------VRRRC 441

Query: 459 TGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQR-RQ 517
           TGGL CSAQ +ERLKHFVSR AF+IEGLG++QL  F    D  + I  PADIF L R   
Sbjct: 442 TGGLICSAQLIERLKHFVSRRAFDIEGLGEKQLSAF---HDRGW-IHEPADIFRLARDAD 497

Query: 518 QTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSY 577
           +    + E+  G+G+ SV NL   I+ RR ISLER IF LGIR +G + +  LA+++  +
Sbjct: 498 KLDALRAED--GYGETSVRNLVAGIDARRVISLERLIFGLGIRDIGDQTSLLLARHFGDW 555

Query: 578 QNF-AQEINNIIAHNNDDWLSLIR----VPLVGDIIAQA--------------------- 611
            +F A  +       + +W  L       P    ++A A                     
Sbjct: 556 ASFHAAAMEAASGIPSPEWTQLAEGHGVSPRTLSVMAAATLSPADPWPEAPIDQKLALAF 615

Query: 612 --------------------IVEFYQ-----NPRNICAVEALLKEVSPSIGRHEKNVSSE 646
                               IVE  +      P       A +  V P   R   +   E
Sbjct: 616 PGIAAPARRALGPLAVDWAGIVELARIAREDGPSMTLGEIAGIAGVGPVAARAVADFFHE 675

Query: 647 IENKKLVFT-----GTLQKIQRHKAQEYVTQLGAVVSAILSR------------------ 683
             N+ +V        T+Q  +R K+   VT    V +  L R                  
Sbjct: 676 PHNQAVVAALLAELTTVQDAERPKSDTAVTGKTVVFTGALERFTRDEAKARAESLGAKVS 735

Query: 684 -----KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
                KTD ++ G   GSKL  AQ+ GV ++ E+++L L+
Sbjct: 736 GSVSKKTDYLVAGPGAGSKLADAQKHGVAVLTEDEWLALI 775


>gi|322513636|ref|ZP_08066733.1| NAD-dependent DNA ligase LigA [Actinobacillus ureae ATCC 25976]
 gi|322120561|gb|EFX92462.1| NAD-dependent DNA ligase LigA [Actinobacillus ureae ATCC 25976]
          Length = 681

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 262/710 (36%), Positives = 415/710 (58%), Gaps = 58/710 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L Q++  ++  Y+    P++ D+EYD L      +    P+   ++ P     ++G
Sbjct: 17  QLEALRQKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPT---QRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +VTH IP LSL+  ++ EDL  F+ R+  +   ++  S+ F  EPK+DG  +
Sbjct: 74  AKPLDGFAQVTHEIPMLSLDNAFSDEDLDSFLRRMESYI-SENPLSLAFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GED+++ IR I  IP  L++ N P  +EVRGEV++ +  F
Sbjct: 133 SILYVDGVLSQAATRGDGTTGEDITSNIRTIRNIPLKLNMDNPPARLEVRGEVFMPQKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR----YLNFFVHGLGKTSEIFAKGQ 254
             LN+  +    K +ANPRNAA+G LR+L+P  ITR     LN +  G+ ++ +      
Sbjct: 193 EELNERALEKSEKTFANPRNAAAGSLRQLDPK-ITRQRPLVLNAYGIGVYESDDELPATH 251

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           +E LQ ++ +G PVNN +R       ++++Y ++++ R TL YDIDG V KV++  LQ+Q
Sbjct: 252 FERLQWLKSIGIPVNNEIRLVTGHEQLLAFYADIQAKRPTLGYDIDGTVLKVNDIGLQEQ 311

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 312 LGFISRSPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 371

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            I +GD V+++RAG+VIP++V +++  R  +A+   FP+ C
Sbjct: 372 NGDEIERL-----------GIVIGDTVIIRRAGDVIPQIVGVVMERRPENAEKIEFPTAC 420

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C+S VVR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +I+G+G++ ++  
Sbjct: 421 PVCESAVVR----VEGEAVA--RCTGGLFCGAQRKEALKHFVSRKAMDIDGVGEKLIEQL 474

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
              E     +  PAD+F L     T+  +++ +   G  S  N  +SI K +N +L RF+
Sbjct: 475 MDRE----LVHTPADLFKL---DHTTLMRLDRM---GKKSAQNALNSIEKAKNTTLARFL 524

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A++LA ++          +N+ A     +  L  V  VG+++A  IV 
Sbjct: 525 FALGIRDVGEATAQNLANHF----------HNLEAIRMATFEQLQEVQDVGEVVANRIVR 574

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQE 668
           F+Q P N+  VE L+ +     G + ++V       + ++ K +V TGTL ++ R +A+ 
Sbjct: 575 FWQEPHNVAVVEDLIAQ-----GVYWQDVVQVEIADNPLKGKNVVLTGTLTQLTRDQAKA 629

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +   G  VS  +S KTD +I G+  GSKL KAQ+LGVK++ E++ + L+
Sbjct: 630 LLQSFGCKVSGSVSSKTDYLIAGEKAGSKLAKAQELGVKVLTEQELVDLM 679


>gi|317049042|ref|YP_004116690.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
 gi|316950659|gb|ADU70134.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
          Length = 672

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 259/717 (36%), Positives = 419/717 (58%), Gaps = 59/717 (8%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++++++L   + +H+  Y+    P + D+EYD L  +   +  A P+L     P+ 
Sbjct: 1   MKSVQEQITALRTTLRHHEYLYHVMDTPEVPDAEYDRLMAQLRELESAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+  ++      F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLAAFEQVRHEVPMLSLDNTFDEAGFLAFNKRVQDRLKSSDD--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP R+   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVSAATRGDGTTGENITANVRTIHAIPLRLHGDNIPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           ++++ F  LN++    G K +ANPRNAA+G LR+L+P     R L FF +GLG  +  E+
Sbjct: 176 MTESGFEKLNEDARRTGAKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGLGLLEGGEM 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A      LQ+ +  G PV++ +R AN    ++++Y E++  R TL +DIDG+V KVD  
Sbjct: 236 PAS-HLGRLQQFKAWGLPVSDRIRLANNADDVLAFYREVEEARPTLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++
Sbjct: 295 ALQEQLGFVARAPRWAVAFKFPAQEQMTVVRDVEFQVGRTGAITPVARLEPVQVAGVVVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  D +   
Sbjct: 355 NATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPEDTREIV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FPS CP+C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPSHCPVCGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRALDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     ++ PAD+F L      +  K+  +   G  S  N+ D++ K +  +
Sbjct: 458 IIDQLVEKE----YVKTPADLFRL------TAGKLTGLDRMGPKSAQNVVDALEKAKFTT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RF+++LGIR VG   A +LA ++        E+  ++   + D  +LI V  VG ++A
Sbjct: 508 LPRFLYALGIREVGEATAANLANHF-------GELEKVM---DADLDALIAVQDVGQVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV----SSEIEN----KKLVFTGTLQKI 661
             +  F     N      +++E++  +G H   V    ++EI++    K +V TG+L ++
Sbjct: 558 SHVRNFMDEESN----REVIRELTQEMGVHWPQVEVVNAAEIDSPFAGKTVVLTGSLSQM 613

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R  A+  +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 614 NRDDAKARLTALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIAVIDEAEMIRLL 670


>gi|292491548|ref|YP_003526987.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
 gi|291580143|gb|ADE14600.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
          Length = 675

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 264/710 (37%), Positives = 402/710 (56%), Gaps = 49/710 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           QAR+ + +L + I+ ++  YY    P++ DSEYD L R    +   +P+L     P+ P 
Sbjct: 6   QARERVETLRKLINDYNYNYYVLDSPVVPDSEYDRLMRELQNLEAQYPELVV---PDSPT 62

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++G E   +L +V H IP LSL   ++ E+L  F  R+    ++     + +  EPK+D
Sbjct: 63  QRVGAEPLKALGEVKHEIPMLSLNNAFSEEELADFHRRVK---ERLGIEQVEYAAEPKLD 119

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVYIS 194
           G  +++ Y++G  V  A RGDG +GEDV+  +R IPT+   L  + IP ++EVRGEVY+ 
Sbjct: 120 GLAVSLLYQEGILVQGATRGDGVTGEDVTHNVRTIPTVSLHLRGDKIPSLLEVRGEVYMP 179

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSE-IFAK 252
           K  F  LN E +A G K + NPRNAA+G LR+L+P    +R L  F +G+GK  +    +
Sbjct: 180 KEGFERLNREHLAKGEKTFVNPRNAAAGSLRQLDPRIAASRPLAIFCYGVGKVEQGTLPQ 239

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
              E+L +++  G      V       G   YY  +   R  LPY+IDG+V+KVD F  +
Sbjct: 240 RHSEVLARLKQWGLRTPPHVEVVAGLAGCQEYYQRLLERRDGLPYEIDGVVFKVDRFDQR 299

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           + LG  AR+PRW I++KF  ++  T++LDI++Q+GRTG LTPVARL+PV +GG  ++NAT
Sbjct: 300 QALGFVARAPRWAIAYKFPAQEELTQILDIEVQVGRTGALTPVARLQPVFVGGVTVSNAT 359

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHNED I+            +D+R+GD V V+RAG+VIP+VV +I++ R PDA+ F  P+
Sbjct: 360 LHNEDEIR-----------RKDVRIGDTVYVRRAGDVIPEVVKVILDHRPPDARFFQMPT 408

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CPIC S V++D     G  +A  RC+GGL C AQ+ E +KHF SR A +I GLG + +D
Sbjct: 409 QCPICGSEVIKD----EGGAIA--RCSGGLYCPAQRKEAIKHFASRRAMDINGLGDKLVD 462

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
              + E     +   AD++ L   Q     ++      G  S  NL  +I   ++ +L R
Sbjct: 463 QLIERE----LVEDVADLYHLTAEQLAGLERM------GQKSAANLMHAIEASKHTTLPR 512

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           F+++LGIR VG   A++L          A+E N++ A        L  V  +G ++A  I
Sbjct: 513 FLYALGIREVGEATAQAL----------AEEFNSLEALEGASEERLQEVTDIGPVVATHI 562

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
             F++ P N   ++  L+E        E  K +   +  K  V TGTL+ + R +A+E +
Sbjct: 563 AAFFRQPHNRQVIQR-LREAGVCWPEKEGKKPIPQPLSGKTFVLTGTLESMTREQAKERL 621

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             LG  V++ +S  TD ++VG NPGSKL KA+ L + +++E  F  LL +
Sbjct: 622 QALGGKVTSSVSSNTDYLVVGTNPGSKLTKAKDLHITLLDEGNFRNLLDE 671


>gi|42520616|ref|NP_966531.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81652444|sp|Q73H01|DNLJ_WOLPM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|42410355|gb|AAS14465.1| DNA ligase, NAD-dependent [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 662

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 278/694 (40%), Positives = 411/694 (59%), Gaps = 55/694 (7%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L+ +I+YH+  Y+Q +KP I D+EYD LK++   +A   P++  ++D       +G   +
Sbjct: 11  LQDQINYHNVLYHQKNKPEISDAEYDELKKK---LAEIEPEIYATQDS------VGAPPD 61

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRY 143
               KV H  P LSLE  ++ + + KF+++I RF     ++ I    EPKIDG   +  Y
Sbjct: 62  ERFSKVEHQEPMLSLENAYDEQGVEKFLSKIKRFLI---EDKIEILCEPKIDGLSFSAIY 118

Query: 144 EKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALND 203
           E G+FV AA RGDG  GEDV+  +  I   P+ L   +   +EVRGE+YIS +DFL LN+
Sbjct: 119 EDGRFVKAATRGDGFVGEDVTHNVATIKGFPKFLQ-GVQGRLEVRGEIYISNSDFLKLNE 177

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMR 262
                    +ANPRNAA+G L++L+     +R L +F + L   +E   K Q E+L K+ 
Sbjct: 178 ------NDEFANPRNAAAGSLKQLDANITASRPLRYFAYSLIGGAE---KSQSEVLNKLE 228

Query: 263 CLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSP 322
            LGF VN      ++  G++ +YNE+ + R  L YDIDG+VYKV++  LQ +LG   ++P
Sbjct: 229 ALGFCVNEHQSLTSSLDGMLKFYNEVYNCRYNLDYDIDGIVYKVNDLVLQNRLGNTHKAP 288

Query: 323 RWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGL 382
           R  +++KF+   A T+L  I IQ+GRTG+LTPVA L PVN+GG L++ A+LHN+D IK  
Sbjct: 289 RSALAYKFSAVYAKTKLNKIFIQVGRTGVLTPVADLVPVNVGGVLVSRASLHNQDEIK-- 346

Query: 383 DASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVV 442
                     +DIR GD V +KRAG+VIP++V++  + R P+   F FP  CP C S+ V
Sbjct: 347 ---------RKDIREGDIVTIKRAGDVIPQIVEVSRDSRLPNTPEFVFPEVCPECGSK-V 396

Query: 443 RDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAF 502
           R +  +     AA RC    AC AQ +E+LKHFVS+DAF+I GLG +Q++FF+   D   
Sbjct: 397 RQVEGE-----AAVRCPEEFACKAQMIEKLKHFVSKDAFDIVGLGDKQIEFFY---DLGL 448

Query: 503 SIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHV 562
            I+   DIFTL+ R       +E   G+G+ S+ NL +SI  RR I+L+RFIFSLGIR +
Sbjct: 449 -IKQIHDIFTLEER--LDEFNLEEQSGWGEKSIANLLNSIQSRRVITLDRFIFSLGIRFI 505

Query: 563 GAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNI 622
           G   A  LA YY+SY N+   +  +   N +    L+ +  +G   A+++  F+    NI
Sbjct: 506 GQVAAELLADYYVSYNNWYNSMIELSLDNTE----LVGIDGIGKKGAESLESFFSKEHNI 561

Query: 623 CAVEALLK--EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAI 680
             +  L    ++ P       + +S + NK +VFTG L  + R +A+     LGA VS+ 
Sbjct: 562 KMLNDLTACLQILPV---SSNSSNSVLNNKIIVFTGKLLAMSRGEAKVRAKTLGAKVSSH 618

Query: 681 LSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           LS KTD +I G+ PGSK +KA +LGV+I++E+Q+
Sbjct: 619 LSAKTDYLIAGEKPGSKYKKAVELGVEILDEDQW 652


>gi|254420802|ref|ZP_05034526.1| DNA ligase, NAD-dependent [Brevundimonas sp. BAL3]
 gi|196186979|gb|EDX81955.1| DNA ligase, NAD-dependent [Brevundimonas sp. BAL3]
          Length = 776

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 262/595 (44%), Positives = 363/595 (61%), Gaps = 31/595 (5%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E L+ E A +EL+ L  E++ HD   Y  + P I D++YDAL+ R  AI  AFPDL R
Sbjct: 10  PVEDLTAETAAEELAWLAAEMARHD-ALYNEATPEISDADYDALRARNLAIETAFPDLVR 68

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
              P+ P +K+G  ++    +V H +P LSL+  ++  ++R F+ RI RF +   D  I 
Sbjct: 69  ---PDSPSHKVGAAVSSQFAEVRHGVPMLSLDNAFDEGEVRDFVARIARFLKLPSDEPIA 125

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           F  EPKIDG    + Y  G+    A RGDG +GEDV+A +  I  + + L+ +  P+ IE
Sbjct: 126 FVAEPKIDGLSANLLYVDGRLTLGATRGDGRTGEDVTANLNTIADVKQTLAGDDWPDRIE 185

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLG 244
           +RGEVY     F A N    A GR+ YANPRN A+G LR+ +   IT  R LNFF +  G
Sbjct: 186 IRGEVYAPNAAFAAFNAAAEAEGRRTYANPRNFAAGSLRQKD-ARITGKRPLNFFAYAWG 244

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S  FA+ Q+E LQK++  GFPVN   R+     G+++ Y E++  R+TL YDIDG+VY
Sbjct: 245 EHSSDFAETQWEALQKLKAWGFPVNARSRRVEGAEGLIAVYRELERDRATLGYDIDGVVY 304

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  ARSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL PV +G
Sbjct: 305 KVDRLDWQRRLGFVARSPRWAIAHKFPAQQATTVLEGIDIQVGRTGSLTPVARLHPVTVG 364

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++ NATLHNED I+ L           D+R+GD V ++RAG+VIP+++ ++ + R  D
Sbjct: 365 GVVVRNATLHNEDEIERL-----------DVRIGDTVRLQRAGDVIPQILGVVPDLRPAD 413

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A P+ FP  CP+C S  VR+     G  V   RCTGGL C AQ +ERLKHFV R AF+IE
Sbjct: 414 AVPYVFPDKCPVCGSEAVRE-----GDEV-KRRCTGGLICDAQIVERLKHFVGRRAFDIE 467

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++QL  F    +    I+ PADIF L  R +    ++E   G+G+ S+ NL   I+ 
Sbjct: 468 GLGEKQLAAF----NARGWIKEPADIFRLA-RDEARLKELEREDGYGETSIRNLVAGIDA 522

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF-AQEINNIIAHNNDDWLSL 598
           RR ISL+RF+F LGIR +G + +  LA+ + S+    A  +       +D W +L
Sbjct: 523 RRVISLDRFLFGLGIRDIGEQTSIVLARAFESWPALKAACLQAASGVPSDAWTAL 577



 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 67/115 (58%)

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           VG + A A+  F+  P N+  V AL  E++  +        + +  K +VFTG L++  R
Sbjct: 661 VGPVAALALAHFFHEPHNLQVVAALEAELTQILDAERPKSDTPVAGKTVVFTGALERFTR 720

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +A+     LGA VS  +S+KTD ++ G   GSKL+ A++ GV+++ E+++L L+
Sbjct: 721 DEAKARAESLGAKVSGSVSKKTDYLVAGPGAGSKLKDAEKHGVQVLTEDEWLALI 775


>gi|329848744|ref|ZP_08263772.1| DNA ligase, NAD-dependent [Asticcacaulis biprosthecum C19]
 gi|328843807|gb|EGF93376.1| DNA ligase, NAD-dependent [Asticcacaulis biprosthecum C19]
          Length = 714

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 278/734 (37%), Positives = 417/734 (56%), Gaps = 48/734 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++++ AR   S L  ++ YH   YY+   P + D++YDAL+++   +   FPDL  SE P
Sbjct: 1   MTLDDARALHSELAAQVQYHRGLYYREETPELTDADYDALEKQLRDLEAQFPDLKTSESP 60

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
                 +G  ++     V H +P LSL+  +  ED+  F  RI RF +   +  + F  E
Sbjct: 61  T---QTVGAVISEKFSPVVHGVPMLSLDNAFADEDVTDFEDRIRRFLKLPAEEPVVFAAE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVRGE 190
           PKIDG   ++ Y  G+ V  A RGDG +GEDV+  IR I  IP  LS    PE IE+RGE
Sbjct: 118 PKIDGLSCSLLYVNGELVRGATRGDGRTGEDVTENIRTIADIPHRLSGTGHPERIEIRGE 177

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           +Y+    F  +N +  A G + YANPRN ASG LR+L+ T +T  R L FF +  G+ S+
Sbjct: 178 IYVPLQAFADMNAKAQAEGGRTYANPRNFASGSLRQLD-TAVTAARPLRFFAYTWGEVSD 236

Query: 249 I-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
             FA  Q E L K R  G  VN    Q +   G++  YN +   RS L YDIDG+VYKVD
Sbjct: 237 DGFAATQTEALAKFREWGLQVNPQSAQVDGAAGLLDVYNRIGRDRSGLGYDIDGVVYKVD 296

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               Q++LG  +RSPRW I+HKF  +QA TRL  IDIQ+GR G +TPVARL+PVN+GG +
Sbjct: 297 RLDWQRRLGFVSRSPRWAIAHKFPAQQALTRLAAIDIQVGRMGTMTPVARLQPVNVGGVV 356

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TN TLHN D I+            +DIR+GD V V+RAG+VIP++V I  +ER   A P
Sbjct: 357 VTNVTLHNADEIE-----------RKDIRIGDMVRVQRAGDVIPQIVGIEPDERPDTAVP 405

Query: 428 FSFPSFCPI-CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           + FP+ CP   ++ VVR+ N   G    A +C+G  AC  Q+ E LK+ VSR   +IEGL
Sbjct: 406 YEFPTVCPCPLKTEVVREQN-AAGTEGVARKCSGDQACPHQRTEYLKYVVSRRVLDIEGL 464

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQR-------------------RQQTSTTKIENI 527
           G+  ++ F +       +  PADI+ L                     RQ+ S   ++  
Sbjct: 465 GETYIEIFNR----GGILAEPADIYRLHEKAEAAKVIVLEERKRQSAARQEKSGQAVKKQ 520

Query: 528 LGFGDVSVTN---LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI 584
           +   D + T+   L+ +I+ RR++ LERFI +LGI+HVG   A+ LA+ ++S + F   +
Sbjct: 521 VADTDRAFTDLDKLFAAIDIRRDLPLERFIAALGIKHVGDTTAKLLARAFVSERAFHDTL 580

Query: 585 NNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS 644
                 + + + S+  +  VG +IA+++  ++ +P      E  +++V         + +
Sbjct: 581 VKAAEGDEEAFNSVKDLNQVGPVIARSVTSYFAHPYQRGIYERFIEQVRVQDAEAVAS-T 639

Query: 645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQL 704
           S +  K +VFTGTL+K+ R +A+    +LGA VS  +S+KTD+++ G   GSKL+ A +L
Sbjct: 640 SPVSGKTVVFTGTLEKLTRDEAKAQAERLGAKVSGSVSKKTDLVVAGPGAGSKLKTAAEL 699

Query: 705 GVKIMNEEQFLFLL 718
           G++++ E+++L L+
Sbjct: 700 GIQVLTEDEWLSLI 713


>gi|33151983|ref|NP_873336.1| NAD-dependent DNA ligase LigA [Haemophilus ducreyi 35000HP]
 gi|81423646|sp|Q7VMX7|DNLJ_HAEDU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33148205|gb|AAP95725.1| DNA ligase [Haemophilus ducreyi 35000HP]
          Length = 686

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 263/713 (36%), Positives = 415/713 (58%), Gaps = 59/713 (8%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           +L +L  ++  ++  Y+  + P++ D+EYD L  +   I   +P+L     P+ P  ++G
Sbjct: 17  QLEALRDQLREYEYHYHVLNNPLVPDAEYDRLINQLKNIEQQYPELI---TPDSPTQRVG 73

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
            +      +V H +P LSL+  ++  DL  F+ RI  +    D N + F  EPK+DG  +
Sbjct: 74  AKPLAGFAQVAHEMPMLSLDNAFSETDLDNFLRRIENYL-SLDANQLTFCCEPKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEVYISKNDF 198
           +I Y  G    AA RGDG +GE+++A +R I  IP  L + N P  +E+RGE+++    F
Sbjct: 133 SILYIDGVLQLAATRGDGTTGENITANVRTIRNIPLKLKMANPPHRLEIRGEIFMPLKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY--LNFFVHGLGKTSEIFAK---G 253
            ALN   +A G K +ANPRNAA+G LR+L+P  ITR   L    +G+G     + +    
Sbjct: 193 NALNQRALAKGEKSFANPRNAAAGSLRQLDP-QITRQRPLMLNAYGIGVYESNYQRLPTS 251

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            Y  L+ ++ +G PVN  +R A  +  ++++Y ++++ R+ L YDIDG V KVD+ ++Q+
Sbjct: 252 HYARLEWLKSIGIPVNAEIRLARGYPQLLAFYADIQAKRADLGYDIDGTVLKVDDITIQE 311

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
            LG  +RSPRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEP  + G  ++NATL
Sbjct: 312 TLGFISRSPRWAIAYKFPAQEEMTILKDVEFQVGRTGAITPVAKLEPTLVAGVTVSNATL 371

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            + +GD V+++RAG+VIP+++ I+ + R  +A+   FP+ 
Sbjct: 372 HNGDEIERL-----------GVAIGDTVIIRRAGDVIPQIIGIVADRRPANAKKIVFPTA 420

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S V+R      G+ VA  RCTGGL C AQ+ E LKHFVSR A NI+G+G++ ++ 
Sbjct: 421 CPVCHSAVIR----IAGEAVA--RCTGGLFCPAQRKEALKHFVSRKAMNIDGVGEKLIEQ 474

