PSIBLAST alignment of GI: 254781172 and protein with PDB id: 2k7f

>gi|257471690|pdb|2K7F|A Chain A, Haddock Calculated Model Of The Complex Between The Brct Region Of Rfc P140 And Dsdna Length = 109
>gi|259090084|pdb|2K6G|A Chain A, Solution Structure Of The Dna Binding Brct Domain From The Large Subunit Of Human Replication Factor C Length = 109
 Score =  119 bits (297), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 637 GRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG- 695
               K   + +E    V TG L+ I+R +A+  + + G  V+  +S+KT+ +++G + G 
Sbjct: 23  KEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQ 82

Query: 696 SKLEKAQQLGVKIMNEEQFLFLL 718
           SK +KA  LG KI++E+  L L+
Sbjct: 83  SKSDKAAALGTKIIDEDGLLNLI 105