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     I  PAD+F L      S  ++E +   G+ S  N  +SI K ++ +L RF
Sbjct: 475 LMARE----LIHTPADLFKL---DPLSLMRLERM---GEKSAQNALNSIEKAKHTTLARF 524

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +FSLGIR VG   A +LA ++ S +N        I   N + L    V  VG+++A  +V
Sbjct: 525 LFSLGIRDVGETTALNLANHFGSLEN--------IRTANVEQLK--EVQDVGEVVANRLV 574

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNV------SSEIENKKLVFTGTLQKIQRHKAQ 667
            F+Q   N+  VE L+ +     G H  N+       + +++K +V TGTL +  R +A+
Sbjct: 575 CFWQEQHNVAVVEELIAQ-----GVHWDNIVQLEIADNPLKDKNVVLTGTLTQFSRDQAR 629

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + + QLG  VS+ +S KTD +I G+  G+KL KA+QLG++I++E  F  L++Q
Sbjct: 630 KLLQQLGCKVSSAVSTKTDFLIAGEKAGTKLTKAEQLGIRILDEHAFADLIKQ 682


>gi|113868039|ref|YP_726528.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
 gi|123133949|sp|Q0KA11|DNLJ_RALEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|113526815|emb|CAJ93160.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
          Length = 709

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 260/718 (36%), Positives = 393/718 (54%), Gaps = 54/718 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P   L  E A K ++ L  E+  H+  YY    P I D+EYDAL     A+    P+L  
Sbjct: 15  PAGPLPPEAAAKRVAWLRDELDRHNYQYYVLDAPTIPDAEYDALFSELQALELEHPEL-- 72

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITR----IYRFWQKKDD 123
            + P+ P  ++GGE   +   V H +P LSL   +  +D+  F  R    + R      +
Sbjct: 73  -QTPDSPTQRVGGEPLSAFDSVRHRVPMLSLNNGFADDDVLNFDRRCAQGLGRTAPAAGE 131

Query: 124 NSIF-------FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV 176
             +F       +  E K DG  +++RYE G+ V AA RGDG +GEDV+  +R I  IP  
Sbjct: 132 QDLFSAADAVEYACELKFDGLAMSLRYEDGRLVQAATRGDGETGEDVTVNVRTIKAIPLK 191

Query: 177 LSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRY 235
           L    P ++EVRGEV++ + DF  LN+     G K + NPRNAA+G LR+L+P     R 
Sbjct: 192 LRGQAPAVLEVRGEVFMYRGDFDKLNERQAEAGEKTFVNPRNAAAGSLRQLDPRITAKRP 251

Query: 236 LNFFVHGLGKTSEIFAKGQYE-MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
           L+FF +GLG+   +     +  ML     LG PV           G++ +Y ++   R  
Sbjct: 252 LSFFAYGLGELQGVDRPPTHSAMLDGFAALGLPVCKDRAVVKGAQGLLDFYRDIGQRRDA 311

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           LPYDIDG+VYKV+  + Q++LG  +R+PR+ ++HKF  ++ +T + DI++Q+GRTG +TP
Sbjct: 312 LPYDIDGVVYKVNALAEQERLGFVSRAPRFALAHKFPAQEMTTIVEDIEVQVGRTGAITP 371

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARL+PV +GG  +TNATLHNED I+            +D+ +GD V+V+RAG+VIP+VV
Sbjct: 372 VARLKPVFVGGVTVTNATLHNEDEIR-----------RKDVHIGDTVIVRRAGDVIPEVV 420

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
            ++   R  DA+ F  P+ CP+C S + +  +       A  RCTGGL C+AQ+ + L H
Sbjct: 421 AVVTERRPDDARAFVMPTACPVCGSHIEKLEDE------AIARCTGGLICAAQRKQALLH 474

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
           F  R A +IEGLG + ++           +R PAD+F L         K+  +    D S
Sbjct: 475 FAQRRAMDIEGLGDKLVEQLVDQG----IVRTPADLFKL------GVAKLAALERMADKS 524

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             NL  +I+  R  ++ RFIF+LGIRHVG   A+ LA+++        +++ ++A    D
Sbjct: 525 AANLVAAIDASRETTMNRFIFALGIRHVGEATAKDLARHF-------GKLDALMAA---D 574

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL-LKEVSPSIGRHEKNVSSEIENKKLV 653
             +L+ V  VG ++AQ+I  F+  P N+  +E L    V  +         + +  K  V
Sbjct: 575 EAALLEVNDVGPVVAQSIAHFFAEPHNVEVIEQLRAAGVHWTESEPVAKAPAPLSGKTFV 634

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
            TGTL  + R  A+E +   GA V+  +S+KTD ++ G   GSKL+KA+ LGV +++E
Sbjct: 635 LTGTLPTMSREDAKELLEAAGAKVAGSVSKKTDYVVAGAEAGSKLDKAEALGVPVLDE 692


>gi|108759370|ref|YP_633776.1| NAD-dependent DNA ligase [Myxococcus xanthus DK 1622]
 gi|123074067|sp|Q1D0P7|DNLJ_MYXXD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|108463250|gb|ABF88435.1| DNA ligase, NAD-dependent [Myxococcus xanthus DK 1622]
          Length = 672

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 259/714 (36%), Positives = 407/714 (57%), Gaps = 58/714 (8%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           ++A      L +E+++H+  YY    P + D++YD L R    +    P L   + P+ P
Sbjct: 5   QKAAARARELHRELAHHNYRYYVLDSPEVSDAQYDKLMRELQDLEAKHPSL---QTPDSP 61

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++GG       +V H  P +SL  I+  + L +F  RI +         I +  EPK+
Sbjct: 62  TQRVGGAAAEEFGEVVHRAPMISLANIFEDQGLTEFDERIRKLVGLP---GIAYVCEPKL 118

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL----SLNIPEIIEVRGE 190
           DG  I +RYEKG FV  A RGDG +GEDV++ +R I ++P  L     + +P+++EVRGE
Sbjct: 119 DGLAIALRYEKGAFVQGATRGDGTTGEDVTSNLRTIRSLPMSLFPQDDVKVPDVLEVRGE 178

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGL--GKTS 247
           V+I K DF  LN++    G   +ANPRNAA+G LR+L+P     R L+ F++    G+  
Sbjct: 179 VFIRKKDFQKLNEKREEEGEPLFANPRNAAAGSLRQLDPRMTAARPLSVFLYECVPGEGV 238

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
            +F K   E L+ ++ LG P+N   R+A    G+   Y+     R  LP+++DG+V KVD
Sbjct: 239 PVF-KTHIEKLEYLKTLGLPINQ-YRRAEGLEGVRQAYDASLKGRHELPFEVDGMVVKVD 296

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +   +K+LG+ ++SPRW +++KF  ++ ST ++DI IQ+GRTG LTPVA L+PV +GG  
Sbjct: 297 DEDQRKRLGQVSKSPRWAVAYKFPPEEESTEVMDIGIQVGRTGALTPVAHLKPVKVGGVT 356

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +  ATLHNED ++            +D+R GD V V+RAG+VIP++V +++++R  D+ P
Sbjct: 357 VARATLHNEDELR-----------RKDVRKGDTVFVRRAGDVIPEIVSVVLSKRPADSAP 405

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C +   +D   + G ++   RCTG  +C AQ +E+++HF SR A +IEGLG
Sbjct: 406 FEFPKHCPVCDAVATKD---EDGAII---RCTGA-SCPAQLVEKIRHFASRLAMDIEGLG 458

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            +       +      ++  AD++ L +    +  ++      GD S  NL  S+ + + 
Sbjct: 459 DKLAAQLVST----GRVKAFADLYALTKEDLLTLERM------GDKSADNLIASLERSKQ 508

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYY-LSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            +  RF++SLGIRHVG   A++LA+ +  S   F   + +I            RV  VG 
Sbjct: 509 TTQRRFLYSLGIRHVGDATAKALAEAFPRSEMLFEASLEDI-----------SRVKDVGP 557

Query: 607 IIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           I+AQ I  F+Q P+N  A+ ALL   V P+    +         K +V TG +  + R +
Sbjct: 558 IMAQVIHTFFQEPQNQEAIRALLAAGVQPAA--PQVATGGPFVGKSVVLTGAMTGMTREQ 615

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+E V + G  V+  +SRKTD ++ G++ GSKL+KAQ+LGV+I++E+ FL +LQ
Sbjct: 616 AKEEVERRGGKVAGSVSRKTDFVVAGEDAGSKLKKAQELGVRILDEQAFLQMLQ 669


>gi|167627564|ref|YP_001678064.1| DNA ligase (NAD(+)) [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|190359258|sp|B0TY02|DNLJ_FRAP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|167597565|gb|ABZ87563.1| DNA ligase (NAD(+)) [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
          Length = 678

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 270/719 (37%), Positives = 410/719 (57%), Gaps = 56/719 (7%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I  + L+  Q +  +  L + +      Y+   KP+I DS+YD L R    +    P L 
Sbjct: 9   IDYKTLTKAQLKSYIDDLAEYLGEQSYLYHTIDKPVITDSDYDKLFRLLQDLVDDNPQLK 68

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
            S   N  L+++GGE+      + H     SL  ++++E+LR F  +I        +  I
Sbjct: 69  PS---NSVLDRVGGEILAGFETIKHKKKMTSLANVFSLEELRDFYDKI--------EYDI 117

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEII 185
               EPK+DG  I+I Y+ GKF YA  RGDG  GE VS  ++ I  +P  L+  N PE +
Sbjct: 118 ELECEPKMDGLAISIFYKNGKFDYAVTRGDGIQGEKVSENVKTIRNVPLKLNTSNPPEEL 177

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLG 244
           EVRGE+ + K  FL+LN+ M     K +ANPRNAA+G +R L+   +  R L  + +G+G
Sbjct: 178 EVRGEIILDKQSFLSLNEYMQTHENKTFANPRNAAAGSIRMLDSKVVAKRPLKLYSYGIG 237

Query: 245 KTSEIFA--KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
             S+ F   + Q+E++  ++  GF +++ +  A  F  +  Y+++M   R+ L YDIDGL
Sbjct: 238 YFSKDFVHPETQFELMNLLQSFGFTISDNMFLAKNFSEVEVYHHKMSHQRADLAYDIDGL 297

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           V+KV+   LQ  +G  AR P+W I++KF  ++  + +L+++ Q+GRTG +TPVARL+PV 
Sbjct: 298 VFKVNNIKLQDTIGYTARGPKWAIAYKFPAEEVESEVLNVEFQVGRTGAITPVARLKPVA 357

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG +++NATLHN + IK            +DIRVGDRV+V+RAG+VIP+VV  +   R 
Sbjct: 358 VGGVIVSNATLHNINEIK-----------RKDIRVGDRVIVRRAGDVIPEVVKSLPQYRK 406

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
           PDAQ    P+ CP+C S  + ++N +     A +RCTGG  C AQ  ERLKHFVSR A +
Sbjct: 407 PDAQMVEMPTNCPVCDS-AIENINDQ-----AIYRCTGGWHCQAQTTERLKHFVSRKAMD 460

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           I+ LG + ++    ++     I+ PADI+ L   Q T   ++      G  S  N+ DSI
Sbjct: 461 IDKLGAKLIEQLVAAD----LIKYPADIYKLNFEQLTGLERM------GAKSSQNVLDSI 510

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
            K +  SL RFIF++GI+ VG   + +LA ++ S ++F +            +  LI + 
Sbjct: 511 TKSKEPSLARFIFAIGIKDVGEVSSEALANHFGSLESFREA----------KFEQLIEIN 560

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIE---NKKLVFTGTLQ 659
            +G+IIA+ IV F+Q+  NI  V+ LL   S +I   EK   +  E   NK +V TGT +
Sbjct: 561 DIGEIIAKNIVSFWQDSLNIQIVDELLGN-SINIQNPEKIEQAHNESFTNKTIVITGTFE 619

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
              R +  + +  +GA V++ +S+KTD++I GDN GSKL KAQ LGV+++ EE    LL
Sbjct: 620 NYNRTELTQLLKSMGAKVTSSVSKKTDMVICGDNAGSKLTKAQDLGVEVIFEEDLQNLL 678


>gi|307132386|ref|YP_003884402.1| DNA ligase, NAD(+)-dependent [Dickeya dadantii 3937]
 gi|306529915|gb|ADM99845.1| DNA ligase, NAD(+)-dependent [Dickeya dadantii 3937]
          Length = 683

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 260/710 (36%), Positives = 406/710 (57%), Gaps = 56/710 (7%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
           ++ +L  ++ YH+  Y+    P I D+EYD L      +  A P+L     P+ P  ++G
Sbjct: 18  QIEALRAQLRYHEYKYHVEDAPEIPDAEYDKLMNALKTLEQAHPELV---TPDSPTQRVG 74

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
                +   + H +P LSL+ +++      F  RI    + K+D  + F  E K+DG  +
Sbjct: 75  ATPLDAFDTIAHEVPMLSLDNVFDETSFLAFSKRIND--RLKNDGELTFCCELKLDGLAV 132

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDF 198
           ++ YE G  V AA RGDG +GE+++A IR +  IP R+   NIP+ +EVRGEV++    F
Sbjct: 133 SLLYENGLLVRAATRGDGTTGENITANIRTVGAIPLRLRGDNIPQRLEVRGEVFMKHKGF 192

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT-SEIFAKGQYE 256
            ALN+E    G K +ANPRNAA+G LR+L+P    TR L F  +G+G           ++
Sbjct: 193 EALNEEARRTGGKVFANPRNAAAGSLRQLDPRITATRPLTFLCYGVGLVEGGALPDTHWQ 252

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L + R  G PV++ +R       ++ +Y +++  R TL +DIDG+V KV+E +LQ++LG
Sbjct: 253 RLMQFRDWGLPVSDRIRLCTGSDAVLDFYRQVEQERETLGFDIDGVVIKVNELTLQERLG 312

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             AR+PRW ++ KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++NATLHN 
Sbjct: 313 FVARAPRWAVAFKFPAQEQLTWLRDVEFQVGRTGAITPVARLEPVAVAGVVVSNATLHNA 372

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I+ L            I++GDRV V+RAG+VIP++V ++++ER  DA+P  FP  CP+
Sbjct: 373 DEIERL-----------GIQIGDRVAVRRAGDVIPQIVSVVLSERPADARPVVFPEQCPV 421

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S + R      G+ V   RCTGGL C AQ+ E LKHFVSR A ++EG+G + +D   +
Sbjct: 422 CGSELER----VDGEAVT--RCTGGLFCGAQRKEALKHFVSRRALDVEGMGDKIIDQLVE 475

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
            E     ++ PAD+F L     T   ++      G  S  NL +++NK ++ +  RF+++
Sbjct: 476 KE----YVKTPADLFRLSAGILTGLDRM------GPKSAQNLVNALNKAKSTTFARFLYA 525

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR VG   A SLA ++ + +          A  + D  +L +V  VG ++A  +  F 
Sbjct: 526 LGIRDVGEATAASLASHFGTLE----------ALQSADLEALQQVQDVGIVVATHVRNFL 575

Query: 617 QNPRNICAVEALLKEVSPSIGRHE--------KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
               N   ++ L+ E   +IG H         +   S    K +V TG+L  + R +A++
Sbjct: 576 DEAHNQQVIQELISE---NIGIHWPAPVVVDVEASDSPFAGKTVVLTGSLTLLSRDEAKD 632

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 633 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLTKAQELGIEVIDEAEMMRLL 682


>gi|90579891|ref|ZP_01235699.1| DNA ligase [Vibrio angustum S14]
 gi|90438776|gb|EAS63959.1| DNA ligase [Vibrio angustum S14]
          Length = 670

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 257/695 (36%), Positives = 405/695 (58%), Gaps = 49/695 (7%)

Query: 30  YHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKV 89
           YH   YY    P I D+EYD + ++   I    P+    + P+    ++GG       +V
Sbjct: 18  YHGHRYYVEDNPEIPDAEYDRMMQQLIKIEADHPEWITVDSPS---QRVGGAALEGFTQV 74

Query: 90  THSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFV 149
            H I  LSL+  +N +DLR F  R+    + +   ++ +  EPK+DG  +++ YE G  V
Sbjct: 75  KHEIAMLSLDNAFNDDDLRAFQKRLQD--RLRSGATLSYCCEPKLDGLAVSLMYENGVLV 132

Query: 150 YAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAV 208
            AA RGDG +GE+++  +R I  IP ++   + PE +EVRGEV++ K  F ALN + +  
Sbjct: 133 QAATRGDGATGENITHNVRTIRAIPLKLQGDDWPERLEVRGEVFMPKKGFEALNAKALKK 192

Query: 209 GRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT-SEIFAKGQYEMLQKMRCLGF 266
           G K +ANPRNAA+G LR+L+P    TR L+F+ + +G       A  QYE L +++  G 
Sbjct: 193 GDKAFANPRNAAAGSLRQLDPKITATRPLSFYAYAVGVVDGRELANTQYERLCQLKAWGL 252

Query: 267 PVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMI 326
           P+   +R+ ++   ++SY+  +   R +L Y+IDG+V KVD+   Q+QLG  AR+PRW I
Sbjct: 253 PMCPEIRKVDSIEDVISYHQSIGEKRQSLGYEIDGVVIKVDDVDTQQQLGFVARAPRWAI 312

Query: 327 SHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASG 386
           ++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  ++NATLHN D         
Sbjct: 313 AYKFPAQEEMTILNNVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLHNAD--------- 363

Query: 387 KVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLN 446
           +V R G  + +GD V+++RAG+VIP++  ++ + R  +AQ   FP+ CP+CQS+V R   
Sbjct: 364 EVARLG--VMIGDTVIIRRAGDVIPQIASVVESRRPENAQAIVFPTECPVCQSKVER--- 418

Query: 447 PKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRI 506
              G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G G++ ++     E     +  
Sbjct: 419 -IEGEAVA--RCTGGLFCQAQRKEALKHFVSRKALDVDGCGEKVIEQLVDRE----MVTT 471

Query: 507 PADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEI 566
           PAD+F     + T   ++      G  S   L D++N  +  +L RFI SLGIR VG   
Sbjct: 472 PADLFKFSAGEVTVLERM------GPKSAQKLVDALNASKLTTLPRFIHSLGIREVGEAT 525

Query: 567 ARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVE 626
           A +LA Y+ + ++ +Q               LI VP VGDI+A  I  F++   N+  V 
Sbjct: 526 AANLANYFETLESISQATKE----------QLIEVPDVGDIVAAHIFNFFREEHNMVVVN 575

Query: 627 ALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
             L+EV    P I + +++V   ++ K +V TG+L ++ R  A+  + +LGA V+  +S+
Sbjct: 576 E-LQEVGIHWPEIEKRDEDVELPLDGKVVVLTGSLSQLTRSDAKAALQKLGAKVTGSVSK 634

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           KTD+++ G+  GSKL KAQ+LG++I +E++ + L+
Sbjct: 635 KTDLLVAGEAAGSKLTKAQELGIEIWDEQKLVDLM 669


>gi|258544861|ref|ZP_05705095.1| DNA ligase, NAD-dependent [Cardiobacterium hominis ATCC 15826]
 gi|258519884|gb|EEV88743.1| DNA ligase, NAD-dependent [Cardiobacterium hominis ATCC 15826]
          Length = 668

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 261/704 (37%), Positives = 403/704 (57%), Gaps = 48/704 (6%)

Query: 21  LSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG 80
           L++L +EI  HD  YY    P+I D+EYDAL R   A+  A  +   ++ P+    ++GG
Sbjct: 7   LAALREEIRAHDHAYYVLDNPLIADAEYDALLRELRALEAASGEPVPADSPS---QRVGG 63

Query: 81  EMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMIT 140
           + + +   V H++P LSL+ +++ E+   F+ R+    ++ D + +  + EPK DG  I+
Sbjct: 64  KADGAFAPVAHAVPMLSLDNVFSEEEFAAFVKRLQ---ERLDHDELLLSAEPKFDGLAIS 120

Query: 141 IRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFL 199
           +RYE G    AA RGDG +GEDV+A +R I  IP R+L    P +IE+RGE+Y+ K  F 
Sbjct: 121 LRYENGVLTRAATRGDGATGEDVTANVRTIRAIPLRLLDATPPAVIEIRGEIYMPKAAFA 180

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYE-M 257
           ALN      G K +ANPRNAA+G LR+L+P    +R+L+F+ +GLG          Y  +
Sbjct: 181 ALNAAAERDGGKTFANPRNAAAGSLRQLDPAITASRHLSFYAYGLGAHDGYALPATYSAL 240

Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317
           L + R  G PV       ++    V+Y + +   R  LPY+IDG+VYK D ++ Q+  G 
Sbjct: 241 LAQYRDWGVPVCPLQESLSSAAAAVAYMDALGKKRHDLPYEIDGVVYKADRYADQQAAGF 300

Query: 318 RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED 377
            +R+PRW I+ KF   + +T +  ID+Q+GRTG +TPVARL PV +GG  +TNATLHN D
Sbjct: 301 VSRAPRWAIAWKFPAVEKTTVVEAIDVQVGRTGAVTPVARLRPVEVGGVTVTNATLHNAD 360

Query: 378 YIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPIC 437
                    +V R  +D+RVGD V V+RAG+VIP++V  ++  R  D+QPF+ P+ CP+C
Sbjct: 361 ---------EVAR--KDVRVGDTVFVRRAGDVIPEIVKTVLEARPADSQPFAMPTHCPVC 409

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
           +S ++R      G+ VA  RC+GGL C AQ+++ L HF SR A +I+GLG + ++   + 
Sbjct: 410 ESEIIR----PEGEAVA--RCSGGLHCRAQRVQALIHFASRKALDIQGLGDKLIEQLVQD 463

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
                 +  PAD+F L      +  ++       + S  N+  ++   +  +L RFI++L
Sbjct: 464 G----RVHSPADLFALTLADWAALPRM------AEKSAQNILAALEAAKATTLPRFIYAL 513

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ 617
           GIR VG   A  LA++Y       +E+  ++A + DD   L  +  +G ++AQ I  F+ 
Sbjct: 514 GIREVGNVSAELLARHY-------RELPALLAASEDD---LQAIDGIGPVMAQYIRHFFL 563

Query: 618 NPRNICAVEALLKEV--SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGA 675
           +  N   + AL       P +        S +  K +V TGTL  + R +A  ++ +LG 
Sbjct: 564 DDANRAVIAALQAAGIHWPVVEAPVIAADSPLAGKTVVITGTLPTMTRDEAAAHIARLGG 623

Query: 676 VVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             ++ +S+KTD ++ GD  GSKLEKAQ LGV I++E Q L  L+
Sbjct: 624 KTASAVSKKTDYLLAGDKAGSKLEKAQSLGVAIIDEAQLLAWLE 667


>gi|88800009|ref|ZP_01115580.1| DNA ligase, NAD-dependent [Reinekea sp. MED297]
 gi|88777287|gb|EAR08491.1| DNA ligase, NAD-dependent [Reinekea sp. MED297]
          Length = 674

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 261/705 (37%), Positives = 391/705 (55%), Gaps = 53/705 (7%)

Query: 23  SLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM 82
           +L Q+I  +D  YY  ++  I D EYD L      I    P       P  P  ++ G  
Sbjct: 10  ALIQQIRRYDHEYYVLNESAIPDVEYDRLMEELKRIESEHPQWV---TPQSPTQRVAGAP 66

Query: 83  NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIR 142
                 V H +P LSL+  +N +DL  F+ R+    +  D + I F  EPK+DG  +++ 
Sbjct: 67  QAGFETVEHRMPMLSLDNAFNHDDLGAFVKRLKD--RLNDPSPIEFACEPKLDGIAVSLL 124

Query: 143 YEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVYISKNDFLAL 201
           YE+G  V  A RGDG +GED++A +R I +IP  L  +  PE++EVRGE+Y+ K  F  +
Sbjct: 125 YEQGHLVRGATRGDGTTGEDITANVRTIRSIPLSLQGDGWPEVLEVRGEIYMPKAGFERM 184

Query: 202 NDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKG-----QY 255
           NDE    G K + NPRNAASG LR+L+     TR L    + +G    +F  G     QY
Sbjct: 185 NDEARERGDKVFVNPRNAASGSLRQLDSRLTATRPLEMCCYSVG----VFEGGTLPDTQY 240

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           +++QK    G  +N  +       G++ YY++++  R+ LPY+IDG+VYKV+ F LQ++L
Sbjct: 241 QLMQKFSEWGLKINPEMALVTDVQGLLDYYDQLEQKRNGLPYEIDGIVYKVNSFGLQRRL 300

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  +R+PRW I+ KF  ++  T LLD++ Q+GRTG LTPVARLEPV +GG  ++NATLHN
Sbjct: 301 GFVSRAPRWAIARKFPAQEEVTTLLDVEFQVGRTGALTPVARLEPVFVGGVTVSNATLHN 360

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I+ L           D+ +GDRV+V+RAG+VIP+VV  +  +R P+A+P + P  CP
Sbjct: 361 MDEIERL-----------DVHIGDRVIVRRAGDVIPQVVKSLAEDRSPEARPITAPEECP 409

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
            C S+V R          A  RCTGG+ CSAQ+ E LKHFVSR A +I+G G++ +D   
Sbjct: 410 ECGSKVDRVAGE------AVMRCTGGMICSAQRREALKHFVSRKAMDIDGFGEKIVDALL 463

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
                   I   +DIF L + + ++  ++      GD S  NL  +I+  R  +L RFIF
Sbjct: 464 AGN----KIHAASDIFELTQEEVSALERM------GDKSAANLIAAIDAARETTLARFIF 513

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR VG   AR+LA ++ + +                   L+ V  VG  +A  +V +
Sbjct: 514 ALGIREVGETTARNLAMHFGTIEKLMSATEA----------QLLDVEDVGPKVAAHVVNY 563

Query: 616 YQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGA 675
           +   +N   ++ L+              +S +  +  V TG + ++ R +A++Y+ QLGA
Sbjct: 564 FSEEQNRIEIQRLIALGVTWDDPIPDQSASVLAGQTWVVTGKISQMSRDEAKDYLLQLGA 623

Query: 676 VVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            V+  +S KT  ++ G   GSKL KA++LGV +M+E +F+  L Q
Sbjct: 624 KVAGSVSAKTTQVVAGPGAGSKLRKAEELGVPVMDEAEFVEWLTQ 668


>gi|73541575|ref|YP_296095.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
 gi|123732913|sp|Q470D2|DNLJ_RALEJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|72118988|gb|AAZ61251.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
          Length = 711

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 266/731 (36%), Positives = 394/731 (53%), Gaps = 64/731 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P   L    A + +  L  E+  H+  YY    P I D+EYDAL     A+    P+L  
Sbjct: 15  PAGGLPPATAAERVQWLRDELDRHNYQYYVLDAPTIPDAEYDALFTELQALEAEHPELL- 73

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITR----IYRFWQKKDD 123
              P+ P  ++GG    +   V H +P LSL   ++ ED+  F  R    + R      +
Sbjct: 74  --TPDSPTQRVGGAPLSAFDTVRHRVPMLSLNNGFSDEDVTGFDRRCAQGLGRSAAAGGE 131

Query: 124 NSIF-------FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV 176
             +F       +  E K DG  +++RYE G+ V AA RGDG +GEDV+  +R I  IP  
Sbjct: 132 QDLFSAAEGVEYACELKFDGLAMSLRYEDGRLVQAATRGDGETGEDVTVNVRTIKAIPLK 191

Query: 177 LSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRY 235
           L    P ++EVRGEV++ + DF  LN      G K + NPRNAA+G LR+L+P     R 
Sbjct: 192 LRGAAPAVLEVRGEVFMYRRDFDKLNARQAEAGDKTFVNPRNAAAGSLRQLDPRITAKRP 251

Query: 236 LNFFVHGLGKTSEIFAKGQYE-MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
           L+FF +GLG+   I     +  ML     +G PV N         G++ +Y ++   R  
Sbjct: 252 LSFFAYGLGELQGIERPATHSAMLDGFATMGLPVCNERAVVKGAQGLLDFYRKVGEKRDQ 311

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           LPYDIDG+VYKV+  + Q+QLG  +R+PR+ ++HKF  ++ +T + DI++Q+GRTG +TP
Sbjct: 312 LPYDIDGVVYKVNALAEQEQLGFVSRAPRFALAHKFPAQEMTTIVEDIEVQVGRTGAITP 371

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARL+PV +GG  +TNATLHNED ++            +D+ +GD V+V+RAG+VIP+VV
Sbjct: 372 VARLQPVFVGGVTVTNATLHNEDEVR-----------RKDVHIGDTVIVRRAGDVIPEVV 420

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
            +++  R  DA+ F  P+ CP+C S + R  +       A  RCTGGL C+AQ+ + L H
Sbjct: 421 AVVLERRPDDARAFVMPTACPVCGSHIERLEDE------AIARCTGGLICAAQRKQALLH 474

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
           F  R A +IEGLG + ++           +R PAD++ L         K+  +    D S
Sbjct: 475 FAQRRAMDIEGLGDKVVEQLVDQG----IVRTPADLYKL------GVAKLAALDRMADKS 524

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             NL  +I   R+ +  RFIFSLGIRHVG   A+ LA+++            ++A    D
Sbjct: 525 AGNLVAAIEASRSTTFNRFIFSLGIRHVGEATAKDLARHFGKLDGL------MVA----D 574

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIE 648
             +L+ V  VG ++AQ+IV F+  P N+  +E L        E  P + R      + + 
Sbjct: 575 EAALLEVNDVGPVVAQSIVNFFGEPHNVEVIEQLRAAGVHWPESEP-VAR----APAPLA 629

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K  V TGTL  + R  A+E +   GA V+  +S+KTD ++ G   GSKL+KA+ LGV +
Sbjct: 630 GKTFVLTGTLPSLSREAAKEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLDKAEALGVPV 689

Query: 709 MNEEQFLFLLQ 719
           ++E   L LL+
Sbjct: 690 LDEAGMLALLE 700


>gi|166216279|sp|A0LI67|DNLJ_SYNFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 675

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 268/713 (37%), Positives = 388/713 (54%), Gaps = 59/713 (8%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A   + +L +EI +H+  YY   +P I D  YD L R    +  ++P L     P+ P
Sbjct: 5   EKAHARIEALREEIRHHNYLYYVLDRPEISDEAYDGLFRELVRLEESYPALI---TPDSP 61

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G           H+IP LSLE   +  ++ +F  R+ +    + D  + F  EPK+
Sbjct: 62  TQRVGAAPAEKFLPFPHTIPMLSLENAMSEAEVFEFARRVRKILGDRGD--VDFMAEPKM 119

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-----SLNIPEIIEVRG 189
           DG  + + YE G+   A  RGDG+ GEDV+   + I  IP  L       + P  I VRG
Sbjct: 120 DGLAVELVYENGELTGAGTRGDGYVGEDVTRNAKTIRAIPLKLYAGAGGASPPARIAVRG 179

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EVY+ + DF ALN      G   +ANPRNAA+G LR+L+P+    R L  F +G+G+ S 
Sbjct: 180 EVYMDRKDFAALNRSREQAGEPLFANPRNAAAGSLRQLDPSVTAARSLKAFFYGVGEVSG 239

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
              K Q + L+++R  G PVN   R   +    VS+YNE+ + R  LP++IDG+V KV+ 
Sbjct: 240 YRFKTQAQTLEQLRRWGLPVNPLSRVCPSIEDAVSFYNEIAAGRDALPFEIDGVVVKVNS 299

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q+ LGE++RSPRW I++KF+  QA TR+LDI +Q+GRTG+LTPVA LEPV +GG  +
Sbjct: 300 IEWQEMLGEKSRSPRWAIAYKFSPHQARTRVLDIKVQVGRTGVLTPVAELEPVTVGGVTV 359

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
             ATLHN+D ++            +DIRV D+V+V+RAG+VIP+VV++I   R    + F
Sbjct: 360 RRATLHNQDEVE-----------RKDIRVRDQVMVRRAGDVIPEVVEVIGEARTGGEEVF 408

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
             P  CP C S VVR   P+     A HRC     C AQ    L+HF SRDA NIEGLGK
Sbjct: 409 QMPGQCPSCGSEVVR--LPEE----AVHRCL-NRNCPAQIKASLRHFASRDAMNIEGLGK 461

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             +            +   +D++ L      S   +E + GF   S  NL +SI + +  
Sbjct: 462 NIVSMLVDRG----IVESVSDLYRL------SVETLEQLPGFAGKSSRNLVESIERSKKT 511

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L  F+++LGI HVG+ +AR LA+ +            + A        L+ V  VG+++
Sbjct: 512 NLADFLYALGIYHVGSHVARLLAERF----------GTLDAVRRASVEELMSVNGVGEVV 561

Query: 609 AQAIVEFYQNPRNICAVEALLK------EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           A+++V ++  P N   VE+LL          P  G     V +    K +VFTG L  + 
Sbjct: 562 ARSVVHYFSLPANRTLVESLLSAGLEMAATEPEAG----PVDAFWNGKTVVFTGALSSMT 617

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           R  A       GA VS  +SRKTDI++ G +PGSK+EKA+QLG+ I++E +FL
Sbjct: 618 RSNAAALTASRGARVSDSVSRKTDIVVAGADPGSKVEKARQLGITILDEREFL 670


>gi|329297490|ref|ZP_08254826.1| NAD-dependent DNA ligase LigA [Plautia stali symbiont]
          Length = 672

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 255/713 (35%), Positives = 416/713 (58%), Gaps = 59/713 (8%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++++L   + +H+  Y+    P I D+EYD L R    +  A PDL     P+ P  +
Sbjct: 5   QEQITALRTTLRHHEYLYHVMDTPEIPDAEYDRLMRELRELESAHPDLI---TPDSPTQR 61

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G     +  +V H +P LSL+  ++      F  R+    +  D+  + +  E K+DG 
Sbjct: 62  VGAAPLATFEQVRHEVPMLSLDNTFDEAGFLAFNKRMQDRLKSTDN--LTYCCELKLDGL 119

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            +++ YE G  V AA RGDG +GE+++A +R I  IP R+   NIP  +EVRGEV+++++
Sbjct: 120 AVSLLYENGLLVRAATRGDGTTGENITANVRTIHAIPLRLHGDNIPARVEVRGEVFMTES 179

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKG 253
            F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G G  +  E+ A  
Sbjct: 180 GFEKLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEMPAS- 238

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            ++ LQ+ +  G PV++ +R  +T   ++++Y +++  R +L +DIDG+V KVD  +LQ+
Sbjct: 239 HWQRLQQFKAWGLPVSDRIRLVHTADEVLAFYRQVEQDRPSLGFDIDGVVIKVDSQALQE 298

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATL
Sbjct: 299 QLGFVARAPRWAVAFKFPAQEQMTVVRDVEFQVGRTGAITPVARLEPVQVAGVIVSNATL 358

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  DA+   FPS 
Sbjct: 359 HNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPADAREIVFPSH 407

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S    D+    G+ V   RCTGGL C AQ+ E LKHFVS  A +++G+G + +D 
Sbjct: 408 CPVCGS----DVESVEGEAVT--RCTGGLICGAQRKEALKHFVSHRAMDVDGMGDKIIDQ 461

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + E     ++ PAD+F L      +  K+  +   G  S  N+ D++ K +  +L RF
Sbjct: 462 LVEKE----YVKTPADLFRL------TAGKLTGLDRMGPKSAQNVVDALEKAKLTTLPRF 511

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +++LGIR VG   A +LA ++        E+  ++   N D  +LI V  VG ++A  + 
Sbjct: 512 LYALGIREVGEATAANLANHF-------GELEKVM---NADLDALIAVQDVGKVVAAHVR 561

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRH--------EKNVSSEIENKKLVFTGTLQKIQRHK 665
            F +   N      ++++++  +G H         + + S    K +V TG+L ++ R  
Sbjct: 562 NFMEEESN----REVIRQLTDEVGVHWPAVVVVKAEEIDSPFAGKTVVLTGSLSQMNRDD 617

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+  +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 618 AKARLTALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLL 670


>gi|300717845|ref|YP_003742648.1| DNA ligase [Erwinia billingiae Eb661]
 gi|299063681|emb|CAX60801.1| DNA ligase [Erwinia billingiae Eb661]
          Length = 672

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 262/715 (36%), Positives = 414/715 (57%), Gaps = 51/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E  + ++++L+  + +H+  Y+    P + D+EYD L R    +  A P+L  ++ P  
Sbjct: 1   MESVQDKITALQTTLRHHEYQYHVMDDPEVPDAEYDRLMRELRELEQAHPELVTADSPT- 59

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
              ++G     +  +V H +P LSL+  ++ E    F  R+    +  DD  I F  E K
Sbjct: 60  --QRVGAAPLGAFEQVRHEVPMLSLDNAFDEESYLAFYKRVQDRLKNTDD--ITFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP R+   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVRAATRGDGTTGENITANVRTIRAIPLRLHGENIPSRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           +    F ALN+E    G K +ANPRNAA+G LR+L+P     R L FF +G G  +  E+
Sbjct: 176 MPLAGFEALNNEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEM 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             +     LQ+ +  G PV++ ++  +T   ++++Y +++  R TL +DIDG+V KVD  
Sbjct: 236 -PRSHMARLQQFKAWGLPVSDRIKLCHTAEEVLAFYRQVEQDRPTLGFDIDGVVIKVDSQ 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++
Sbjct: 295 DLQEQLGFVARAPRWAVAFKFPAQEQMTTVRDVEFQVGRTGAITPVARLEPVQVAGVIVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +R+GDRV+++RAG+VIP+VV +I +ER  DA+   
Sbjct: 355 NATLHNADEIERL-----------GLRIGDRVIIRRAGDVIPQVVGVIESERPDDAREVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S V R      G++VA  RCTGGL C AQ+   LKHFVSR A +++G+G +
Sbjct: 404 FPTHCPVCGSDVER----VEGEVVA--RCTGGLICGAQRKGALKHFVSRRALDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  N+ +S+ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNVVNSLEKAKTTT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RF++SLGI  VG   A +LA ++ S       +  I+A + D   +LI V  VG ++A
Sbjct: 508 LARFLYSLGISEVGEATAANLAAHFGS-------LEKIMAADLD---ALIAVQDVGTVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEVS---PSIG-RHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             +  F     N   +  L++E     P++   +   + S    K +V TG+L  + R +
Sbjct: 558 SHLRNFMDEESNREVIRQLVEEAGINWPAVEVVNAAEIDSPFAGKTVVLTGSLTILSRDE 617

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 618 AKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMIRLLGE 672


>gi|238895883|ref|YP_002920619.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae NTUH-K2044]
 gi|238548201|dbj|BAH64552.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 671

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 255/715 (35%), Positives = 413/715 (57%), Gaps = 52/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    + K  + + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD--RLKSTDHLTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP ++   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A     +LQ  +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  
Sbjct: 236 PASHSARLLQ-FKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++
Sbjct: 295 ALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   
Sbjct: 355 NATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+CQS V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPTHCPVCQSDVER----VEGEAVA--RCTGGLICGAQRKESLKHFVSRRALDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  N+ +++ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLERMGPKSAQNVVNALEKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHFGTLEALEQATIE----------ELQKVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKE----VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
                F+    N   +  LL E     +P + + E+ + S    K +V TG+L ++ R  
Sbjct: 558 THTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEE-IDSPFAGKTVVLTGSLSQLSRDD 616

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+E +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 617 AKERLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|260774893|ref|ZP_05883794.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609148|gb|EEX35306.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 669

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 261/709 (36%), Positives = 406/709 (57%), Gaps = 47/709 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           ++ ++ L+ L + + YH   YY    P + D+EYD L R    +    PDL   + P+  
Sbjct: 3   QEIQERLNQLRETLHYHGVKYYVEDNPEVPDAEYDRLMRELLELEAEHPDLVSIDSPS-- 60

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++GG+       VTH IP LSL+  ++ E+L  F  R+       + N   F  EPK+
Sbjct: 61  -QRVGGQPLDGFQSVTHEIPMLSLDNAFDDEELESFHKRMSDRIPTAEFN--VFCCEPKL 117

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVRGEVYI 193
           DG  +++ YE G  V AA RGDG +GE+++  +R I +IP  LS    P+ IEVRGEV++
Sbjct: 118 DGLAVSLLYENGILVQAATRGDGTTGENITENVRTIKSIPLKLSGQGWPQRIEVRGEVFM 177

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEI-FA 251
            K  F  LN +    G K + NPRNAA+G LR+L+     TR L+F+ + +G    I  +
Sbjct: 178 PKEGFDKLNQQAQKKGEKVFVNPRNAAAGSLRQLDSRITATRPLSFYAYSVGVVEGIALS 237

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
           +  YE   +++  G P+    R+      + +YY ++   R  LPY+IDG+V KVD+ +L
Sbjct: 238 ESHYERFLQLKGWGLPMCPETRRVANLTEVKAYYQDILERREALPYEIDGVVIKVDDIAL 297

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  ++NA
Sbjct: 298 QEQLGFVARAPRWAIAYKFPAQEEITLLNDVEFQVGRTGAITPVAKLEPVFVGGVTVSNA 357

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D I+ L            ++VGD V+++RAG+VIP++V +I   R  +A+   FP
Sbjct: 358 TLHNADEIERL-----------GVKVGDSVIIRRAGDVIPQIVSVIEERRPGNARDIVFP 406

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
             CP+C S V R      G+ VA  RC+GGL C AQ+ E LKHFVSR A +++GLG++ +
Sbjct: 407 ERCPVCSSEVER----IEGEAVA--RCSGGLVCQAQRKEALKHFVSRKALDVDGLGEKVI 460

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           +     E     +  PAD+F L      S   I  +   G  S  N+ D++N+ +  +L 
Sbjct: 461 EQLVDRE----MVETPADLFKL------SAGVITVLDRMGPKSAQNVVDALNQAKLTTLP 510

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RF++SLGIR VG   A +LA+Y+       + ++ + A N++    LI V  +GDI+A  
Sbjct: 511 RFLYSLGIREVGEATAANLAQYF-------KTLDAVKAANHE---QLIEVSDIGDIVASH 560

Query: 612 IVEFYQNPRNICAVEALLKE--VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           ++ F+   +N   ++ LL +    P I    ++    +  K +V TG+L ++ R+ A+  
Sbjct: 561 VIAFFAQDKNQQVIQDLLDQGIEWPEIEEQSEDTPQPLAGKTVVLTGSLSQLSRNDAKSA 620

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  + L+
Sbjct: 621 LQALGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLVDLI 669


>gi|59712497|ref|YP_205273.1| NAD-dependent DNA ligase LigA [Vibrio fischeri ES114]
 gi|75353581|sp|Q5E3L1|DNLJ_VIBF1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|59480598|gb|AAW86385.1| DNA ligase, NAD(+)-dependent [Vibrio fischeri ES114]
          Length = 668

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 262/714 (36%), Positives = 410/714 (57%), Gaps = 54/714 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SIEQ    L  L+Q+++YH   YY    P + D+EYD + ++  +I    P+L   + P
Sbjct: 1   MSIEQT---LDELKQQLNYHAYRYYVEDSPELPDAEYDRMMQQLLSIESEHPELVTVDSP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    ++GGE      ++ H IP LSL+  ++ E+L  F  R+      K  +   F  E
Sbjct: 58  S---QRVGGEALDGFTQIQHEIPMLSLDNAFSDEELEAFEKRMNDRLISKPVS--LFCCE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PK+DG  +++ Y  GK V A  RGDG +GE+++  +R I  IP  L     P  +EVRGE
Sbjct: 113 PKLDGLAVSLLYVDGKLVQAGTRGDGTTGENITENVRTIRCIPLTLQGEGWPTRLEVRGE 172

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG--KTS 247
           V++ K  F ALN+  +  G KP+ANPRNAA+G LR+L+     TR L+F+ + +G  +  
Sbjct: 173 VFMPKAGFEALNERALKRGEKPFANPRNAAAGSLRQLDSKITATRPLSFYAYSVGVIEGG 232

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+     Y+   +++  G P+    +Q ++   + +YY ++   R  L Y+IDG+V KVD
Sbjct: 233 EL-ETSHYQRFVQLKSWGLPMCEETKQCHSLTEVKAYYKDILERRDALKYEIDGVVIKVD 291

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  
Sbjct: 292 DIALQEQLGFVARAPRWAIAYKFPAQEELTVLNDVEFQVGRTGAITPVAKLEPVFVGGVT 351

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHN D I  L            + +GD V+++RAG+VIP++V ++   R  D++ 
Sbjct: 352 VSNATLHNADEIARL-----------GVHIGDTVIIRRAGDVIPQIVSVVEARRPTDSKA 400

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
             +P  CP+C S + R      G+ V   RC  GL C AQ+ E LKHFVSR A +++GLG
Sbjct: 401 IVYPIHCPVCGSNLER----VEGEAVT--RCGAGLVCQAQRKEALKHFVSRKALDVDGLG 454

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + ++     E     +  PAD+F L     T   ++      G  S  N+ D++NK + 
Sbjct: 455 DKVVEQLVDKE----MVETPADLFKLSAGLLTVLERM------GPKSAQNVVDALNKAKA 504

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF++SLGIR VG   A +LA ++ + +          A     +  LI V  VGDI
Sbjct: 505 TTLPRFLYSLGIREVGEATAANLAAHFYTLE----------AIQVATFEQLIEVSDVGDI 554

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           +A+ ++ F+  P N   +E  L+E+    P I   +++V   +  K +V TGTL K++R+
Sbjct: 555 VAKHVLNFFAEPHNKTVIED-LQEMGIHWPEIKALDESVPQPLAGKVVVLTGTLHKLKRN 613

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+  + +LGA V+  +S+KTDI+  G+  GSKL KA++LGV++MNEEQ + LL
Sbjct: 614 EAKAALQELGAKVTGSVSKKTDILFAGEAAGSKLAKAEELGVEVMNEEQLIELL 667


>gi|302878427|ref|YP_003846991.1| DNA ligase, NAD-dependent [Gallionella capsiferriformans ES-2]
 gi|302581216|gb|ADL55227.1| DNA ligase, NAD-dependent [Gallionella capsiferriformans ES-2]
          Length = 674

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 259/710 (36%), Positives = 396/710 (55%), Gaps = 52/710 (7%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++ + +L  EI  H+  YY    P + D+ YD L R    +    P+   S+ P     +
Sbjct: 7   QQRIKALRSEIEAHNYQYYVLDAPTVPDAGYDTLFRELQRLEAQHPEFLTSDSPT---QR 63

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G        +V H  P LSL   ++ +++  F  R+         + + + +E K DG 
Sbjct: 64  VGAAPLKYFAEVPHRTPMLSLNNAFSADEVIAFDARVR---DALGIDEVEYAVELKFDGL 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI----IEVRGEVYI 193
            I + Y  G FV  A RGDG +GEDV+  +R + +IP  L     E+    +EVRGEV +
Sbjct: 121 AINLSYRNGIFVQGATRGDGSTGEDVTENLRTVRSIPLRLKEANGEVLCADVEVRGEVLM 180

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAK 252
              DF  LN++    G K + NPRNAA+G LR+L+     TR+L+F+ +G+G    +   
Sbjct: 181 FTRDFDLLNEQQRLNGEKEFVNPRNAAAGSLRQLDSAVTATRHLSFYAYGVGLCDGVNLS 240

Query: 253 GQYEM-LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
           G++++ + ++   G PV           G++ YY EM ++R+ LP+ IDG+VYKV++ + 
Sbjct: 241 GKHDLQMAQLADWGVPVATQRSTVQGVAGLLDYYKEMGALRAALPFAIDGVVYKVNDIAQ 300

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q+ LG  +R+PR+ I+HKF  ++A T LLDID+Q+GRTG LTPVARL PV +GG  +TNA
Sbjct: 301 QQMLGFVSRAPRFAIAHKFPAEEAMTTLLDIDVQVGRTGALTPVARLTPVFVGGVTVTNA 360

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHNED I+            +D+R+GD V+V+RAG+VIP+V  +++  R  DA+ FS P
Sbjct: 361 TLHNEDEIR-----------RKDVRIGDTVIVRRAGDVIPEVARVVLERRPSDARVFSMP 409

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
             CP+C S VVR+ +       AA RCTGGL C AQ+ + L HF  R A NI+GLG + +
Sbjct: 410 QACPVCGSHVVREED------AAAWRCTGGLFCPAQRKQALLHFAGRRAMNIDGLGDKLV 463

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           +    ++     +  PAD++ L      S  ++      G+ S  NL D+I   R  +L 
Sbjct: 464 EQLVDAQ----QVSTPADLYKLGMSGLVSLERM------GEKSALNLLDAIEASRKTTLA 513

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RF+F+LGIR+VG   AR LA+++ +     Q           D   L +V  VG ++AQ+
Sbjct: 514 RFLFALGIRNVGETTARDLAQHFGALDAIMQA----------DAERLQQVRDVGPVVAQS 563

Query: 612 IVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE--IENKKLVFTGTLQKIQRHKAQEY 669
           +V+F+    N+ AV A L+E       H      +     K  V TGTL  + R +A+E 
Sbjct: 564 MVDFFAEAHNL-AVIAQLREAGVHWDEHSPAPQEDRIYTGKTFVLTGTLASLSRQQAKER 622

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +  LGA VS  +S+KTD ++ G + GSKLE+A +LGV +++E +FL L++
Sbjct: 623 LEALGAKVSGSVSKKTDFVVAGSDSGSKLERAMELGVAVLSESEFLLLIE 672


>gi|289165264|ref|YP_003455402.1| DNA ligase [Legionella longbeachae NSW150]
 gi|288858437|emb|CBJ12315.1| DNA ligase [Legionella longbeachae NSW150]
          Length = 671

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/713 (37%), Positives = 403/713 (56%), Gaps = 52/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           I++ +++ + L+ +I  +D  YY   +P++ D EYD   R    +    P+L  ++ P  
Sbjct: 3   IDEIKEQAARLKDKIRQYDYHYYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSPT- 61

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--NSIFFTLE 131
              ++GG    +   VTH  P LSL  +++ E+L+ F+ R+    +K D+    + FT E
Sbjct: 62  --QRVGGTPADAFAPVTHRQPMLSLSNVFSEEELQAFVKRVT---EKLDEPAQQLVFTCE 116

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  + I YE G  VYAA RGDG +GE+++A I+ I  IP VL  N  P  IE+RGE
Sbjct: 117 PKLDGLAVNITYENGVLVYAATRGDGTTGENITANIKTIAAIPLVLRSNKPPRFIEIRGE 176

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
           VY+ K+ F   N +   +G K +ANPRNAA+G LR+LNP     R L  + +G+G   + 
Sbjct: 177 VYMPKSGFEQYNKKAKELGEKTFANPRNAAAGSLRQLNPAVTANRPLAIYCYGIGACEDY 236

Query: 250 -FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 +E LQ ++ LGF V++  ++     G + YY  M + R  LP++IDG+VYKVD 
Sbjct: 237 RLPNTHWEQLQLLKELGFKVSSESKREVGIKGCLDYYCNMLARRDQLPFEIDGVVYKVDS 296

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  +R+PR+  +HKF   +  T +L +D Q+GRTG LTPVARL PVN+ G  +
Sbjct: 297 IALQQQLGFISRAPRFACAHKFPATEEITEILAVDFQVGRTGALTPVARLAPVNVAGVTV 356

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I             +DIR+GD+V+++RAG+VIP+VV +++ +R  D +  
Sbjct: 357 SNATLHNMDEIT-----------RKDIRIGDKVIIRRAGDVIPEVVSVVLEQRPADTKEI 405

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
             P  CP+C S VVR+     G+ VA  RC GGL C AQ    + HF SR A +IEGLG 
Sbjct: 406 CLPLKCPVCDSDVVRE----EGEAVA--RCIGGLFCKAQLKRMMWHFASRKAMHIEGLGS 459

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++      D      +P D++ L        + + N+   G+ S  NL  ++   +  
Sbjct: 460 VLIEQLV---DEGIVRHLP-DLYRL------DVSTLANLPRMGEKSAKNLLQALEHSKKT 509

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF+++LGIR +G   AR LA+++           +I A +N     L+ +  +G + 
Sbjct: 510 TLSRFLYALGIREIGEASARVLAEHF----------GDIEAISNATEADLMSLEDMGPVG 559

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           A  IV F+    N+  ++ LL E+    P I + ++N    +  K +V TGTL  + R +
Sbjct: 560 AANIVHFFAQTHNLQVIQHLL-ELGIHWPKIEKKQQNKEHPLFGKTVVLTGTLNTLSREE 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+  +  LGA VS  +S KTD +I G   G+KL+KA  LG+ I++EEQFL +L
Sbjct: 619 AKAKLLILGAKVSGSVSAKTDYVIAGIEAGTKLDKANNLGISILDEEQFLHML 671


>gi|270159993|ref|ZP_06188649.1| DNA ligase [Legionella longbeachae D-4968]
 gi|269988332|gb|EEZ94587.1| DNA ligase [Legionella longbeachae D-4968]
          Length = 671

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/713 (37%), Positives = 403/713 (56%), Gaps = 52/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           I++ +++ + L+ +I  +D  YY   +P++ D EYD   R    +    P+L  ++ P  
Sbjct: 3   IDEIKEQAARLKDKIRQYDYHYYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSPT- 61

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD--NSIFFTLE 131
              ++GG    +   VTH  P LSL  +++ E+L+ F+ R+    +K D+    + FT E
Sbjct: 62  --QRVGGTPADAFAPVTHRQPMLSLSNVFSEEELQAFVKRVT---EKLDEPAQQLVFTCE 116

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  + I YE G  VYAA RGDG +GE+++A I+ I  IP VL  N  P  IE+RGE
Sbjct: 117 PKLDGLAVNITYENGVLVYAATRGDGTTGENITANIKTIAAIPLVLRSNKPPRFIEIRGE 176

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
           VY+ K+ F   N +   +G K +ANPRNAA+G LR+LNP     R L  + +G+G   + 
Sbjct: 177 VYMPKSGFEQYNKKAKELGEKTFANPRNAAAGSLRQLNPAVTANRPLAIYCYGIGACEDY 236

Query: 250 -FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 +E LQ ++ LGF V++  ++     G + YY  M + R  LP++IDG+VYKVD 
Sbjct: 237 RLPNTHWEQLQLLKELGFKVSSESKREVGIKGCLXYYCNMLARRDQLPFEIDGVVYKVDS 296

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  +R+PR+  +HKF   +  T +L +D Q+GRTG LTPVARL PVN+ G  +
Sbjct: 297 IALQQQLGFISRAPRFACAHKFPATEEITEILAVDFQVGRTGALTPVARLAPVNVAGVTV 356

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I             +DIR+GD+V+++RAG+VIP+VV +++ +R  D +  
Sbjct: 357 SNATLHNMDEIT-----------RKDIRIGDKVIIRRAGDVIPEVVSVVLEQRPADTKEI 405

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
             P  CP+C S VVR+     G+ VA  RC GGL C AQ    + HF SR A +IEGLG 
Sbjct: 406 CLPLKCPVCDSDVVRE----EGEAVA--RCIGGLFCKAQLKRMMWHFASRKAMHIEGLGS 459

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             ++      D      +P D++ L        + + N+   G+ S  NL  ++   +  
Sbjct: 460 VLIEQLV---DEGIVRHLP-DLYRL------DVSTLANLPRMGEKSAKNLLQALEHSKKT 509

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF+++LGIR +G   AR LA+++           +I A +N     L+ +  +G + 
Sbjct: 510 TLSRFLYALGIREIGEASARVLAEHF----------GDIEAISNATEADLMSLEDMGPVG 559

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           A  IV F+    N+  ++ LL E+    P I + ++N    +  K +V TGTL  + R +
Sbjct: 560 AANIVHFFAQTHNLQVIQHLL-ELGIHWPKIEKKQQNKEHPLFGKTVVLTGTLNTLSREE 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+  +  LGA VS  +S KTD +I G   G+KL+KA  LG+ I++EEQFL +L
Sbjct: 619 AKAKLLILGAKVSGSVSAKTDYVIAGIEAGTKLDKANNLGISILDEEQFLHML 671


>gi|116748867|ref|YP_845554.1| DNA ligase, NAD-dependent [Syntrophobacter fumaroxidans MPOB]
 gi|116697931|gb|ABK17119.1| DNA ligase, NAD-dependent [Syntrophobacter fumaroxidans MPOB]
          Length = 694

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/713 (37%), Positives = 388/713 (54%), Gaps = 59/713 (8%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E+A   + +L +EI +H+  YY   +P I D  YD L R    +  ++P L     P+ P
Sbjct: 24  EKAHARIEALREEIRHHNYLYYVLDRPEISDEAYDGLFRELVRLEESYPALI---TPDSP 80

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G           H+IP LSLE   +  ++ +F  R+ +    + D  + F  EPK+
Sbjct: 81  TQRVGAAPAEKFLPFPHTIPMLSLENAMSEAEVFEFARRVRKILGDRGD--VDFMAEPKM 138

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-----SLNIPEIIEVRG 189
           DG  + + YE G+   A  RGDG+ GEDV+   + I  IP  L       + P  I VRG
Sbjct: 139 DGLAVELVYENGELTGAGTRGDGYVGEDVTRNAKTIRAIPLKLYAGAGGASPPARIAVRG 198

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EVY+ + DF ALN      G   +ANPRNAA+G LR+L+P+    R L  F +G+G+ S 
Sbjct: 199 EVYMDRKDFAALNRSREQAGEPLFANPRNAAAGSLRQLDPSVTAARSLKAFFYGVGEVSG 258

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
              K Q + L+++R  G PVN   R   +    VS+YNE+ + R  LP++IDG+V KV+ 
Sbjct: 259 YRFKTQAQTLEQLRRWGLPVNPLSRVCPSIEDAVSFYNEIAAGRDALPFEIDGVVVKVNS 318

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q+ LGE++RSPRW I++KF+  QA TR+LDI +Q+GRTG+LTPVA LEPV +GG  +
Sbjct: 319 IEWQEMLGEKSRSPRWAIAYKFSPHQARTRVLDIKVQVGRTGVLTPVAELEPVTVGGVTV 378

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
             ATLHN+D ++            +DIRV D+V+V+RAG+VIP+VV++I   R    + F
Sbjct: 379 RRATLHNQDEVE-----------RKDIRVRDQVMVRRAGDVIPEVVEVIGEARTGGEEVF 427

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
             P  CP C S VVR   P+     A HRC     C AQ    L+HF SRDA NIEGLGK
Sbjct: 428 QMPGQCPSCGSEVVR--LPEE----AVHRCL-NRNCPAQIKASLRHFASRDAMNIEGLGK 480

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
             +            +   +D++ L      S   +E + GF   S  NL +SI + +  
Sbjct: 481 NIVSMLVDRG----IVESVSDLYRL------SVETLEQLPGFAGKSSRNLVESIERSKKT 530

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L  F+++LGI HVG+ +AR LA+ +            + A        L+ V  VG+++
Sbjct: 531 NLADFLYALGIYHVGSHVARLLAERF----------GTLDAVRRASVEELMSVNGVGEVV 580

Query: 609 AQAIVEFYQNPRNICAVEALLK------EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           A+++V ++  P N   VE+LL          P  G     V +    K +VFTG L  + 
Sbjct: 581 ARSVVHYFSLPANRTLVESLLSAGLEMAATEPEAG----PVDAFWNGKTVVFTGALSSMT 636

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           R  A       GA VS  +SRKTDI++ G +PGSK+EKA+QLG+ I++E +FL
Sbjct: 637 RSNAAALTASRGARVSDSVSRKTDIVVAGADPGSKVEKARQLGITILDEREFL 689


>gi|167581473|ref|ZP_02374347.1| DNA ligase, NAD-dependent [Burkholderia thailandensis TXDOH]
          Length = 691

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 269/729 (36%), Positives = 408/729 (55%), Gaps = 59/729 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLVGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +++VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTSEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G    +        +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S       ++ I+  + D+   L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGS-------LDPIMDASIDE---L 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE------VSPSIGRHEKNVSSEIENKKL 652
           + V  VG I+A++I +F+    N   +E L  +        P   R  + V   +  K +
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGV---LAGKTV 620

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E 
Sbjct: 621 VLTGTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEA 680

Query: 713 QFLFLLQQY 721
               LL+ +
Sbjct: 681 GMHKLLEGH 689


>gi|89075460|ref|ZP_01161871.1| DNA ligase [Photobacterium sp. SKA34]
 gi|89048732|gb|EAR54303.1| DNA ligase [Photobacterium sp. SKA34]
          Length = 670

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 255/695 (36%), Positives = 405/695 (58%), Gaps = 49/695 (7%)

Query: 30  YHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKV 89
           YH   YY    P I D+EYD + ++   I    P+    + P+    ++GG       +V
Sbjct: 18  YHGHRYYVEDNPEIPDAEYDRMMQQLLKIEAEHPEWVTVDSPS---QRVGGAALEGFTQV 74

Query: 90  THSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFV 149
            H I  LSL+  +N +DLR F  R+    + +   +  +  EPK+DG  +++ YEKG  V
Sbjct: 75  KHEIAMLSLDNAFNDDDLRAFQKRLQD--RLRSGATFSYCCEPKLDGLAVSLMYEKGVLV 132

Query: 150 YAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAV 208
            AA RGDG +GE+++  +R I  IP ++   + PE +EVRGEV++ K  F  LN + +  
Sbjct: 133 QAATRGDGATGENITHNVRTIRAIPLKLQGDDWPERLEVRGEVFMPKKGFEELNAKALKK 192

Query: 209 GRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT-SEIFAKGQYEMLQKMRCLGF 266
           G K +ANPRNAA+G LR+L+P    TR L+F+ + +G       A  QYE L +++  G 
Sbjct: 193 GDKAFANPRNAAAGSLRQLDPKITATRPLSFYAYAVGVVDGRELANTQYERLCQLKAWGL 252

Query: 267 PVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMI 326
           P+   +R+ ++   +++Y+  +   R +L Y+IDG+V KVD+   Q+QLG  AR+PRW I
Sbjct: 253 PMCPEIRKVDSIEEVIAYHQNIGEKRQSLGYEIDGVVIKVDDVDTQQQLGFVARAPRWAI 312

Query: 327 SHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASG 386
           ++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  ++NATLHN D         
Sbjct: 313 AYKFPAQEEMTTLNNVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLHNAD--------- 363

Query: 387 KVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLN 446
           +V R G  + +GD V+++RAG+VIP++  ++ + R  +AQ   FP+ CP+CQS+V R   
Sbjct: 364 EVARLG--VMIGDTVIIRRAGDVIPQIASVVESRRPANAQAIVFPTECPVCQSKVER--- 418

Query: 447 PKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRI 506
              G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G G++ ++     E     +  
Sbjct: 419 -IEGEAVA--RCTGGLFCQAQRKEALKHFVSRKALDVDGCGEKVIEQLVDRE----MVTT 471

Query: 507 PADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEI 566
           PAD+F     + T   ++      G  S   L D++N  +  +L RFI+SLGIR VG   
Sbjct: 472 PADLFKFSAGEVTVLERM------GPKSAQKLVDALNASKLTTLPRFIYSLGIREVGEAT 525

Query: 567 ARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVE 626
           A +LA Y+ + ++ +Q   +           LI VP VG I+A  I  F++   N+  V 
Sbjct: 526 AANLANYFETLESISQATKD----------QLIEVPDVGGIVAAHIFNFFREEHNMVVVN 575

Query: 627 ALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
             L+EV    P I + +++V   ++ K +V TG+L ++ R  A+  + +LGA V+  +S+
Sbjct: 576 E-LQEVGIHWPEIEKIDEDVELPLDGKVVVLTGSLSQLTRSDAKAALQKLGAKVTGSVSK 634

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           KTD+++ G+  GSKL KAQ+LG++I +E++ + L+
Sbjct: 635 KTDLLVAGEAAGSKLTKAQELGIEIWDEQKLVDLM 669


>gi|241668131|ref|ZP_04755709.1| DNA ligase (NAD(+)) [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876666|ref|ZP_05249376.1| DNA ligase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254842687|gb|EET21101.1| DNA ligase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 678

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/716 (37%), Positives = 409/716 (57%), Gaps = 56/716 (7%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           + L+  Q +  +  L + +      Y+   KP+I DS+YD L R    +    P L  S 
Sbjct: 12  KTLTKAQLKSYIDDLAEYLGEQSYLYHTIDKPVITDSDYDKLFRLLQDLVDDNPQLKPS- 70

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
             N  L+++GG++      + H     SL  ++++E+LR F  +I        +  I   
Sbjct: 71  --NSVLDRVGGDVLAGFETIKHKKKMTSLANVFSLEELRDFYDKI--------EYDIELE 120

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVR 188
            EPK+DG  I+I Y+ GKF YA  RGDG  GE VS  ++ I  +P  L+  N PE +EVR
Sbjct: 121 CEPKMDGLAISIFYKNGKFDYAVTRGDGIQGEKVSENVKTIRNVPLKLNTSNPPEELEVR 180

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKTS 247
           GE+ + K  FL+LN+ M     K +ANPRNAA+G +R L+   +  R L  + +G+G  S
Sbjct: 181 GEIILDKQSFLSLNEYMQTHENKTFANPRNAAAGSIRMLDSKVVAKRPLKLYSYGIGYFS 240

Query: 248 EIFA--KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           + F   + Q+E++  ++  GF +++ +  A  F  +  Y+++M   R+ L YDIDGLV+K
Sbjct: 241 KDFVHPETQFELMNLLQSFGFTISDNMFLAKNFSEVEVYHHKMSHQRADLAYDIDGLVFK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V+   LQ  +G  AR P+W I++KF  ++  + +L+++ Q+GRTG +TPVARL+PV +GG
Sbjct: 301 VNNIKLQDTIGYTARGPKWAIAYKFPAEEVESEVLNVEFQVGRTGAITPVARLKPVAVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHN + IK            +DIRVGDRV+V+RAG+VIP+VV  +   R PDA
Sbjct: 361 VIVSNATLHNINEIK-----------RKDIRVGDRVIVRRAGDVIPEVVKSLSEYRKPDA 409

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           Q    P+ CP+C S  + ++N +     A +RCTGG  C AQ  ERLKHFVSR A +I+ 
Sbjct: 410 QMVEMPTNCPVCDS-TIENINDQ-----AIYRCTGGWHCQAQTTERLKHFVSRKAMDIDK 463

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG + ++    ++     I+ PADI+ L   Q T   ++      G  S  N+ DSI K 
Sbjct: 464 LGAKLIEQLVAAD----LIKYPADIYKLNFEQLTGLERM------GAKSSQNVLDSITKS 513

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           +  SL RFIF++GI+ VG   + +LA ++ S ++F +            +  LI +  +G
Sbjct: 514 KEPSLARFIFAIGIKDVGEVSSEALANHFGSLESFREA----------KFEQLIEINDIG 563

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIE---NKKLVFTGTLQKIQ 662
           +IIA+ IV F+Q+  NI  V+ LL   S +I   EK   +  E   NK +V TGT +   
Sbjct: 564 EIIAKNIVSFWQDSLNIQIVDELLGN-SINIQNPEKIEQAHNESFTNKTIVITGTFENYN 622

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +  + +  +GA V++ +S+KTD++I GDN GSKL KAQ LGV+++ EE    LL
Sbjct: 623 RTELTQLLKSMGAKVTSSVSKKTDMVICGDNAGSKLIKAQDLGVEVIFEEDLQNLL 678


>gi|227328979|ref|ZP_03833003.1| NAD-dependent DNA ligase LigA [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 684

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 258/718 (35%), Positives = 409/718 (56%), Gaps = 51/718 (7%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E   +  A   ++ L + + +H+  Y+    P I D EYD L +   ++  A P+L  S+
Sbjct: 7   EPAEVNVAALRVAELRRVLRHHEYKYHVEDAPEIPDVEYDKLMQELKSLEAAHPELVTSD 66

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P     ++G     +  +V H +P LSL+ +++ E    F  RI    +  DD  + F 
Sbjct: 67  SPT---QRVGAAPLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRLKNGDD--LTFC 121

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVR 188
            E K+DG  +++ YE+G  V AA RGDG +GE++++ IR +  IP R+   NIP  +EVR
Sbjct: 122 CELKLDGLAVSLLYEEGVLVQAATRGDGTTGENITSNIRTVAAIPLRLEGDNIPRRVEVR 181

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGK-T 246
           GEV++  + F  LN+E    G K +ANPRNAA+G LR+L+P    TR L FF +G+G   
Sbjct: 182 GEVFMKHSGFEKLNEEARRTGSKVFANPRNAAAGSLRQLDPRITATRPLTFFCYGVGLLE 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
             +     +E L + +  G PV++ ++       ++ +Y +++  RS+L +DIDG+V KV
Sbjct: 242 GGVLPASHWERLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSSLGFDIDGVVVKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D   LQ++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G 
Sbjct: 302 DSLELQERLGFVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHN D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    +
Sbjct: 362 IVSNATLHNADEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVR 410

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P  FP+ CP+C S V R      G+ V   RCT GL C AQ+ E LKHFVSR A ++EG+
Sbjct: 411 PILFPAACPVCGSDVER----VEGEAVT--RCTAGLICGAQRKEALKHFVSRRALDVEGM 464

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + +D   + E     ++ PAD+F L     T   ++      G  S TNL +++ K +
Sbjct: 465 GDKIIDQLVEKE----YVKTPADLFRLSAGIMTGLDRM------GPKSATNLVNALEKAK 514

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           + +L RF+++LGIR VG   A +LA ++ S       +  + A + D   +L+ VP VG 
Sbjct: 515 STTLARFLYALGIRDVGESTAANLAAHFGS-------LEALFAADED---ALLEVPDVGK 564

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE------KNVSSEIENKKLVFTGTLQK 660
           ++A  +  F +   N   +  L      +I   E      + + S    K +V TG+L  
Sbjct: 565 VVAAHVRHFLEEEHNQTVIRELTDPAGINIHWPEVQVVNVEEIDSPFAGKTVVLTGSLSI 624

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 625 LSRDEAKDRLTALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLL 682


>gi|88861394|ref|ZP_01136024.1| NAD-dependent DNA ligase [Pseudoalteromonas tunicata D2]
 gi|88816660|gb|EAR26485.1| NAD-dependent DNA ligase [Pseudoalteromonas tunicata D2]
          Length = 673

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 260/713 (36%), Positives = 416/713 (58%), Gaps = 48/713 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E    ++++L+ ++  ++  YY    P + DSEYD + R   A+   +P    ++ P+  
Sbjct: 3   ESVLSQIAALKVQLEEYNYQYYVLDNPSVPDSEYDRVMRELIALETQYPQFLSADSPS-- 60

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             K+GGE   S  +V H +P LSL+  ++  + R F  R+    + KD  ++ F  EPK+
Sbjct: 61  -QKVGGEALGSFSQVQHLVPMLSLDNAFDETEFRSFNKRLQD--RLKDTTTLTFCCEPKL 117

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYI 193
           DG  ++I Y+ G  V AA RGDG +GE+++  ++ I  +P ++   +IP  +EVRGEV++
Sbjct: 118 DGLAVSILYQDGVLVQAATRGDGQTGENITENVKTIRNVPLKLRGESIPHRLEVRGEVFM 177

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKT-SEIF 250
               F  +N+  I    K +ANPRNAA+G LR+L+ + IT  R L F+ +G+G     + 
Sbjct: 178 DSAGFAKMNELAIKNDGKVFANPRNAAAGSLRQLD-SKITAKRPLMFYAYGMGIIEGGVV 236

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               +  LQ +   G P++   +        ++YY ++ + RS L Y+IDG+V KV++ +
Sbjct: 237 PDDHFAQLQALGDWGLPMSPETKLVTGVDDALAYYQDIMNRRSQLKYEIDGVVIKVNDKA 296

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW I+ KF  ++  T+LLD++ Q+GRTG +TPVARLEPV +GG  ++N
Sbjct: 297 LQQTLGFVARAPRWAIAFKFPAQEEMTQLLDVEFQVGRTGAITPVARLEPVFVGGVTVSN 356

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN+D I+ L            +++GD V+++RAG+VIP++  +++ ER  DA+   F
Sbjct: 357 ATLHNQDEIERL-----------GVKIGDTVIIRRAGDVIPQITQVVLAERKTDAKDIVF 405

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+CQS+V R +    G+ VA  RC+GGL C AQ+ E +KHFVSR AF+I+G+G + 
Sbjct: 406 PSNCPVCQSKVERTV----GEAVA--RCSGGLVCGAQRKEAIKHFVSRKAFDIDGMGDKI 459

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + E     I  PA+IFTL++        +E++   G  S   L  +I   +  +L
Sbjct: 460 VEQLVERE----LIHTPAEIFTLRQGH------LESLERMGPKSAEKLVAAIGNAKQTTL 509

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF++SLGIR VG   A +LA +YL+       ++ I+A + D   SL  V  VG+I+A+
Sbjct: 510 ARFLYSLGIREVGEATALNLANHYLT-------LDAIMAASVD---SLQEVADVGEIVAK 559

Query: 611 AIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
            +  F++   N   V+AL+   ++ +    +      +     V TGTL ++ R  A+  
Sbjct: 560 HVNFFFREAHNRAVVDALIAAGITWAALEPKSEAEQPLAGLTYVLTGTLLQMGRSDAKNR 619

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           +  LGA VS  +S KTD ++ GD  GSKL KAQ+LG+K++ E+  + LL QYN
Sbjct: 620 LQALGAKVSGSVSAKTDALVAGDKAGSKLTKAQELGIKVLFEDDLIALLAQYN 672


>gi|323499974|ref|ZP_08104932.1| NAD-dependent DNA ligase LigA [Vibrio sinaloensis DSM 21326]
 gi|323314991|gb|EGA68044.1| NAD-dependent DNA ligase LigA [Vibrio sinaloensis DSM 21326]
          Length = 669

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 259/707 (36%), Positives = 399/707 (56%), Gaps = 49/707 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           +++L+ L + + YH   YY    P I D+EYD L R    +    PDL   + P+    +
Sbjct: 6   QEKLNQLRETLHYHGVKYYVEDSPEIPDAEYDRLMRELMELESQHPDLMSLDSPS---QR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIY-RFWQKKDDNSIFFTLEPKIDG 136
           +GG        V H IP LSL+  ++  +L  F  R+  R    K D    F  EPK+DG
Sbjct: 63  VGGAALDGFGSVNHEIPMLSLDNAFDDAELESFNKRMADRIPSAKFD---VFCCEPKLDG 119

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISK 195
             +++ YE G  V AA RGDG +GE+++  +R I  IP ++     PE IEVRGEV++ K
Sbjct: 120 LAVSLLYENGVLVQAATRGDGTTGENITENVRTIKAIPLKLQGQGWPERIEVRGEVFMPK 179

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKT-SEIFAKG 253
             F  LN++ +  G K + NPRNAA+G LR+L+     TR L+F+ + +G       +  
Sbjct: 180 AGFDKLNEQALKKGEKVFVNPRNAAAGSLRQLDSRITATRPLSFYAYSVGVVQGATLSSS 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            YE   +++  G P+    ++ +    + +YY ++   R  LPY+IDG+V KVD+ +LQ+
Sbjct: 240 HYERFLQLKGWGLPMCPETKRVSGLDEVKAYYQDILQRREALPYEIDGVVIKVDDIALQE 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  ++NATL
Sbjct: 300 QLGFVARAPRWAIAYKFPAQEELTTLNDVEFQVGRTGAITPVAKLEPVFVGGVTVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            + +GD V+++RAG+VIP++V ++V+ R   A+   FP+ 
Sbjct: 360 HNADEIERL-----------SVMIGDTVVIRRAGDVIPQIVSVVVDRRPDSAREIVFPAL 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+CQS+V R      G+ VA  RC+GGL C AQ+ E LKHFVSR A +++GLG++ ++ 
Sbjct: 409 CPVCQSQVER----IEGEAVA--RCSGGLVCQAQRKEALKHFVSRKALDVDGLGEKVIEQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     +  PAD+F L      S   I  +   G  S  N+ D++N+ +  +L RF
Sbjct: 463 LVDRE----MVETPADLFKL------SAGVITVLDRMGPKSAQNVVDALNQSKQTTLPRF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           ++SLGIR VG   A +LA+++ S Q   +  +            LI V  +G+I+A  I 
Sbjct: 513 LYSLGIREVGEATAANLAQHFKSLQAVTKATHE----------ELIAVSDIGEIVASHIT 562

Query: 614 EFYQNPRNICAVEALLKEV--SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
            F+    N   +  LL++    P I   +++    +  K +V TG+L ++ R  A+  + 
Sbjct: 563 AFFAQESNQQVIGQLLEQGINWPEIEERDESTPQPLAGKTVVLTGSLSQLSRSDAKAALQ 622

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            LGA V+  +S+KTDI+  G+N GSKL KAQ LGV+I  E+  + L+
Sbjct: 623 DLGAKVTGSVSKKTDILFAGENAGSKLAKAQDLGVEIRTEQDLIDLI 669


>gi|197336238|ref|YP_002156719.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
 gi|254781450|sp|B5FGU7|DNLJ_VIBFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197317728|gb|ACH67175.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
          Length = 668

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 261/714 (36%), Positives = 409/714 (57%), Gaps = 54/714 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SIEQ    L  L+Q+++YH   YY    P + D+EYD + +   +I    P+L   + P
Sbjct: 1   MSIEQT---LDELKQQLNYHAYRYYVEDSPELPDAEYDRMMQELLSIESEHPELVTVDSP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           +    ++GGE      ++ H IP LSL+  ++ E+L  F  R+      K  +   F  E
Sbjct: 58  S---QRVGGEALDGFTQIQHEIPMLSLDNAFSDEELEAFEKRMNDRLISKPVS--LFCCE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGE 190
           PK+DG  +++ Y  GK V A  RGDG +GE+++  +R I  IP  L     P  +EVRGE
Sbjct: 113 PKLDGLAVSLLYVNGKLVQAGTRGDGTTGENITENVRTIRCIPLTLQGEGWPTRLEVRGE 172

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG--KTS 247
           V++ K  F ALN+  +  G KP+ANPRNAA+G LR+L+     TR L+F+ + +G  +  
Sbjct: 173 VFMPKAGFEALNERALKRGEKPFANPRNAAAGSLRQLDSKITATRPLSFYAYSVGVIEGG 232

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+     Y+   +++  G P+    +Q  +   + +YY ++   R  L Y+IDG+V KVD
Sbjct: 233 EL-ETSHYQRFVQLKSWGLPMCEETKQCYSLTEVKAYYKDILKRRDALKYEIDGVVIKVD 291

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + +LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  
Sbjct: 292 DIALQEQLGFVARAPRWAIAYKFPAQEELTVLNDVEFQVGRTGAITPVAKLEPVFVGGVT 351

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHN D I  L            + +GD V+++RAG+VIP++V ++   R  D++ 
Sbjct: 352 VSNATLHNADEIARL-----------GVHIGDTVIIRRAGDVIPQIVSVVEARRPTDSKA 400

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
             +P+ CP+C S + R      G+ V   RC  GL C AQ+ E LKHFVSR A +++GLG
Sbjct: 401 IVYPTHCPVCGSNLER----VEGEAVT--RCGAGLVCQAQRKEALKHFVSRKALDVDGLG 454

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + ++     E     +  PAD+F L     T   ++      G  S  N+ D++NK + 
Sbjct: 455 DKVVEQLVDKE----MVETPADLFKLSAGVLTVLERM------GPKSAQNVVDALNKAKA 504

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF++SLGIR VG   A +LA ++ + +          A     +  LI V  VGDI
Sbjct: 505 TTLPRFLYSLGIREVGEATAANLAAHFYTLE----------AIQVATFEQLIEVSDVGDI 554

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           +A+ ++ F+  P N   ++  L+E+    P I   +++V   +  K +V TGTL K++R+
Sbjct: 555 VAKHVLNFFAEPHNKTVIDD-LQEMGIHWPEIKALDESVPQPLAGKVVVLTGTLHKLKRN 613

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+  + +LGA V+  +S+KTDI+  G+  GSKL KA++LGV++MNEEQ + LL
Sbjct: 614 EAKAALQELGAKVTGSVSKKTDILFAGEAAGSKLAKAEELGVEVMNEEQLIELL 667


>gi|167619582|ref|ZP_02388213.1| DNA ligase, NAD-dependent [Burkholderia thailandensis Bt4]
          Length = 691

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/729 (36%), Positives = 408/729 (55%), Gaps = 59/729 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +++VRGEV + + DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFRRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTSEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G    +        +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S       ++ I+  + D+   L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGS-------LDPIMDASIDE---L 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE------VSPSIGRHEKNVSSEIENKKL 652
           + V  VG I+A++I +F+    N   +E L  +        P   R  + V   +  K +
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGV---LAGKTV 620

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E 
Sbjct: 621 VLTGTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEA 680

Query: 713 QFLFLLQQY 721
               LL+ +
Sbjct: 681 GMHKLLEGH 689


>gi|261868202|ref|YP_003256124.1| NAD-dependent DNA ligase LigA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413534|gb|ACX82905.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 670

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/708 (37%), Positives = 412/708 (58%), Gaps = 58/708 (8%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++  L + + +H+  Y+    P I DSEYD L  +  A+    P+L  ++ P     +
Sbjct: 6   QQQIDDLRKTLRHHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELVTADSPT---QR 62

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G        ++ H IP LSL+  ++ E+   F+ RI        +  + F  EPK+DG 
Sbjct: 63  VGARPLSEFAQIRHEIPMLSLDNAFSNEEFFSFVKRIQDRLALVPE-PLTFCCEPKLDGL 121

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKN 196
            ++I Y  G    AA RGDG +GED++  IR I  IP ++L+ N P  +EVRGEV++   
Sbjct: 122 AVSILYVNGVLSQAATRGDGTTGEDITQNIRTIRNIPLQLLTDNPPARLEVRGEVFMPHA 181

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHGLGKTSEIFAKG 253
            F  LN+  +  G K +ANPRNAA+G LR+L+P   ++    LN +  G+ +  E+    
Sbjct: 182 GFERLNERALEHGEKTFANPRNAAAGSLRQLDPKITSQRPLMLNAYSIGIAEGVEL-PPT 240

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +E LQ ++ +G PVNN ++  +    ++++Y  + + RS+L YDIDG V K+++ +LQ+
Sbjct: 241 HFERLQWLKSVGIPVNNEIQLCDGIENVLNFYRTIMAKRSSLGYDIDGAVLKINDIALQQ 300

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  +++PRW I++KF  ++  TRLLD++ QIGRTG +TPVA+LEPV++GG  ++NATL
Sbjct: 301 RLGFISKAPRWAIAYKFPAEEVRTRLLDVEFQIGRTGAVTPVAKLEPVSVGGVTVSNATL 360

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D IK L            I +GD VL++RAG+VIP+V+  +V++     +P  FP+ 
Sbjct: 361 HNNDEIKRL-----------GISIGDIVLIRRAGDVIPQVIK-LVHKAKKGNKPIVFPTH 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S ++R      G+ VA  RCTGGL C+AQ+ E LKHFVSR A +I+ +G + ++ 
Sbjct: 409 CPVCDSLIIR----IEGEAVA--RCTGGLFCAAQRKEALKHFVSRKAMDIDSVGGKLIEQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               E     I  PAD+F L     T+ T++E +   G  S  N   S+ K +N +L RF
Sbjct: 463 LVDRE----LIHTPADLFKLDL---TTLTRLERM---GPKSAENALASLEKAKNTTLARF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IF+LGIR VG   A +LA ++ + +          A  N D   L +VP VG+++A  I 
Sbjct: 513 IFALGIRDVGEATALNLANHFKTLE----------ALQNADLEQLQQVPDVGEVVANRIF 562

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE------IENKKLVFTGTLQKIQRHKAQ 667
            F++   N+  VE L+ +     G H + V  +       + K +V TGTL ++ R+ A+
Sbjct: 563 VFWREAHNVAVVEDLIAQ-----GVHWETVDVQEVKENPFKGKTVVLTGTLSQMGRNDAK 617

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
             + QLGA VS  +S KTD +I G+  GSKL KA +LGV++++EE+FL
Sbjct: 618 ALLQQLGAKVSGSVSAKTDYVIAGEAAGSKLSKAAELGVQVLSEEEFL 665


>gi|330817444|ref|YP_004361149.1| DNA ligase [Burkholderia gladioli BSR3]
 gi|327369837|gb|AEA61193.1| DNA ligase [Burkholderia gladioli BSR3]
          Length = 691

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/727 (36%), Positives = 400/727 (55%), Gaps = 60/727 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  +  Q  +  + L  E+   +  YY   +P + D+EYD L R    I    PDL  
Sbjct: 5   PVEPPA-SQPSERAAWLRNELERANHAYYVLDQPDLPDAEYDRLFRELQQIEAEHPDLI- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN--- 124
              P+ P  ++GGE       V H  P LSL   ++ ED+  F  R+     K   +   
Sbjct: 63  --TPDSPTQRVGGEAATGFTPVVHDAPMLSLNNGFSDEDIAAFDKRVADALDKAPADLAG 120

Query: 125 ----SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SL 179
                + +  E K DG  I++RYE G+FV AA RGDG +GEDV+  +R I +IP  L   
Sbjct: 121 TAIDPVEYACELKFDGLAISLRYEHGRFVQAATRGDGTTGEDVTENVRTIRSIPLTLKGK 180

Query: 180 NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLN 237
           N P +++VRGEV + K DF  LN       ++ +ANPRNAA+G LR+L+ + IT  R L+
Sbjct: 181 NPPALLDVRGEVLMYKRDFARLNQRQREAEQREFANPRNAAAGSLRQLD-SKITAQRPLS 239

Query: 238 FFVHGLGK-TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLP 296
           FF +G+G             +L      G PVN          G++++++++   R  LP
Sbjct: 240 FFAYGIGVLEGATMPDTHSGLLDWYAGFGLPVNRERAVVKGAEGLLAFFHKVGEQREALP 299

Query: 297 YDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVA 356
           YDIDG+VYKV+    Q++LG  +R+PR+ ++HKF  ++A TRLL I++Q+GRTG +TPVA
Sbjct: 300 YDIDGVVYKVNRRDEQERLGFVSRAPRFALAHKFPAQEALTRLLAIEVQVGRTGAITPVA 359

Query: 357 RLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDI 416
           RLEPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  
Sbjct: 360 RLEPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSA 408

Query: 417 IVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFV 476
           +++ R  DA  F  P+ CP+C SR+ R   P+     A  RCTGGL C AQ+ + L HF 
Sbjct: 409 LLDRRPADAAEFVMPTECPVCGSRIER--LPEE----AIARCTGGLFCPAQRKQALWHFA 462

Query: 477 SRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVT 536
            R A +I+GLG++ +D   +       +R PAD+F L          +  +  F D S  
Sbjct: 463 QRRALDIDGLGEKIIDQLVEQN----LVRTPADLFHL------GFATLAALDRFADKSAQ 512

Query: 537 NLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWL 596
           NL DS+ K R+ +L RFI++LGIRHVG   A+ LAK++ S Q         +   ND   
Sbjct: 513 NLLDSLEKARHTTLGRFIYALGIRHVGESTAKDLAKHFGSLQPIMDATTEQLLEVND--- 569

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV----SPSIGRHEKNVSSEIENKKL 652
                  VG ++A+++ +F+    N   +  L ++V     P   R  + V   +  K +
Sbjct: 570 -------VGPVVAESLHQFFAEEHNRTVIAQLREKVDWPEGPPAPREPQGV---LAGKTV 619

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R +A+  +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+
Sbjct: 620 VLTGTLPTLGRDEAKALLEAAGAKVTGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDED 679

Query: 713 QFLFLLQ 719
               LL+
Sbjct: 680 GMHLLLK 686


>gi|167837047|ref|ZP_02463930.1| DNA ligase, NAD-dependent [Burkholderia thailandensis MSMB43]
          Length = 691

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 267/729 (36%), Positives = 410/729 (56%), Gaps = 59/729 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  +  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEPPA-SQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFVELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVAGGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKATDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L   +
Sbjct: 121 VTEPVEYACELKFDGLAISLRYEGGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGRH 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +++VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTSEIFAKGQYE-MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G    +   G +  +L     LG PVN          G++ +++ +   R +LPYD
Sbjct: 241 AYGIGVLDGVEMPGTHSGLLDWYETLGLPVNRERAVVRGAAGLLGFFHSVGERRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SR+ R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRIERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S       ++ ++  + D+   L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGS-------LDPVMDASIDE---L 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE------VSPSIGRHEKNVSSEIENKKL 652
           + V  VG I+A++I +F+    N   +E L  +        P   R  + V   +  K +
Sbjct: 564 LEVNDVGPIVAESIHQFFAEEHNRTVIEQLRAKGKVTWPEGPPAPRAPQGV---LAGKTV 620

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E 
Sbjct: 621 VLTGTLPTLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEA 680

Query: 713 QFLFLLQQY 721
               LL+ +
Sbjct: 681 GMHKLLEGH 689


>gi|170692136|ref|ZP_02883299.1| DNA ligase, NAD-dependent [Burkholderia graminis C4D1M]
 gi|170142566|gb|EDT10731.1| DNA ligase, NAD-dependent [Burkholderia graminis C4D1M]
          Length = 693

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/705 (37%), Positives = 395/705 (56%), Gaps = 49/705 (6%)

Query: 24  LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMN 83
           L  E+   +  YY   +P + D+EYD L +  ++I    PDL     P+ P  ++GGE  
Sbjct: 26  LRAELERANYAYYVLDQPDLPDAEYDKLFKELESIEAEHPDLIV---PDSPTQRVGGEAA 82

Query: 84  LSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFW---QKKDDNSIFFTLEPKIDGTMIT 140
                V H  P LSL   +  ED+  F  R+        K+    + +  E K DG  I+
Sbjct: 83  SGFEPVVHDQPMLSLNNGFADEDIIAFDKRVGDALGNNAKEPPVPVDYATELKFDGLAIS 142

Query: 141 IRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFL 199
           +RY  G FV AA RGDG +GE+V+  IR + +IP R+    +P I++VRGEV + K DF 
Sbjct: 143 LRYVDGVFVQAATRGDGATGENVTENIRTVRSIPLRLKGKRVPHILDVRGEVLMFKRDFE 202

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQY-EM 257
            LN+   A G K +ANPRNAA+G LR+L+P     R L+FF +G+G    I     + E+
Sbjct: 203 RLNERQRAAGHKEFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGIEMPATHSEL 262

Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317
           L   + LG PVN+         G++++++ +   R  LPYDIDG+VYKV+    Q+ LG 
Sbjct: 263 LDWYKELGLPVNSERAVVKGAEGLLAFFHAVGEKRDKLPYDIDGVVYKVNRRDEQEALGF 322

Query: 318 RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED 377
            +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +TNATLHNED
Sbjct: 323 VSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVTNATLHNED 382

Query: 378 YIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPIC 437
            ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA+ F  P+ CP+C
Sbjct: 383 EVR-----------RKDIRIGDTVIVRRAGDVIPEVVSALIDRRPDDAREFVMPTHCPVC 431

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
            S + R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++ +D   + 
Sbjct: 432 GSNIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEKIIDQLVEQ 485

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
                 +R PAD+F L        + +  +  F D S  NL DS+ K R+ +L RFI++L
Sbjct: 486 N----LVRTPADLFNL------GFSTLAQLDRFADKSAQNLLDSLEKARHTTLSRFIYAL 535

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ 617
           GIRHVG   A+ LAK++ S     +     +   ND          VG ++A++I +F+ 
Sbjct: 536 GIRHVGESTAKDLAKHFGSLDPIMEASVEALLEVND----------VGPVVAESIHQFFA 585

Query: 618 NPRNICAVEALL---KEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLG 674
              N   +E L    K   P      +     +  K +V TGTL  + R +A+E +   G
Sbjct: 586 EEHNRTVIEQLRAHGKVTWPEGPPAPRAPQGVLAGKTIVLTGTLPNLAREEAKEMLEAAG 645

Query: 675 AVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 646 AKVAGSVSKKTDYVVAGAEAGSKLVKAEELGIPVLDEDGMRKLLE 690


>gi|83720010|ref|YP_442546.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|257138755|ref|ZP_05587017.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|123753789|sp|Q2SX03|DNLJ_BURTA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83653835|gb|ABC37898.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
          Length = 691

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/729 (36%), Positives = 407/729 (55%), Gaps = 59/729 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLN 180
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +++VRGEV + + DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFRRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTSEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G    +        +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  + 
Sbjct: 361 EPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSAVF 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S       ++ I+  + D+   L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGS-------LDPIMDASIDE---L 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE------VSPSIGRHEKNVSSEIENKKL 652
           + V  VG I+A++I +F+    N   +E L  +        P   R  + V   +  K +
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGV---LAGKTV 620

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E 
Sbjct: 621 VLTGTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEA 680

Query: 713 QFLFLLQQY 721
               LL+ +
Sbjct: 681 GMHKLLEGH 689


>gi|170727191|ref|YP_001761217.1| DNA ligase, NAD-dependent [Shewanella woodyi ATCC 51908]
 gi|254781418|sp|B1KJT5|DNLJ_SHEWM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169812538|gb|ACA87122.1| DNA ligase, NAD-dependent [Shewanella woodyi ATCC 51908]
          Length = 670

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/711 (37%), Positives = 393/711 (55%), Gaps = 54/711 (7%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
            A +E+  L + I+ H+  YY    P + D+EYD L  R   +    P L     P  P 
Sbjct: 2   HAIEEIKQLTETINEHNHSYYVEDSPSVPDAEYDRLINRLKQLEGENPHLCL---PTSPT 58

Query: 76  NKIGGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
            ++GG M L+ F ++TH  P LSL+ +++ E+   F  RI      K   +  F  EPK+
Sbjct: 59  QRVGG-MALAKFDQITHLKPMLSLDNVFSEEEFEAFYKRI----SDKTSEAPTFCCEPKL 113

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYI 193
           DG  ++I Y  G +  AA RGDG +GED+S  +R I +IP ++   N P ++EVRGEV +
Sbjct: 114 DGLAVSILYRDGVYERAATRGDGTTGEDISENVRTILSIPLKLRGDNFPPLLEVRGEVIM 173

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG---KTSEI 249
            K  F ALND   A G K + NPRNAA+G LR+L+     +R L F+ + LG     +  
Sbjct: 174 PKKAFDALNDRARAKGEKLFVNPRNAAAGSLRQLDSKITASRALGFYAYALGVVEPETWA 233

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A   Y+ L ++R  GFPV+  V+Q      +V+YY ++ + R +L Y+IDG+V KVD  
Sbjct: 234 LADTHYDQLMQLRAWGFPVSAEVKQCGDVSSVVAYYTDIMTRRDSLDYEIDGVVIKVDSI 293

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q QLG  A++PRW  + KF  ++  T L  +D Q+GRTG +TPVARL+PV +GG  ++
Sbjct: 294 EHQGQLGFVAKAPRWATAFKFPAQEEVTLLEGVDFQVGRTGAVTPVARLKPVFVGGVTVS 353

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            ++VGD V+V+RAG+VIP++V I+ ++R  DA+   
Sbjct: 354 NATLHNADEIARL-----------GVKVGDTVIVRRAGDVIPQIVAIVADKRPDDAREIE 402

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP+C S V R      G+ VA  RCTGGL C AQ+ E +KHF SR A +I+G+G +
Sbjct: 403 FPDTCPVCNSMVER----VEGEAVA--RCTGGLFCEAQRKEAIKHFASRKALDIDGMGDK 456

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++     E     +  PAD+F L      + + I  +   G  S TNL  +I   +  +
Sbjct: 457 VVEQLIDKE----LVESPADLFKL------TASAITMLDRMGMKSATNLVAAIEVAKTTT 506

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF++ LGIR VG   A +LA Y+ +                 D  S I+V  VG I+A
Sbjct: 507 FSRFLYGLGIREVGEATAANLANYFKTLDKLKAA----------DAESFIKVDDVGTIVA 556

Query: 610 QAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           Q +  F+  P N+  V+ L++     P I    +  S  ++ +  V TGTL ++ R+ A+
Sbjct: 557 QHLTHFFAQPHNLEVVDKLIEAGVNWPEIEEVAEE-SLSLKGQTWVLTGTLTQLNRNDAK 615

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+ TD ++ G+  GSKL KAQ LGVK+++EE  L LL
Sbjct: 616 ARLQALGAKVAGSVSKNTDCLVAGEAAGSKLTKAQDLGVKVIDEEALLQLL 666


>gi|56416472|ref|YP_153546.1| DNA ligase [Anaplasma marginale str. St. Maries]
 gi|81359291|sp|Q5PBN8|DNLJ_ANAMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56387704|gb|AAV86291.1| DNA ligase [Anaplasma marginale str. St. Maries]
          Length = 673

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/713 (37%), Positives = 406/713 (56%), Gaps = 52/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +EQAR+ L+ L  ++ +HD  Y+    P + D +YD L +    +   FPD+++ +D   
Sbjct: 2   LEQARRRLAGLNAKLRHHDVLYHGLDAPEVTDHQYDLLVQEKKRLLDEFPDISQYDDY-- 59

Query: 74  PLNKIGGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
             + +G     S F KV H  P LSLE  + ++D+ KFITR+ RF + + D+ +  + E 
Sbjct: 60  -ADVVGTPKIDSRFPKVQHLEPMLSLENAFTVQDVEKFITRVRRFLELQPDDILELSCEL 118

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVY 192
           K+DG   +  Y  GK    A RG+GH GED++     +  +P  L  + PE++EVRGE+Y
Sbjct: 119 KMDGMSFSALYHGGKLTRVATRGNGHFGEDITTNAMVLRGLPHQLD-SAPEVLEVRGEIY 177

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFAK 252
           +   DF  L       G   +ANPRNAA+G +R+LN   I    N         +  FA 
Sbjct: 178 MHHEDFEKLR------GSCNFANPRNAAAGSIRQLN-QKIVEERNLSYVAYSAVNSTFAT 230

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
            Q E+L+++   GF  N  V   +     +++YN + + RS L YDIDG+VYKV+  + Q
Sbjct: 231 -QQEILKQLDEWGFHTNKQVLFTDKIEEAIAFYNSVYTTRSALGYDIDGVVYKVNSTNFQ 289

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           K LG   +SPRW I+HKF   +A T+LLDI +Q+GRTG++TP+A LEP+NIGG +++ A+
Sbjct: 290 KLLGATGKSPRWAIAHKFPSTEARTKLLDITVQVGRTGVVTPIAELEPINIGGVMVSRAS 349

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN + I+            +D+R+GD V+VKRAGEVIP+VVD+    R    Q F FPS
Sbjct: 350 LHNLNEIE-----------RKDVRIGDLVIVKRAGEVIPQVVDVDKTLRSSGTQKFVFPS 398

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C S++ R+     G++  A RC   L+C AQ LER+KHFVSRD  NI GLG +Q++
Sbjct: 399 HCPSCGSKLHRE----PGEV--ALRCVAELSCKAQALERVKHFVSRDGLNIMGLGAKQIE 452

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
           FF         I   ADIF+L+ +        E+  G+G+ SV NL  +I     + L  
Sbjct: 453 FFCNHG----LIGSIADIFSLEEKLHGINLDTEH--GWGEKSVANLIAAIRNSATVRLSN 506

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR +G   A+ +A++Y SY+N+ Q +  +   ++      +++  +G+    ++
Sbjct: 507 FIFALGIRFIGVGAAKLVAEHYRSYKNWHQAMLALTETHDT-----VQIRGLGEKSISSL 561

Query: 613 VEFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
             F+    N+  +E+L      L E SP+     +  SS I  K +VFTGTL+ + R +A
Sbjct: 562 KAFFSVQGNLEVLESLSAKLNILDEASPA-----QRGSSAISGKTVVFTGTLESMSRTEA 616

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +     LGA V+  +S  T +++ G NPGSK EKA  L V++++E+ ++ +++
Sbjct: 617 KLQAESLGAKVANSVSANTWLLVAGSNPGSKHEKALSLNVRVIDEQTWVKMVE 669


>gi|222474841|ref|YP_002563256.1| DNA ligase (ligA) [Anaplasma marginale str. Florida]
 gi|255003944|ref|ZP_05278745.1| DNA ligase (ligA) [Anaplasma marginale str. Virginia]
 gi|254781539|sp|B9KHN8|DNLJ_ANAMF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|222418977|gb|ACM49000.1| DNA ligase (ligA) [Anaplasma marginale str. Florida]
          Length = 673

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 263/713 (36%), Positives = 402/713 (56%), Gaps = 52/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +EQAR+ L+ L  ++ +HD  Y+    P + D +YD L +    +   FPD+ + +D   
Sbjct: 2   LEQARRRLAGLNAKLRHHDMLYHGLDAPEVTDHQYDLLVQEKKRLLDEFPDIRQYDDY-- 59

Query: 74  PLNKIGGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
             + +G     S F KV H  P LSLE  + ++D+ KFITR+ RF + + D+ +  + E 
Sbjct: 60  -ADVVGTPKIDSRFPKVQHLEPMLSLENAFTVQDVEKFITRVRRFLELQPDDILELSCEL 118

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVY 192
           K+DG   +  Y  GK    A RG+GH GED++     +  +P  L  + PE++EVRGE+Y
Sbjct: 119 KMDGMSFSALYHGGKLTRVATRGNGHFGEDITTNAMVLRGLPHQLD-SAPEVLEVRGEIY 177

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFVHGLGKTSEIFAK 252
           +   DF  L       G   +ANPRNAA+G +R+LN   I    N         +  FA 
Sbjct: 178 MHHEDFEKLR------GSCNFANPRNAAAGSIRQLN-QKIVEERNLSYVAYSAVNSTFAT 230

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
            Q E+L+++   GF  N  V   +     +++YN + + RS L YDIDG+VYKV+  + Q
Sbjct: 231 -QQEILKQLDEWGFHTNKQVLFTDKIEEAIAFYNSVYTTRSALGYDIDGVVYKVNSINFQ 289

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           K LG   +SPRW I+HKF   +A T+LLDI +Q+GRTG++TP+A LEP+NIGG +++ A+
Sbjct: 290 KLLGATGKSPRWAIAHKFPSTEARTKLLDITVQVGRTGVVTPIAELEPINIGGVMVSRAS 349

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN + I+            +D+R+GD V+VKRAGEVIP+VVD+    R    Q F FPS
Sbjct: 350 LHNLNEIE-----------RKDVRIGDLVIVKRAGEVIPQVVDVDKTLRSSGTQKFVFPS 398

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C S++ R+          A RC   L+C AQ LER+KHFVSRD  NI GLG +Q++
Sbjct: 399 HCPSCGSKLHREPGE------VALRCVAELSCKAQALERVKHFVSRDGLNIMGLGAKQIE 452

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
           FF         I   ADIF+L+ +        E+  G+G+ SV NL  +I     + L  
Sbjct: 453 FFCNHG----LIGSIADIFSLEEKLHGINLDTEH--GWGEKSVANLIAAIRNSATVRLSN 506

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR +G   A+ +A++Y SY+N+ Q +  +   ++      +++  +G+    ++
Sbjct: 507 FIFALGIRFIGVGAAKLIAEHYRSYKNWHQAMLALTETHDT-----VQIRGLGEKSISSL 561

Query: 613 VEFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
             F+    N+  +E+L      L E SP+     +  SS I  K +VFTGTL+ + R +A
Sbjct: 562 KAFFSVQGNLEVLESLSAKLNILDEASPA-----QRGSSAISGKTVVFTGTLESMSRTEA 616

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +     LGA V+  +S  T +++ G NPGSK EKA  L V++++E+ ++ +++
Sbjct: 617 KLQAESLGAKVANSVSANTWLLVAGSNPGSKHEKALSLNVRVIDEQTWVKMVE 669


>gi|269959115|ref|YP_003328904.1| NAD-dependent DNA ligase [Anaplasma centrale str. Israel]
 gi|269848946|gb|ACZ49590.1| NAD-dependent DNA ligase [Anaplasma centrale str. Israel]
          Length = 673

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 264/714 (36%), Positives = 406/714 (56%), Gaps = 54/714 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +EQAR+ L+ L  ++ +HD  Y+    P + D +YD L +    +   FPD+ + +D   
Sbjct: 2   LEQARRRLAGLNAKLRHHDVLYHGLDAPEVTDHQYDLLVQEKKRLLDEFPDIRQYDDY-- 59

Query: 74  PLNKIGGEMNLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
             + +G     S F KV H  P LSLE  + ++D+ KFITR+ RF + + D+ +  + E 
Sbjct: 60  -ADVVGTPKIDSRFPKVQHLEPMLSLENAFTVQDVEKFITRVRRFLELQPDDILELSCEL 118

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVY 192
           K+DG   +  Y  GK    A RG+GH GED++     +  +P  L  + PE++EVRGE+Y
Sbjct: 119 KMDGMSFSALYHGGKLTRVATRGNGHFGEDITTNAMVLRGLPHQLD-SAPEVLEVRGEIY 177

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKTSEIFA 251
           +   DF  L       G   +ANPRNAA+G +R+LN   +  R L++  +     +  FA
Sbjct: 178 MHHEDFEKLR------GSCNFANPRNAAAGSIRQLNQKIVEERNLSYVAYS--AVNSTFA 229

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
             Q E+L+++   GF  N  V   +     V++YN + + RS L YDIDG+VYKV+  + 
Sbjct: 230 T-QQEILKQLDEWGFHTNKQVLFTDKIEEAVAFYNSVYTTRSALGYDIDGVVYKVNSINF 288

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           QK LG   +SPRW I+HKF   +A T+LLDI +Q+GRTG++TP+A LEP+NIGG +++ A
Sbjct: 289 QKLLGATGKSPRWAIAHKFPSTEARTKLLDITVQVGRTGVVTPIAELEPINIGGVMVSRA 348

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           +LHN + I+            +D+R+GD V+VKRAGEVIP+VVD+    R    Q F FP
Sbjct: 349 SLHNLNEIE-----------RKDVRIGDLVIVKRAGEVIPQVVDVDKTLRSSGTQKFVFP 397

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           S CP C S++ R+          A RC   L+C AQ LER+KHFVSRD  NI GLG +Q+
Sbjct: 398 SHCPSCGSKLHREPGE------VALRCVAELSCKAQALERVKHFVSRDGLNIMGLGAKQI 451

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           +FF         I   ADIF+L+ +        E+  G+G+ SV NL  +I     + L 
Sbjct: 452 EFFSNHG----LINGIADIFSLEEKLHGINLGTEH--GWGEKSVANLIAAIRNSATVRLS 505

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
            FIF+LGIR +G   A+ +A++Y SY+N+ Q +  +   ++      +++  +G+    +
Sbjct: 506 NFIFALGIRFIGVGAAKLVAEHYRSYKNWHQAMLALTETHDT-----VQIRGLGEKSISS 560

Query: 612 IVEFYQNPRNICAVEAL------LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +  F+    N+  +E+L      L E SP+     +  SS I  K +VFTGTL+ + R +
Sbjct: 561 LKAFFSVQGNLEVLESLSAKLNILDEASPA-----QRGSSAISGKTVVFTGTLESMSRTE 615

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+     LGA V+  +S  T +++ G NPGSK EKA  L V++++E+ ++ +++
Sbjct: 616 AKLQAESLGAKVANSVSANTWLLVAGSNPGSKHEKALSLNVRVIDEQTWVKMVE 669


>gi|148263373|ref|YP_001230079.1| DNA ligase, NAD-dependent [Geobacter uraniireducens Rf4]
 gi|190359259|sp|A5GA98|DNLJ_GEOUR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146396873|gb|ABQ25506.1| DNA ligase, NAD-dependent [Geobacter uraniireducens Rf4]
          Length = 672

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/708 (37%), Positives = 396/708 (55%), Gaps = 48/708 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           + A + +  L +EI+ H+  YY   +P I D+EYD L R    +  A+PDL  ++ P   
Sbjct: 4   QAAERRIQELHKEINRHNYLYYVEDRPEINDAEYDLLLRELQQLEKAYPDLVTADSPT-- 61

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G        +VTH +P LSLE  +N E++  F  RI RF      + I +  EPK+
Sbjct: 62  -QRVGAAPLEKFSQVTHRMPMLSLENAFNEEEMHDFDERIKRFLGLAAGDEIEYVCEPKM 120

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP-EIIEVRGEVYI 193
           DG  + + YE G F   + RGDG+ GEDV+  +R + TIP  L++  P  + EVRGEVY+
Sbjct: 121 DGLAVELVYENGDFTVGSTRGDGYVGEDVTQNLRTVKTIPLSLAIATPPRLFEVRGEVYL 180

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFA 251
               F  LN E    G  P+ANPRNAA+G LR+L+ + IT  R L+ F +  G       
Sbjct: 181 GLAPFQKLNVEREEAGDPPFANPRNAAAGSLRQLD-SRITARRPLSIFCYAAGSLEGHEF 239

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
             Q ++L  +   G PVN  +R+ +   G+++YY+EM   R +LPY+IDG+V KVD F L
Sbjct: 240 TSQSDLLNTIPGWGLPVNPLIRKVSGIGGVLAYYHEMSEKRESLPYEIDGVVVKVDSFDL 299

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q++LGE+ RSPRW I+ KF  +QA T + +I  Q+GRTG++TPVA L PV + G +++ A
Sbjct: 300 QRELGEKTRSPRWAIAWKFPPRQAVTVVEEIVPQVGRTGVITPVAHLRPVEVSGVMVSRA 359

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN + ++            +DIR GD V+V+RAG+VIP VV +I  +R  D QP   P
Sbjct: 360 TLHNWEEME-----------KKDIRKGDTVVVERAGDVIPAVVKVITEKRKGDEQPLPIP 408

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           + CP C S VV+      G++  A RC  GL+C AQ  E + HF SR A +I+G+G + +
Sbjct: 409 ANCPECGSEVVK----IPGEV--AVRCL-GLSCPAQIRETIIHFASRHAMDIDGMGDKYI 461

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           +   K       ++  AD++ L++       ++      GD    NL  +I   +   L 
Sbjct: 462 EQLLK----LGLVKNVADLYYLKKDDFMRFERM------GDKLAENLLGAIETSKQRELS 511

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RFI++LGIRHVG   A+ LA  + S +N        + H +++ L  IR   VG  +AQ+
Sbjct: 512 RFIYALGIRHVGEHTAKLLANAFGSMEN--------LEHASEEELLSIRE--VGPQVAQS 561

Query: 612 IVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           I  F+ N  NI  ++ +    V PS+   EK V      K  VFTG L +  R  A+  V
Sbjct: 562 IRTFFHNRNNIEVIDRMFNAGVKPSV--EEKRVGGRFTGKTFVFTGALTRFTRDDAKRMV 619

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
              G   +  +S+KTD ++ G   GSKL+KA+QLGVK++ E++FL +L
Sbjct: 620 ENEGGHAAGSVSKKTDFVVAGAEAGSKLDKARQLGVKVLTEDEFLAML 667


>gi|227114832|ref|ZP_03828488.1| NAD-dependent DNA ligase LigA [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 684

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 260/719 (36%), Positives = 410/719 (57%), Gaps = 53/719 (7%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E   +  A   ++ L + + +H+  Y+    P I D EYD L +   A+    P+L  S+
Sbjct: 7   EPAEVNAAALRVAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEADHPELVTSD 66

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P     ++G     +  +V H +P LSL+ +++ E    F  RI    +  DD  + F 
Sbjct: 67  SPT---QRVGAAPLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRLKNGDD--LTFC 121

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVR 188
            E K+DG  +++ YE G  V AA RGDG +GE++++ IR +  IP R+   NIP  +EVR
Sbjct: 122 CELKLDGLAVSLLYENGVLVQAATRGDGTTGENITSNIRTVAAIPLRLEGDNIPRRVEVR 181

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--K 245
           GEV++  + F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +
Sbjct: 182 GEVFMKHSGFEKLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLE 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
             E+ A   +E L + +  G PV++ ++       ++ +Y +++  RS+L +DIDG+V K
Sbjct: 242 GGELPAS-HWERLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSSLGFDIDGVVVK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G
Sbjct: 301 VDSLELQERLGFVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHN D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    
Sbjct: 361 VIVSNATLHNADEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETV 409

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +P  FP+ CP+C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A ++EG
Sbjct: 410 RPIVFPAACPVCGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRALDVEG 463

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           +G + +D   + E     ++ PAD+F L     T   ++      G  S TNL +++ K 
Sbjct: 464 MGDKIIDQLVEKE----YVKTPADLFRLSAGIMTGLDRM------GPKSATNLVNALEKA 513

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           ++ +L RF+++LGIR VG   A +LA ++ S       +  + A + D   +L+ VP VG
Sbjct: 514 KSTTLARFLYALGIRDVGESTAANLAAHFGS-------LEALFAADED---ALLEVPDVG 563

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE------KNVSSEIENKKLVFTGTLQ 659
            ++A  +  F +   N   +  L      +I   E      + + S    K +V TG+L 
Sbjct: 564 KVVAAHVRHFLEEEHNQTVIRELTDPAGINIHWPEVQVVNAEEIDSPFAGKTVVLTGSLS 623

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            + R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 624 ILSRDEAKDRLTALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLL 682


>gi|290476106|ref|YP_003469005.1| DNA ligase [Xenorhabdus bovienii SS-2004]
 gi|289175438|emb|CBJ82241.1| DNA ligase [Xenorhabdus bovienii SS-2004]
          Length = 672

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 253/715 (35%), Positives = 410/715 (57%), Gaps = 51/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L R    +    P+L  ++ P  
Sbjct: 1   MESIIEKINKLRATLRHHEYLYHVMDAPEIPDAEYDRLLRELKVLEEQHPELITADSPT- 59

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
              ++G     +  +V H IP LSL+ +++ E    F  R+    + KD   + F  E K
Sbjct: 60  --QRVGAAPLTAFGQVRHEIPMLSLDNVFDEESYLAFDKRVRD--RLKDSRDLVFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++  +R I  IP R+   NIP  +E+RGEV+
Sbjct: 116 LDGLAVSLLYEDGELVQAATRGDGTTGENITVNVRTIHAIPLRLKGNNIPARVEIRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  LNDE    G K +ANPRNAA+G LR+L+P     R L F+ +G+G  +  E+
Sbjct: 176 MKQGGFEKLNDEARRKGNKVFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGVLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A   YE L + +  G PV++ V+       ++ +Y+ ++  R  L +DIDG+V KVD  
Sbjct: 236 PAS-HYERLMQFKQWGLPVSDNVKLCQGTQQVIDFYHNIEQQRPILGFDIDGIVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ+ LG  A++PRW  + KFA ++  T + D++ Q+GRTG +TPVARL+PV + G +++
Sbjct: 295 ELQETLGFVAKAPRWATAFKFAAQEQMTIVRDVEFQVGRTGAITPVARLKPVQVAGVIVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +R+GD V+++RAG+VIPKVV ++ ++R  ++Q   
Sbjct: 355 NATLHNADEIERL-----------GLRIGDTVVIRRAGDVIPKVVGVVQDKRPAESQEVI 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP +CP+C+S    D+    G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G+G++
Sbjct: 404 FPEYCPVCRS----DIERVEGESVA--RCTGGLFCGAQRKEALKHFVSRRAMDVDGMGEK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++     E     ++ PAD+F L      S  K+  +   G  S  N  D++ K +  +
Sbjct: 458 IIEQLVDKE----YVKTPADLFRL------SAGKLTGLERMGPKSAQNTIDALEKSKKTT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RFI+SLGIR VG   A +L  ++++ +               D  +LI V  VG ++A
Sbjct: 508 FARFIYSLGIREVGEATAANLVAHFVTLEKL----------RAADTEALIAVQDVGGVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEVS---PSIGRHEKN-VSSEIENKKLVFTGTLQKIQRHK 665
             +V F+  P N   ++ L+  +     S+   + + V +    K +V TG+L ++ R +
Sbjct: 558 SHVVNFFNEPHNQTVIDDLIDNIGIYWESVETLQSDTVGNSFAGKTVVLTGSLNRLSRDE 617

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A++ +T LGA V+  +S+KTD++I G+  GSKL KA +LG+++++EE+ L LL +
Sbjct: 618 AKDKLTALGAKVTGSVSKKTDLVIAGEAAGSKLAKATELGIEVIDEEEMLRLLGE 672


>gi|242238286|ref|YP_002986467.1| NAD-dependent DNA ligase LigA [Dickeya dadantii Ech703]
 gi|242130343|gb|ACS84645.1| DNA ligase, NAD-dependent [Dickeya dadantii Ech703]
          Length = 684

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 262/732 (35%), Positives = 418/732 (57%), Gaps = 60/732 (8%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M +++ +P+   S   A  ++ +L  ++ YH+  Y+    P I D+EYD L      +  
Sbjct: 1   MSEKKPMPMNDTS--AAAVQIDALRAQLRYHEYKYHVEDAPEIPDAEYDKLMNALKLLEQ 58

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           A P+   S+ P     ++G         V H +P LSL+ +++ E  + F+ RI    + 
Sbjct: 59  AHPEWVTSDSPT---QRVGATPLAGFDNVQHEVPMLSLDNVFDAESFQAFVKRIGD--RL 113

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSL 179
           K D ++ F  E K+DG  +++ YE G  V AA RGDG +GE++++ IR I  IP R+   
Sbjct: 114 KSDEALRFCCELKLDGLAVSLLYEDGVLVRAATRGDGSTGENITSNIRTIGAIPLRLRGD 173

Query: 180 NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNF 238
           NIP  +EVRGEV++    F ALN+E    G K +ANPRNAA+G LR+L+P     R L F
Sbjct: 174 NIPRRLEVRGEVFMKHKGFEALNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTF 233

Query: 239 FVHGLG-KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
           F +G+G           ++ L + R  G PV++ +R       ++++Y  ++++R TL +
Sbjct: 234 FCYGVGLMEGGSLPDSHWQRLMQFREWGLPVSDRIRLCTGGDEVLAFYQHVEAVRDTLGF 293

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+V KVD+ +LQ++LG  AR+PRW ++ KF  ++  T L D++ Q+GRTG +TPVAR
Sbjct: 294 DIDGVVIKVDDLALQERLGFVARAPRWAVAFKFPAQEQLTWLRDVEFQVGRTGAITPVAR 353

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           LEPV + G +++NATLHN D I  L            I++GDRV V+RAG+VIP++V ++
Sbjct: 354 LEPVAVAGVIVSNATLHNADEIDRL-----------GIQIGDRVAVRRAGDVIPQIVSVV 402

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           + +R  DA+P  FP+ CP+C S V R      G++V   RCTGGL C+AQ+ E LKHFVS
Sbjct: 403 LPDRPADARPVVFPTQCPVCGSDVER----VDGEVVT--RCTGGLFCAAQRKEALKHFVS 456

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R A ++EG+G + +D   + E     ++ PA++F   R      T++E +   G  S  N
Sbjct: 457 RRALDVEGMGDKIIDQLVEKE----YVKTPAELF---RLDIGILTRLERM---GPKSAQN 506

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           L ++++K ++ +  RF+++LGIR VG   A  LA ++            + A    D  +
Sbjct: 507 LVNALDKAKSTTFARFLYALGIRDVGEATAAGLAAHF----------GTLDALMTADVDT 556

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKN--------VSSEIE 648
           L +VP VG ++A  +  F     N    + +++E + P +G    +        + +   
Sbjct: 557 LQQVPDVGIVVATHVRHFLDEEHN----QQIIRELIGPEVGLRWPDPVVVDAGALDNPFA 612

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +V TG+L  + R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ LG+ +
Sbjct: 613 GKTVVLTGSLSLLSRDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQALGIDV 672

Query: 709 MNEEQFLFLLQQ 720
           ++E + + LL Q
Sbjct: 673 IDEVEMMRLLGQ 684


>gi|332184463|gb|AEE26717.1| DNA ligase [Francisella cf. novicida 3523]
          Length = 678

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 270/728 (37%), Positives = 410/728 (56%), Gaps = 65/728 (8%)

Query: 6   LIPIEALSIEQ---ARKELSS----LEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAI 58
           + P E  SI+    A+ EL +    L   +S     Y+   KPII DS+YD L R    +
Sbjct: 1   MTPNEFFSIKYHILAKPELKAYIDKLADYLSQQSYLYHTLDKPIISDSDYDKLFRLLQDL 60

Query: 59  AHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFW 118
               P    +   N  L+++GGE+      + H     SL  ++ IE+LR F  +I    
Sbjct: 61  VDDNPQFKPT---NSVLDRVGGEVLAGFETIKHKKKMTSLVNVFTIEELRDFYDKI---- 113

Query: 119 QKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL- 177
               +  I    EPK+DG  I+I Y+ GKF YA  RGDG  GE VS  ++ I  +P  L 
Sbjct: 114 ----EYEIELECEPKMDGLAISIFYKNGKFDYAVTRGDGIQGEKVSENVKTIRNVPLKLN 169

Query: 178 SLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYL 236
           ++N PE +EVRGE+ + K  FL+LN+ M     K +ANPRNAA+G +R L+   +  R L
Sbjct: 170 TINPPEELEVRGEIILDKQSFLSLNEYMQTHENKTFANPRNAAAGSIRMLDSKVVAKRPL 229

Query: 237 NFFVHGLGKTSEIFA--KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
             F +G+G  S+ F   + Q+E++Q +R  GF +++ +  A +F  +  Y+ +M   R+ 
Sbjct: 230 KLFSYGIGYFSKDFVHPETQFELMQLLRSFGFTISDNMFLAKSFSEVEEYHRKMSHQRAD 289

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           L YDIDGLV+KV+   LQ  +G  AR P+W +++KF  ++  + +L+++ Q+GRTG +TP
Sbjct: 290 LAYDIDGLVFKVNNIKLQDTIGYTARGPKWAVAYKFPAEEVESEVLNVEFQVGRTGAITP 349

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARL+PV +GG +++NATLHN + IK            +DIRV DRV+V+RAG+VIP+VV
Sbjct: 350 VARLKPVAVGGVMVSNATLHNINEIK-----------RKDIRVSDRVIVRRAGDVIPEVV 398

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
             +   R PDAQ    P  CP+C S  + ++N +     A +RCTGG  C AQ  ERLKH
Sbjct: 399 KSLPQYRKPDAQIVEMPKNCPVCDS-TIENINDQ-----AIYRCTGGWHCQAQTTERLKH 452

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
           FVSR A +I+ LG + ++    ++     I+ PADI+ L   Q T   ++      G  S
Sbjct: 453 FVSRKAMDIDKLGAKLIEQLVAAD----LIKYPADIYKLNFEQLTGLKRM------GAKS 502

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             N+ DSI K +  SL RFIF++GI+ +G   + +LA ++ S ++F +            
Sbjct: 503 SQNVLDSITKSKEPSLARFIFAIGIKDIGEVSSEALANHFGSLESFREA----------K 552

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEV----SPSIGRHEKNVSSEIENK 650
           +  LI +  +G+I+A  IV F+Q+  NI  V+ LL       +P   + E+  +    NK
Sbjct: 553 FEQLIEINDIGEIMANNIVSFWQDSLNIQIVDELLANAINIQNPE--KIEQAHNESFTNK 610

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +V TGT +   R +  + +  +GA V++ +S+KTD++I GDN GSKL KAQ+LGV ++ 
Sbjct: 611 TVVITGTFENYNRTELTQLLKSMGAKVTSSVSKKTDMVICGDNAGSKLTKAQELGVTVIL 670

Query: 711 EEQFLFLL 718
           E+    LL
Sbjct: 671 EQDLQNLL 678


>gi|308271402|emb|CBX28010.1| DNA ligase [uncultured Desulfobacterium sp.]
          Length = 674

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 260/708 (36%), Positives = 411/708 (58%), Gaps = 52/708 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           K++ +L+ E+  H+  YY    P I D++YD + +    +   +P L+    P+ P  K+
Sbjct: 11  KKVENLKSELQKHNYHYYVMDDPQISDTQYDKMMQELIELEAKYPMLST---PDSPSMKV 67

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G E      ++ HS+  LSL+  ++  D+  F  R+        D  I +T EPK+DG  
Sbjct: 68  GAEPVKKFEQIRHSVKMLSLDNAFSDSDILNFDRRVKEGLMA--DEQILYTAEPKMDGVA 125

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-----IPEIIEVRGEVYI 193
           + + Y+ G+ V A+ RGDG +GED+++ ++ I ++P +L  N     IP  +E RGEV I
Sbjct: 126 VELVYKDGRLVSASTRGDGETGEDITSNVKTIRSVPLLLQQNKKEHIIPARLEARGEVII 185

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAK 252
           SK  F  LN++M++ G   +ANPRNAA+G LR+L+      R L  + +G+G+   I  K
Sbjct: 186 SKEGFKRLNEDMLSQGLALFANPRNAAAGSLRQLDSKVTAKRPLEIYFYGVGEVEGISCK 245

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             ++ L  ++ LG  +N  ++     + +  YY E++ +RS LPYDIDG+V KVD    Q
Sbjct: 246 SHWDWLYALKELGLRINPYIKPKININAVCKYYKELEQMRSGLPYDIDGMVVKVDSVQYQ 305

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           +QLG +ARSPRW +++KF   Q +T++LDI +Q+GRTG +TPVA LE VNIGG  ++ AT
Sbjct: 306 EQLGTKARSPRWAVAYKFKAIQETTKVLDILVQVGRTGAVTPVACLETVNIGGVNVSRAT 365

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHNED I+            +DIR+GD VLV+RAG+VIP++V +I + R+     F  P 
Sbjct: 366 LHNEDEIR-----------NKDIRIGDTVLVQRAGDVIPEIVKVIDSARNGSEIIFCMPQ 414

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C S+++RD   +   L+   RC    +C A+   +++HFVS+ AF+I+GLG++ ++
Sbjct: 415 NCPSCNSQLIRD---EKESLI---RCVNN-SCPAKTKAQIEHFVSKRAFDIDGLGEKLIN 467

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
             F   D  + +   ADIF L +       K+E +   G  S  NL+++I K +NI+  R
Sbjct: 468 QLF---DKKY-LSSYADIFYLDK------IKMEGLERMGLKSAGNLFEAIEKSKNINFAR 517

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FI++LGIRHVG  IA  LA  Y  Y+ F        +   DD   L  +  VG I+AQ+I
Sbjct: 518 FIYALGIRHVGEHIAEILASKYEKYEKFC-------SATYDD---LKNIKGVGPIVAQSI 567

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKN-VSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           ++F     N+  +E +L   S  I R+ +N  S+ ++ K  V TGTL+ + R++A   + 
Sbjct: 568 IDFLGREDNLNNIERMLN--SGVIIRYGENRKSTTLDGKIFVLTGTLESMTRNEAIIKIK 625

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             G  +S  +S+KTD ++ G +PGSK+EKA+  GV+I++E +   + +
Sbjct: 626 SFGGKISESVSKKTDYLVAGKSPGSKIEKAKAAGVEIIDENKLKIMFE 673


>gi|152971289|ref|YP_001336398.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166215815|sp|A6TC47|DNLJ_KLEP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150956138|gb|ABR78168.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 671

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 254/715 (35%), Positives = 412/715 (57%), Gaps = 52/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    + K  + + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD--RLKSTDHLTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP ++   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A     +LQ  +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  
Sbjct: 236 PASHSARLLQ-FKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++
Sbjct: 295 ALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   
Sbjct: 355 NATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+CQS V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPTHCPVCQSDVER----VEGEAVA--RCTGGLICGAQRKESLKHFVSRRALDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  N+ +++ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNVVNALEKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHFGTLEALEQA----------SIEELQKVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKE----VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
                F+    N   +  LL E     +P + + E+ + S    K +V TG+L ++ R  
Sbjct: 558 THTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEE-IDSPFAGKTVVLTGSLSQLSRDD 616

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+  +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 617 AKARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|329912476|ref|ZP_08275756.1| DNA ligase [Oxalobacteraceae bacterium IMCC9480]
 gi|327545605|gb|EGF30768.1| DNA ligase [Oxalobacteraceae bacterium IMCC9480]
          Length = 679

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 269/697 (38%), Positives = 398/697 (57%), Gaps = 53/697 (7%)

Query: 31  HDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVT 90
           H   YY    P+I D++YD L R  +A+  + P+L  ++ P     ++G        +V 
Sbjct: 23  HAHAYYVLDNPVIPDADYDLLFRELEALEASHPELVTADSPT---RRVGAPPLPEFVQVR 79

Query: 91  HSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVY 150
           HS+P LSL   +  ED+  F  R+    Q   +  + +  E K DG  I +RYE G  V 
Sbjct: 80  HSVPMLSLSNGFADEDVIGFDRRVRDGLQIAGE--VAYATELKYDGLAINLRYENGVLVE 137

Query: 151 AALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVG 209
           AA RGDG +GE+V+  IR I  IP R+ +   P II+VRGEV + K DF +LN    A G
Sbjct: 138 AATRGDGSTGENVTVNIRTIRGIPLRLHTDTPPAIIDVRGEVLLYKADFASLNARQRAAG 197

Query: 210 RKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIFAKGQYE-MLQKMRCLGF 266
            K +ANPRNAA+G LR+L+ + IT  R L FF +G+G    +     +  +L   R LG 
Sbjct: 198 LKEFANPRNAAAGSLRQLD-SRITAQRALRFFAYGIGTLEGVAMPDSHSGLLDWYRALGI 256

Query: 267 PVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMI 326
           PV +  +  +   G++ +Y E+ + R++LPY+IDG+VYKVD+   Q+QLG  AR+PR+ +
Sbjct: 257 PVCDERKVVHGAAGLLDFYREIGAKRASLPYEIDGVVYKVDDAVQQQQLGFVARAPRYAL 316

Query: 327 SHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASG 386
           +HKF  ++AST +  ID+Q+GRTG +TPVARL PV +GG ++TNATLHNED ++      
Sbjct: 317 AHKFPAEEASTVVQGIDVQVGRTGAITPVARLAPVAVGGVIVTNATLHNEDEVR------ 370

Query: 387 KVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLN 446
                 +DIR+GD V+V+RAG+VIP+VV  I + R PD Q F  PS CP+C S +VR  +
Sbjct: 371 -----RKDIRIGDTVIVRRAGDVIPEVVAFIADLRGPDVQEFVMPSACPVCGSAIVRLED 425

Query: 447 PKTGKLVAAHRCTGG-LACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIR 505
                  A  RC+GG + C+AQ+   L HFVSR A +IEGLG+Q +      E     IR
Sbjct: 426 E------AIARCSGGWIKCAAQRKGGLLHFVSRRAMDIEGLGEQLVVQLVDRE----VIR 475

Query: 506 IPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE 565
            PAD++ L          +  +    D S  N+  ++ K ++ +L RFI++LGIRHVG  
Sbjct: 476 TPADLYKL------GLVGLSELARMADKSARNVLAALEKSKSTTLARFIYALGIRHVGEA 529

Query: 566 IARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAV 625
            A+ LA ++        +++ ++A   +    L+ V  VG ++A +I+EF+ +P N+  V
Sbjct: 530 TAKELAAHF-------GQLDIVLAATEE---QLLEVADVGPVVACSILEFFADPLNVELV 579

Query: 626 EALLK---EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILS 682
           E L       +   GR  + VS     K  V TGTL  + R +A   +   G  V+  +S
Sbjct: 580 EQLRAAGVHWTEHAGR--QVVSLPQSGKTFVLTGTLPTLGRDEAAALIEAAGGKVAGSVS 637

Query: 683 RKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +KT  ++ G + GSKL KAQ+LG+ I++E   L LL+
Sbjct: 638 KKTSYVVAGSDAGSKLAKAQELGLAILDEAGLLQLLK 674


>gi|253689765|ref|YP_003018955.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756343|gb|ACT14419.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 681

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 261/711 (36%), Positives = 406/711 (57%), Gaps = 55/711 (7%)

Query: 21  LSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG 80
           ++ L + + +H+  Y+    P I D EYD L +   A+    P+L  S+ P     ++G 
Sbjct: 15  VAELRRVLRHHEYKYHVEDAPEIPDVEYDKLMQELKALEADHPELVTSDSPT---QRVGA 71

Query: 81  EMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMIT 140
               +  +V H +P LSL+ +++ E    F  RI    +  DD  + F  E K+DG  ++
Sbjct: 72  APLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRLKNGDD--LTFCCELKLDGLAVS 129

Query: 141 IRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFL 199
           + YE G  V AA RGDG +GE++++ IR +  IP R+   NIP  +EVRGEV++  + F 
Sbjct: 130 LLYEDGVLVQAATRGDGTTGENITSNIRTVAAIPLRLEGENIPRRVEVRGEVFMKHSGFE 189

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKGQYE 256
            LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+ A   +E
Sbjct: 190 KLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPAS-HWE 248

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L + +  G PV++ ++       ++ +Y  ++  RS+L +DIDG+V KVD   LQ++LG
Sbjct: 249 RLMQFKAWGLPVSDKIKLCTGPAEVLDFYRHVEQTRSSLGFDIDGVVVKVDSLELQERLG 308

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATLHN 
Sbjct: 309 FVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGVIVSNATLHNA 368

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    QP  FPS CP+
Sbjct: 369 DEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVQPIVFPSACPV 417

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A ++EG+G + +D   +
Sbjct: 418 CGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRALDVEGMGDKIIDQLVE 471

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
            E     ++ PAD+F L     T   ++      G  S TNL +++ K ++ +L RF+++
Sbjct: 472 KE----YVKTPADLFRLSAGIMTGLDRM------GPKSATNLVNALEKAKSTTLARFLYA 521

Query: 557 LGIRHVGAEIARSLAKYYLSYQN-FAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           LGIR VG   A +LA ++ S +  FA            D  +L+ VP VG ++A  +  F
Sbjct: 522 LGIRDVGESTAANLAAHFGSLEALFAA-----------DEETLLAVPDVGKVVAAHVRHF 570

Query: 616 YQNPRNICAVEALLKEVSPSIGRHE------KNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
            +   N   +  L      +I   E      + + S    K +V TG+L  + R +A++ 
Sbjct: 571 LEEEHNQTVIRELTDPAGINIHWPEVVVVKAEEIDSPFAGKTVVLTGSLTILSRDEAKDR 630

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 631 LTALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLLGE 681


>gi|56460801|ref|YP_156082.1| NAD-dependent DNA ligase [Idiomarina loihiensis L2TR]
 gi|81362279|sp|Q5QUK1|DNLJ_IDILO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56179811|gb|AAV82533.1| NAD-dependent DNA ligase [Idiomarina loihiensis L2TR]
          Length = 670

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 261/706 (36%), Positives = 403/706 (57%), Gaps = 50/706 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           + +  LEQ ++ ++  YY+  +P + D+EYD L R    +    PDL  ++ P     K+
Sbjct: 7   QRMQELEQLLNRYNQEYYENDEPSVPDAEYDRLFRELKTLETEHPDLKSAQSPT---MKV 63

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN-SIFFTLEPKIDGT 137
           GG+       V H +P LSL+  +++++   F  R+    Q+ D N ++ F  EPK+DG 
Sbjct: 64  GGKPLGQFRSVEHEVPMLSLDNAFSVDEFEAFSKRVE---QRLDTNQTVTFCCEPKLDGA 120

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKND 197
            +++ YE G  V  A RGDG SGED++  ++ I  +P  LS ++PE +EVRGEV +    
Sbjct: 121 AVSLLYENGLLVRGATRGDGQSGEDITENVKTIRNVPLKLSGDVPERLEVRGEVVMPLGA 180

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEI--FAKG 253
           F   N++      K +ANPRNAA+G LR+L+ + IT  R L+F+ + LG  SE       
Sbjct: 181 FERFNEQARQREEKVFANPRNAAAGSLRQLD-SRITAKRPLHFYAYSLGLISETTQLPDS 239

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            ++ L +++  G PVN  ++  ++  G   YY  + + R TL YDIDG+V+KVD   LQ+
Sbjct: 240 HHQRLLQLKDWGLPVNIEIKTVDSVQGCDDYYEAILARRDTLNYDIDGVVFKVDSIRLQQ 299

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
            LG  AR+PRW I+ KF  ++  T +  +D Q+GRTG +TPVARLEPVN+GG  ++NATL
Sbjct: 300 DLGFVARAPRWAIARKFPAQEQLTTITGVDFQVGRTGAITPVARLEPVNVGGVTVSNATL 359

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I+ L            +R+GD V ++RAG+VIP+VV +I ++R  + +   FP  
Sbjct: 360 HNADEIERL-----------GVRIGDCVSIRRAGDVIPQVVSVIKDKRPENTKAIEFPQH 408

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPICQS    D+    G+ VA  RCTGGL C+AQ+ E +KHF SR A +I+GLG + ++ 
Sbjct: 409 CPICQS----DIERVEGEAVA--RCTGGLYCAAQRKEAIKHFASRKAMDIDGLGDKIVEQ 462

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + +     I+ PAD++ L      S  ++  +   G  S  NL ++I   +  +L RF
Sbjct: 463 LVERD----WIKSPADLYRL------SKAELATLPRMGAKSAENLRNAIKATQETTLARF 512

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           I++LGIR VG   A +LA ++       + ++ +IA  ++    L  VP VG ++A+ IV
Sbjct: 513 IYALGIREVGEATANALANHF-------KNLDALIAAESE---QLQEVPDVGAVVAKHIV 562

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE-IENKKLVFTGTLQKIQRHKAQEYVTQ 672
            F+    N   V  L + +S   G    +V S+ +     V TGTL  + R +A+  +  
Sbjct: 563 AFFHEAHNQQVVAELREFISWPEGEEASSVQSDRLSGNTYVITGTLSTMTRDEAKSALEA 622

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           LGA V++ +S+KT  ++ G+N GSKL KAQ LG+ I++E     LL
Sbjct: 623 LGAKVASSVSKKTTALVAGENAGSKLTKAQSLGLDILDENALAELL 668


>gi|319779225|ref|YP_004130138.1| DNA ligase [Taylorella equigenitalis MCE9]
 gi|317109249|gb|ADU91995.1| DNA ligase [Taylorella equigenitalis MCE9]
          Length = 681

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 273/718 (38%), Positives = 412/718 (57%), Gaps = 68/718 (9%)

Query: 23  SLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM 82
           +L+  IS HD  YY    P I D EYD L R+      A P+   S+ P+    ++GG +
Sbjct: 11  ALKSLISVHDKAYYIDDNPQISDEEYDGLMRKLLDYEQAHPEWVTSDSPS---QRVGG-V 66

Query: 83  NLSLF-KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITI 141
            L +F  V H++P LSL  ++N E+L  F  R+       D     F  EPK DG  I+I
Sbjct: 67  ALKIFNSVRHAVPMLSLGNVFNPEELTAFYNRMVEAVGSDD---FEFNCEPKFDGLAISI 123

Query: 142 RYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP------EIIEVRGEVYISK 195
           RYE G    A+ RGDG +GEDV+A +  I T+P  L LN+P      +IIEVRGE  + +
Sbjct: 124 RYENGVLKTASTRGDGLTGEDVTAQVSTIRTVP--LKLNVPSKEALPKIIEVRGEALMLR 181

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA--- 251
           +DF  L       G + +ANPRNAA+G LR+L+P     R L F+ +GLG+   + +   
Sbjct: 182 SDFDNLVKRQEEEGLQTFANPRNAAAGSLRQLDPKITAKRKLRFYAYGLGEFKSLGSEEP 241

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
           K Q ++L  +  LGF V           G+++++  +K+ R TLP+DIDG+VYKVD F L
Sbjct: 242 KSQSQLLDYLSELGFAVTEYRSVKKGLDGLLNFFEHIKAKRDTLPFDIDGVVYKVDSFEL 301

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q+++G  +++PR+ I+HKFA +Q  T+LLDI++Q+GRTG LTPVARLEPV +GG  +  A
Sbjct: 302 QQKIGFVSKAPRFAIAHKFAAEQMQTKLLDIEVQVGRTGALTPVARLEPVFVGGVTVRKA 361

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHNED I+            +++ +GD V+V+RAG+VIP+V++ +++ R  DA  F  P
Sbjct: 362 TLHNEDEIE-----------RKNLMIGDTVIVRRAGDVIPEVLESVIDLRPEDAVKFVMP 410

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           + CP+C S V +      G+ VA  RCTGGL C AQ  + + H VSR A NIEGLG + +
Sbjct: 411 TICPVCGSAVEK----PEGEAVA--RCTGGLVCGAQITQGIIHAVSRKALNIEGLGDKHI 464

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFG------DVSVTNLYDSINKR 545
                +E     I+   D+F L       T    NILG        +V    L+  I   
Sbjct: 465 QKLVSTE----KIKRLDDLFKL-------TVDDLNILGRNAEDSKLEVLAPTLHARIQAS 513

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           ++ +L RF+F+LGIRHVG   AR LAKY+        ++ +I+  + ++   L+ VP VG
Sbjct: 514 KSTTLSRFLFALGIRHVGETTARDLAKYF-------GDLYSIMQASTEE---LVSVPNVG 563

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEK--NVSSEIENKKLVFTGTLQKIQR 663
           +++A +I  F+  P N   +  LL E+   +   E+   ++  I     V TGTL+  +R
Sbjct: 564 EVMATSIHTFFNEPHNREVISNLL-ELGFVLNAEEEAIQINPAIAGHSFVVTGTLENWKR 622

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  + +   G  +++ +S+KTD +++G  PG SK++KAQ++G KI++E +F+ +L+Q
Sbjct: 623 DEISQVIISSGGRINSSVSKKTDYLLMGAEPGDSKVKKAQEVGTKILSEAEFIQMLEQ 680


>gi|167570377|ref|ZP_02363251.1| DNA ligase, NAD-dependent [Burkholderia oklahomensis C6786]
          Length = 691

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 264/729 (36%), Positives = 404/729 (55%), Gaps = 59/729 (8%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  +  Q  K  + L  E+   +  YY   +P + D+EYD L      +    PDL  
Sbjct: 5   PVEPPA-SQPAKRAAWLRAELERANYAYYVLDQPELPDAEYDRLFVELQQVEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P  P  ++GGE+      V H  P LSL   ++ ED+  F  R+     K  D    
Sbjct: 63  --TPESPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDEDVVAFDKRVADGLDKATDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLN 180
             + + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + ++P ++   +
Sbjct: 121 VTDPVEYACELKFDGLAISLRYEDGRFVQASTRGDGTTGEDVTRNIRTVRSVPLKLKGKH 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P +++VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRVLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTSEI-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G    +        +L     LG PVN          G++ +++ +   R +LPYD
Sbjct: 241 AYGIGVLDGVDMPDTHGGLLDWYETLGLPVNRERAVVRGAAGLLDFFHAVGERRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVR-----------RKDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SR+ R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTACPECGSRIERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS++K ++ +L RFI++LGIRHVG   A+ LAK++ S           +   ND     
Sbjct: 514 IDSLDKAKHTTLSRFIYALGIRHVGESTAKDLAKHFGSLDPIMDASIEALLEVND----- 568

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLK------EVSPSIGRHEKNVSSEIENKKL 652
                VG I+A++I +F+    N   +E L           P   R  + V   +  K +
Sbjct: 569 -----VGPIVAESIHQFFAEEHNRTVIEQLRAPGRVTWPEGPPAPRAPQGV---LAGKTV 620

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++EE
Sbjct: 621 VLTGTLPTLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEE 680

Query: 713 QFLFLLQQY 721
               LL+ +
Sbjct: 681 GMHKLLEGH 689


>gi|52425821|ref|YP_088958.1| NAD-dependent DNA ligase LigA [Mannheimia succiniciproducens
           MBEL55E]
 gi|81386743|sp|Q65RN7|DNLJ_MANSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|52307873|gb|AAU38373.1| Lig protein [Mannheimia succiniciproducens MBEL55E]
          Length = 675

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 265/725 (36%), Positives = 410/725 (56%), Gaps = 67/725 (9%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++I    +++  L   + YH+  Y+    P I D+EYD L  +  A+    P+L  ++ P
Sbjct: 1   MTIMDINQQIKQLRDTLRYHEYQYHVLDDPKIPDAEYDRLFHQLKALEQQHPELITADSP 60

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD-----DNSI 126
                ++G +      ++TH +P LSL+  ++ E+   F+ RI      +D        +
Sbjct: 61  T---QRVGAKPLAGFAQITHELPMLSLDNAFSDEEFNAFVKRI------QDRLIVLPQPL 111

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEII 185
            F  EPK+DG  ++I Y  G    AA RGDG +GED++  IR I  IP ++L+ N P  +
Sbjct: 112 TFCCEPKLDGLAVSIFYVNGVLTQAATRGDGTTGEDITLNIRTIRNIPLQLLTDNPPARL 171

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITR---YLNFFVHG 242
           EVRGEV++    F  LN+  +  G K +ANPRNAA+G LR+L+P   +R     N +  G
Sbjct: 172 EVRGEVFMPHEGFNRLNERALEHGEKTFANPRNAAAGSLRQLDPKITSRRPLVFNAYSVG 231

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
           + +  E+ A   YE LQ ++ +G PVN+ V+  +    ++ +Y  M+  R TL YDIDG 
Sbjct: 232 IAEGVELPAT-HYERLQWLKSVGIPVNSEVQLCDGSEKVLEFYRSMQQKRPTLGYDIDGT 290

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           V K+++  LQ++LG  +++PRW I++KF  ++  TRL D++ Q+GRTG +TPVA+L PV 
Sbjct: 291 VLKINDIGLQRELGFISKAPRWAIAYKFPAQEELTRLNDVEFQVGRTGAITPVAKLAPVF 350

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           + G  ++NATLHN D I  L           DI +GD V+++RAG+VIP+++ ++   R 
Sbjct: 351 VAGVTVSNATLHNGDEIARL-----------DIAIGDTVVIRRAGDVIPQIIGVLHERRP 399

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
            +AQ   FP+ CP+C S++VR      G+ VA  RCTGGL C AQ+ E LKHFVSR A +
Sbjct: 400 ANAQAIVFPTQCPVCGSKIVR----IEGEAVA--RCTGGLFCDAQRKEALKHFVSRRAMD 453

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           I+G+G + ++     E     IR PAD+F L      +  ++E +   G+ S  N  DS+
Sbjct: 454 IDGVGAKLIEQLVDKE----LIRTPADLFKLDL---ITLMRLERM---GEKSAQNALDSL 503

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
            K +N +L RFIF+LGIR VG   A +LA ++           N+ A        L  V 
Sbjct: 504 EKAKNTTLARFIFALGIREVGEATALNLANHF----------KNLDALQAASPEQLQEVA 553

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSE------IENKKLVFTG 656
            VG+++A  I  F++   NI AV  L+ +     G H + V ++       + K +V TG
Sbjct: 554 DVGEVVANRIYVFWREQHNIDAVNDLIAQ-----GIHWETVETKEAGENPFKGKTVVLTG 608

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           TL ++ R++ ++ + QLGA  +  +S KT  +I GDN GSKL KAQ+LGV +M+E +FL 
Sbjct: 609 TLTQMGRNETKDLLQQLGAKAAGSVSAKTHFVIAGDNAGSKLTKAQELGVAVMSEAEFLA 668

Query: 717 LLQQY 721
           ++  Y
Sbjct: 669 IVNAY 673


>gi|50122504|ref|YP_051671.1| NAD-dependent DNA ligase LigA [Pectobacterium atrosepticum
           SCRI1043]
 gi|81644069|sp|Q6D165|DNLJ_ERWCT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49613030|emb|CAG76481.1| DNA ligase [Pectobacterium atrosepticum SCRI1043]
          Length = 681

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 259/712 (36%), Positives = 408/712 (57%), Gaps = 53/712 (7%)

Query: 21  LSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG 80
           ++ L + + +H+  Y+    P I D EYD L +   A+    P+L  S+ P     ++G 
Sbjct: 8   VAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEADHPELVTSDSPT---QRVGA 64

Query: 81  EMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMIT 140
               +  +V H +P LSL+ +++ E    F  RI    +  DD  + F  E K+DG  ++
Sbjct: 65  APLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRLKNGDD--LTFCCELKLDGLAVS 122

Query: 141 IRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFL 199
           + YE+G  V AA RGDG +GE++++ IR +  IP R+   NIP  +EVRGEV++    F 
Sbjct: 123 LLYEEGILVQAATRGDGTTGENITSNIRTVGAIPLRLEGENIPRRVEVRGEVFMKHGGFE 182

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKGQYE 256
            LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+ A   +E
Sbjct: 183 KLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPAS-HWE 241

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L + +  G PV++ ++       ++ +Y +++  RS+L +DIDG+V KVD  +LQ++LG
Sbjct: 242 RLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSSLGFDIDGVVVKVDSLALQERLG 301

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATLHN 
Sbjct: 302 FVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGVIVSNATLHNA 361

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    QP  FP+ CP+
Sbjct: 362 DEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVQPIVFPAACPV 410

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A ++EG+G + +D   +
Sbjct: 411 CGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRALDVEGMGDKIIDQLVE 464

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
            E     ++ PAD+F L     T   ++      G  S  NL +++ K ++ +L RF+++
Sbjct: 465 KE----YVKTPADLFRLSAGIMTGLDRM------GPKSAMNLVNALEKAKSTTLARFLYA 514

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR VG   A +LA ++ S       +  + A + D   +L+ VP VG I+A  +  F 
Sbjct: 515 LGIRDVGESTAANLAAHFGS-------LETLFAADED---ALLEVPDVGKIVAAHVRHFL 564

Query: 617 QNPRNICAVEALLKEVSPSIGRHE------KNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +   N   +  L      +I   E      + + S    K +V TG+L  + R +A++ +
Sbjct: 565 EEEHNQTVIRELTDPAGINIYWPEVKVVNAEEIDSPFAGKTVVLTGSLSILSRDEAKDRL 624

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL  + 
Sbjct: 625 TALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLLNNHG 676


>gi|283786048|ref|YP_003365913.1| DNA ligase [Citrobacter rodentium ICC168]
 gi|282949502|emb|CBG89116.1| DNA ligase [Citrobacter rodentium ICC168]
          Length = 671

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 255/715 (35%), Positives = 408/715 (57%), Gaps = 56/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     S  ++ H +P LSL+ +++ E    F  R+    + K  + + +  E K
Sbjct: 58  PTQRVGAAPLTSFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD--RLKSSDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++A +R I  IP R+   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVRAATRGDGTTGEDITANVRTIRAIPLRLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFA 251
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G    I  
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGIG----ILE 231

Query: 252 KGQYE-----MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
            G+        L + +  G PV+N V   ++   ++++Y++++  R TL +DIDG+V KV
Sbjct: 232 GGELPDTHLGRLMQFKAWGLPVSNRVTLCDSPEEVLAFYHKVEEDRPTLGFDIDGVVIKV 291

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +  +LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G 
Sbjct: 292 NSLALQEQLGYVARAPRWAVAFKFPAQEQMTSVRDVEFQVGRTGAITPVARLEPVQVAGV 351

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           L++NATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +
Sbjct: 352 LVSNATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPAETR 400

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P  FP+ CP+C S V R      G+ V   RCTGGL C+AQ+ E LKHFVSR A +++G+
Sbjct: 401 PVVFPAQCPVCGSDVER----VEGEAVT--RCTGGLICAAQRKESLKHFVSRRAMDVDGM 454

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + +D   + E     +  PAD+F L      +  K+  +   G  S  N+ D++ K +
Sbjct: 455 GDKIIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNVVDALEKAK 504

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
             +  RF+++LGIR VG   A  LA ++ + +  A E  +I          L +VP VG 
Sbjct: 505 ETTFARFLYALGIREVGEATAAGLAAFFGTLE--ALEAASI--------EELQKVPDVGI 554

Query: 607 IIAQAIVEFYQNPRNICAVEALLKE---VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           ++A  +  F+    N   +  LL E       +    + + S    K +V TG+L ++ R
Sbjct: 555 VVATHVFNFFAEESNRDVIRQLLAEGVHWPAPVAIKAEEIDSPFAGKTVVLTGSLSQMSR 614

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             A+  +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 615 DDAKARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|322418721|ref|YP_004197944.1| NAD-dependent DNA ligase [Geobacter sp. M18]
 gi|320125108|gb|ADW12668.1| DNA ligase, NAD-dependent [Geobacter sp. M18]
          Length = 668

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 265/711 (37%), Positives = 398/711 (55%), Gaps = 46/711 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A + ++ L +EI  H+  YY+   P I D+EYDAL R    +   FP+LA    P
Sbjct: 1   MEAQAAAERIAWLSKEIERHNRLYYEQDMPEITDAEYDALFRELQELEKKFPELAL---P 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG       +V HS P LSLE  ++ +D+  F  R+ RF     D  I +  E
Sbjct: 58  DSPTGRVGGRPLAKFTQVRHSTPMLSLENAFSEQDMVDFDDRVKRFLGLAADAQISYICE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGE 190
           PK+DG  + + Y  G     + RGDG  GE+V+  ++ I  +P R+ +   PE++ VRGE
Sbjct: 118 PKMDGVAVELVYRDGLLAIGSTRGDGVVGEEVTQNLKTIKDVPLRLETREPPELVTVRGE 177

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSE 248
           VY+    F   N E    G  P+ANPRNAA+G LR+L+ + IT  R L+ F +  G+ + 
Sbjct: 178 VYLPLAPFRKFNREREEAGEPPFANPRNAAAGSLRQLD-SRITAKRPLSIFCYAPGELAG 236

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           +    Q   L+ +     PVN   R       +++YY EM   R  LPY+IDG+V KVD 
Sbjct: 237 VEFTSQSHFLETIPKWRLPVNPLTRVVTGIQAMLAYYQEMMEKRDDLPYEIDGVVVKVDS 296

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
           F +Q++LGE++RSPRW  + KF  +QA+T +  I   +GRTG++TPVA L+PV++ G ++
Sbjct: 297 FRMQRELGEKSRSPRWATAWKFPPRQATTVVEKIFHSVGRTGVITPVAFLKPVSVSGVMV 356

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           + ATLHN + ++            +DIR GD V+V+RAG+VIP VV  ++++R   A   
Sbjct: 357 SRATLHNWEELE-----------RKDIREGDTVVVERAGDVIPAVVQALLDKRPEGAVKP 405

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
             P+ CP+C   VVR  +        A RC  GLAC AQ LER+KHF SR A +IEGLG 
Sbjct: 406 EIPTSCPVCGGEVVRLPDE------VAVRCV-GLACPAQLLERVKHFASRRAMDIEGLG- 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
              D F +      S+++ +D+  +   ++    + E +   G     NL ++I   +  
Sbjct: 458 ---DKFIEQ---LLSLKLISDVADIYALKEADFMQFERM---GKKLAENLLNAIEASKER 508

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
            L R IF+LG+RHVG   A+ LA  + S +N A+         +++ L+ IR   VG  +
Sbjct: 509 DLSRLIFALGMRHVGEHTAKLLAGAFGSIENLAK--------ASEEELTSIRE--VGPQV 558

Query: 609 AQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
           A +IV+F++N  N+  +E  LKE   S    EK +      K  VFTG L+K  R  A++
Sbjct: 559 AASIVDFFKNEENLRVIER-LKEAGVSPKVEEKRLGGRFTGKTFVFTGALEKFTRDGAKK 617

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            V Q GA  +  +S+KTD ++ G + GSKLEKA+QLGV+++ EE+FL L+Q
Sbjct: 618 MVEQEGAHAAGSVSKKTDYVVAGADAGSKLEKARQLGVRVLTEEEFLELMQ 668


>gi|262042032|ref|ZP_06015211.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040623|gb|EEW41715.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 671

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 254/715 (35%), Positives = 412/715 (57%), Gaps = 52/715 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    + K  + + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD--RLKSTDHLTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP ++   NIP  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEI 249
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
            A     +LQ  +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  
Sbjct: 236 PASHSARLLQ-FKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++
Sbjct: 295 ALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   
Sbjct: 355 NATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+CQS V R      G+ VA  RCTGGL C AQ+ E LKHFVSR A +++G+G +
Sbjct: 404 FPTHCPVCQSDVER----VEGEAVA--RCTGGLICGAQRKESLKHFVSRRALDVDGMGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   + E     +  PAD+F L      +  K+  +   G  S  N+ +++ K +  +
Sbjct: 458 IIDQLVEKE----YVHTPADLFRL------TAGKLTGLDRMGPKSAQNVVNALEKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A
Sbjct: 508 FARFLYALGIREVGEATAAGLAAHFGTLEALEQA----------SIEELQKVPDVGIVVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKE----VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
                F+    N   +  LL E     +P + + E+ + S    K +V TG+L ++ R  
Sbjct: 558 AHTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEE-IDSPFAGKTVVLTGSLSQLSRDD 616

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+  +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 617 AKARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|85859410|ref|YP_461612.1| NAD-dependent DNA ligase [Syntrophus aciditrophicus SB]
 gi|123738818|sp|Q2LTN8|DNLJ_SYNAS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|85722501|gb|ABC77444.1| NAD-dependent DNA ligase [Syntrophus aciditrophicus SB]
          Length = 672

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 266/717 (37%), Positives = 395/717 (55%), Gaps = 61/717 (8%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  E ARK +  L+  I YH+  YYQ   P I D+EYD+L +   A+   FP     + P
Sbjct: 2   MDAESARKNIEDLKARIEYHNRRYYQLDDPEISDAEYDSLLQELIALEKQFPQWLTEDSP 61

Query: 72  N-----GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           +      PL+K    ++LS        P LSL   ++ E++ +F  R+ RF    +  S 
Sbjct: 62  SRRIGAAPLSKFAPAVHLS--------PMLSLANAFSEEEILEFDRRLKRFLDSSERLS- 112

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS----LNIP 182
            F +EPKIDG  + + Y  G     A RGDG  GEDV+  IR + TIP  +       +P
Sbjct: 113 -FVVEPKIDGVAVNLIYSSGVLTTGATRGDGAKGEDVTQNIRTLHTIPLKIQNGSDERLP 171

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRY-LNFFVH 241
           E IE+RGE+Y+    F  LN+  +A G  P+ANPRNAA+G LR+L+ +   R  L  F +
Sbjct: 172 EQIEIRGEIYMETAAFRKLNERRLAAGEPPFANPRNAAAGSLRQLDASITARRPLKMFCY 231

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
            +G          +++L  ++  GF VN  +RQ       + +Y E++ +R+ LPY+IDG
Sbjct: 232 AVGIVRGRAFTYHHDVLHALKKWGFSVNPFIRQVEGIEKCIEFYRELQDLRNELPYEIDG 291

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +V KVD+ SLQ +LG  +RSPRW ++ KFA  QA+T + DI + +GRTG LTPVA + PV
Sbjct: 292 MVIKVDDLSLQTRLGAVSRSPRWAVACKFAATQATTVIRDIIVNVGRTGTLTPVALMTPV 351

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG  ++ ATLHN+D I             +DIR+GD VLV+RAG+VIP+VV +IV+ R
Sbjct: 352 KVGGVTVSRATLHNQDEID-----------KKDIRIGDTVLVQRAGDVIPEVVKVIVSNR 400

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
                PF  P  CP C S VVR          AAHRC  GL+C AQ    ++HFVSR   
Sbjct: 401 SGREIPFKIPDTCPECGSEVVRLAGE------AAHRCI-GLSCPAQLRRHIQHFVSRGGM 453

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG + +      +     I  PAD++ L      S   + N+    + SV+NL  +
Sbjct: 454 DIEGLGDKLVSQLVNQK----LIHDPADLYYL------SHDALLNLERMAEKSVSNLLSA 503

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I   ++ SL++ IF+LGIRHVG  I++ LA+ + +         N           L+ +
Sbjct: 504 IELSKHPSLDKIIFALGIRHVGEHISKILARRFRTLDALINTTEN----------ELLAI 553

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
             +G  ++ +I+EF++N  N   +E L K  VSP      +  S+ +  K  VFTG L +
Sbjct: 554 RDIGPEVSSSILEFFRNASNRRVIEKLKKAGVSPLETISPR--SAPLTGKTFVFTGALSR 611

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           + R +A++ V  LG   +  +++KTD ++ G+  GSKL+KAQ+ G+ I++EE+FL L
Sbjct: 612 MTRDEAKQIVESLGGQAAGTVTKKTDYVVAGEAAGSKLQKAQKAGIAILSEEEFLRL 668


>gi|212638096|ref|YP_002314616.1| NAD-dependent DNA ligase LigA [Anoxybacillus flavithermus WK1]
 gi|254781544|sp|B7GFV1|DNLJ_ANOFW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212559576|gb|ACJ32631.1| NAD-dependent DNA ligase [Anoxybacillus flavithermus WK1]
          Length = 672

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 256/706 (36%), Positives = 402/706 (56%), Gaps = 52/706 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           K+++ L ++I  H+  YY   +P I D+EYD L R+   +   +P   + + P+ P  ++
Sbjct: 11  KQIAELREQIEKHNYAYYVLDQPSISDAEYDELMRKLMELEEQYP---QYKTPDSPSQRV 67

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           GG    +  KVTH +P LSL   +N  DLR F  R+     +++   + +  E KIDG  
Sbjct: 68  GGAPLEAFRKVTHRVPMLSLSNAFNEGDLRDFDRRV-----RQEVGDVRYVCELKIDGLA 122

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDF 198
           +++RYE G FV  A RGDG +GED++  ++ I ++P  L L     IEVRGE Y+ +  F
Sbjct: 123 VSLRYEDGYFVQGATRGDGTTGEDITENLKTIRSLP--LRLRQQVTIEVRGEAYMPRKSF 180

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLGKTSEIFAKGQYEM 257
             LN++    G + +ANPRNAA+G LR+L+P    +R L+ F + +    E+        
Sbjct: 181 EKLNEKRKMNGEELFANPRNAAAGSLRQLDPKVAASRQLDIFAYHVVNAEELGILSHSAA 240

Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317
           L  +  LGF  N   +   T   ++SY  +    R++LPYDIDG+V KVD F+ QKQLG 
Sbjct: 241 LNYLDELGFKTNPARQVCETIDDVLSYIEQWHERRASLPYDIDGIVIKVDAFAQQKQLGA 300

Query: 318 RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNED 377
            A+SPRW I++KF  ++  T+L+DI++ +GRTG++TP A L+PV + G ++  A+LHNED
Sbjct: 301 TAKSPRWAIAYKFPAEEVVTQLVDIELSVGRTGVVTPTAILQPVRVAGTIVQRASLHNED 360

Query: 378 YIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPIC 437
           YI+            +DIR+GD V++K+AG++IP+VV  +   R    +PF  P+ CP C
Sbjct: 361 YIR-----------EKDIRLGDYVVIKKAGDIIPEVVCSLPERRTGKEEPFDMPTHCPAC 409

Query: 438 QSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKS 497
            S +VR L+ +      A RC     C AQ  E L HFVSR A NI+GLG++ +   F+ 
Sbjct: 410 ASELVR-LDDEV-----ALRCVNP-QCPAQIREGLIHFVSRQAMNIDGLGEKVIAQLFEH 462

Query: 498 EDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSL 557
                 +R  AD++TL + +  +  ++      G+ S TNL  +I   +  SLER +F L
Sbjct: 463 R----LVRSVADLYTLTKDELVALERM------GEKSATNLLQAIEASKQNSLERLLFGL 512

Query: 558 GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQ 617
           GIRHVGA+ A++LA+++ + +   Q               L+ +  +G+ +A +IV ++ 
Sbjct: 513 GIRHVGAKAAKTLAEHFETMERLQQATKE----------ELMAIHEIGEKMADSIVTYFS 562

Query: 618 NPRNICAVEALLK---EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLG 674
                  +E L      ++    +   ++SS    K  V TGTLQ + R +A+E +  LG
Sbjct: 563 KEEVKQLLERLRAYGVNMTYKGAKQTIDISSTFAGKTFVLTGTLQSMSRSEAKEKIETLG 622

Query: 675 AVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             V+  +S+KTD+++VG++ GSKLEKA+QLG+ I +E +FL  +QQ
Sbjct: 623 GKVTGSVSKKTDVVVVGEDAGSKLEKAKQLGITIWDEARFLQEIQQ 668


>gi|261822799|ref|YP_003260905.1| NAD-dependent DNA ligase LigA [Pectobacterium wasabiae WPP163]
 gi|261606812|gb|ACX89298.1| DNA ligase, NAD-dependent [Pectobacterium wasabiae WPP163]
          Length = 681

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 259/708 (36%), Positives = 405/708 (57%), Gaps = 53/708 (7%)

Query: 21  LSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGG 80
           ++ L + + +H+  Y+    P I DSEYD L +   A+    P+L  S+ P     ++G 
Sbjct: 15  VAELRRVLRHHEYKYHVEDAPEIPDSEYDKLMQELKALEADHPELVTSDSPT---QRVGA 71

Query: 81  EMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMIT 140
               +  +V H +P LSL+ +++ E    F  RI    +  DD  + F  E K+DG  ++
Sbjct: 72  APLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRLKNGDD--LTFCCELKLDGLAVS 129

Query: 141 IRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-RVLSLNIPEIIEVRGEVYISKNDFL 199
           + YE G  V AA RGDG +GE++++ IR +  IP R+   NIP  +EVRGEV++    F 
Sbjct: 130 LLYEDGVLVQAATRGDGTTGENITSNIRTVGAIPLRLEGENIPRRVEVRGEVFMKHGGFE 189

Query: 200 ALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFFVHGLG--KTSEIFAKGQYE 256
            LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G  +  E+ A   +E
Sbjct: 190 KLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPAS-HWE 248

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L + +  G PV++ ++       ++ +Y +++  RS L +DIDG+V KVD  +LQ++LG
Sbjct: 249 RLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSELGFDIDGVVVKVDSLALQERLG 308

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATLHN 
Sbjct: 309 FVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGVIVSNATLHNA 368

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    QP  FP  CP+
Sbjct: 369 DEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVQPIVFPVACPV 417

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S V R      G+ V   RCTGGL C AQ+ E LKHFVSR A ++EG+G + +D   +
Sbjct: 418 CGSDVER----VEGEAVT--RCTGGLICGAQRKEALKHFVSRRALDVEGMGDKIIDQLVE 471

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
            E     ++ PAD+F L     T   ++      G  S  N+ +++ K ++ +L RF+++
Sbjct: 472 KE----YVKTPADLFRLSAGSMTGLDRM------GPKSAMNVVNALEKAKSTTLARFLYA 521

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR VG   A +LA ++ S       +  + A + D   +L+ VP VG I+A  +  F 
Sbjct: 522 LGIRDVGESTAANLAAHFGS-------LEALFAADED---ALLAVPDVGKIVAAHVRHFL 571

Query: 617 QNPRNICAVEALLKEVSPSIGRHE------KNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +   N   +  L      +I   E      + + S    K +V TG+L  + R +A++ +
Sbjct: 572 EEEHNQTVIRELTDPAGINIHWPEVQVVNAEEIDSPFAGKTVVLTGSLSILSRDEAKDRL 631

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 632 TALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIAVIDEAEMIRLL 679


>gi|237745525|ref|ZP_04576005.1| DNA ligase [Oxalobacter formigenes HOxBLS]
 gi|229376876|gb|EEO26967.1| DNA ligase [Oxalobacter formigenes HOxBLS]
          Length = 685

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 264/717 (36%), Positives = 406/717 (56%), Gaps = 59/717 (8%)

Query: 22  SSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGE 81
           + L  EI  ++  YY    P++ D+EYD + R    +  A+P+L     P  P  ++GG 
Sbjct: 20  AKLRSEIERYNYAYYVLDAPVVPDAEYDRVFRELQELEAAYPELVV---PGSPTQRVGGA 76

Que