BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA
[Candidatus Liberibacter asiaticus str. psy62]
         (731 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|190892570|ref|YP_001979112.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
 gi|254781398|sp|B3PTU7|DNLJ_RHIE6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190697849|gb|ACE91934.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
          Length = 718

 Score =  651 bits (1678), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/718 (47%), Positives = 492/718 (68%), Gaps = 5/718 (0%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
             +   ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   F
Sbjct: 2   STEGSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEARF 61

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L R    + P   +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  
Sbjct: 62  PELIRE---DSPSRHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLP 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D SI FT EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P
Sbjct: 119 DQSIAFTAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVP 178

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 179 AVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAY 238

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ +E+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG
Sbjct: 239 AWGEMAEMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDG 298

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD   LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+
Sbjct: 299 VVYKVDSLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPI 358

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +GG ++TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +
Sbjct: 359 TVGGVVVTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEK 418

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ + FP  CP+C S  VR++N KTGK  +  RCTGG  C AQ  E LKHFVSR+A
Sbjct: 419 RAADARSYEFPKTCPVCGSHAVREVNEKTGKTDSVRRCTGGFICRAQATEHLKHFVSRNA 478

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY 
Sbjct: 479 FDIEGLGSKQVDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYA 538

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +IN+RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + + W  L  
Sbjct: 539 AINERRSIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGEAWTDLNA 598

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G+++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K
Sbjct: 599 IEGIGEVVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEK 658

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 659 FTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|86358438|ref|YP_470330.1| NAD-dependent DNA ligase LigA [Rhizobium etli CFN 42]
 gi|123738303|sp|Q2K6D3|DNLJ_RHIEC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86282540|gb|ABC91603.1| DNA ligase (NAD+) protein [Rhizobium etli CFN 42]
          Length = 718

 Score =  650 bits (1677), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/718 (47%), Positives = 493/718 (68%), Gaps = 5/718 (0%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
             +   +E L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   F
Sbjct: 2   STEGSAVETLTIEEAAAELERLAREIAHHDALYHGKDQPEISDADYDALKRRNDALEARF 61

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L R    + P  ++G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  
Sbjct: 62  PELIRE---DSPSRRVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVASVYRFLGRMP 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D SI FT EPKIDG  ++IRYE G+   AA RGDG +GE+V+A IR I  IP  L   +P
Sbjct: 119 DQSIAFTAEPKIDGLSMSIRYENGRLTTAATRGDGTTGENVTANIRTIAEIPNQLPKGVP 178

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 179 AVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAY 238

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ S++ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG
Sbjct: 239 AWGEMSDMPADTQFAMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLKRPDLDYDIDG 298

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD   LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+
Sbjct: 299 VVYKVDSLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPI 358

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +GG ++TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +
Sbjct: 359 TVGGVVVTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEK 418

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  + +P+ FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+A
Sbjct: 419 RLAEVKPYEFPKICPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNA 478

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY 
Sbjct: 479 FDIEGLGSKQIDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYA 538

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +IN+RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  
Sbjct: 539 AINERRSIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGDAWNDLNA 598

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G+++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K
Sbjct: 599 IEGIGEVVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEK 658

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 659 FTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|241205543|ref|YP_002976639.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859433|gb|ACS57100.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 718

 Score =  650 bits (1677), Expect = 0.0,   Method: Composition-based stats.
 Identities = 341/718 (47%), Positives = 489/718 (68%), Gaps = 5/718 (0%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
             +   ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   F
Sbjct: 2   STESSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDRPEISDADYDALKRRNDALEVRF 61

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L R    + P   +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  
Sbjct: 62  PELIRE---DSPSRHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLP 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D SI FT EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P
Sbjct: 119 DQSIAFTAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVP 178

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 179 AVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAY 238

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ SE+ A  Q+ M+Q  +  GFPVN  V++ N+   I+++Y+E+   R  L YDIDG
Sbjct: 239 AWGEMSEMPADTQFGMVQTFKDWGFPVNPLVKRLNSVADILTHYDEIGLERPDLDYDIDG 298

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD   LQ +LG R+RSPRW  +HKF  +QA T + +IDIQ+GRTG LTPVARL P+
Sbjct: 299 VVYKVDSLELQARLGFRSRSPRWATAHKFPAEQAFTIVENIDIQVGRTGALTPVARLTPI 358

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMR-GGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V+D+++ +
Sbjct: 359 TVGGVVVTNATLHNADYIRGIGNSGERIRADEHDIRIGDTVIVQRAGDVIPQVLDVVMEK 418

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  +A+P+ FP  CP+C S  VR+ + KTGKL +  RCTGG  C AQ  E LKHFVSR+A
Sbjct: 419 RSAEARPYEFPKTCPVCGSHAVRERHEKTGKLDSVTRCTGGFICRAQATEHLKHFVSRNA 478

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+DFFF++ED +  IR   DIFTL++RQQ S TK+ENI GFG VSV  LY 
Sbjct: 479 FDIEGLGSKQIDFFFENEDASLQIRTAPDIFTLEKRQQQSLTKLENIDGFGKVSVGKLYA 538

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +I +RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y  F   +    A + D W  L  
Sbjct: 539 AITERRSIALHRFIYALGIRHVGETTAKLLARSYGTYAAFETAMREAEALSGDAWNDLNA 598

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G+++A+AIVEFY+ PRN+  +  L++EV+P      K   S +  K +VFTG+L+K
Sbjct: 599 IEGIGEVVARAIVEFYKEPRNVEVITRLIEEVTPEEAEQPKTAGSPVAGKTVVFTGSLEK 658

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++ GV+ M+E+++L L+
Sbjct: 659 FTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKAREFGVQTMDEDEWLALI 716


>gi|209550159|ref|YP_002282076.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|254781399|sp|B5ZWH9|DNLJ_RHILW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209535915|gb|ACI55850.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 718

 Score =  649 bits (1675), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/718 (47%), Positives = 492/718 (68%), Gaps = 5/718 (0%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
             +   ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   F
Sbjct: 2   STEGSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDRPQISDADYDALKRRNDALEVQF 61

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L R    + P  ++G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  
Sbjct: 62  PELIRE---DSPSRRVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVASVYRFLGRLP 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D SI FT EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P
Sbjct: 119 DQSIAFTAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVP 178

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 179 AVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAY 238

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ SE+ A  Q++M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG
Sbjct: 239 AWGEMSEMPADTQFDMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDG 298

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD   LQ +LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+
Sbjct: 299 VVYKVDSLELQARLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPI 358

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +GG ++TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +
Sbjct: 359 TVGGVVVTNATLHNEDYIKGIGNSGERIRPEDHDIREGDTVIVQRAGDVIPQILDVVMEK 418

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ + FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+A
Sbjct: 419 RTADARSYEFPKTCPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNA 478

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+DFFF+ ED +  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY 
Sbjct: 479 FDIEGLGSKQIDFFFEHEDASLQIRTAPEIFTLEKRQQASLTKLENIDGFGKVSVGKLYT 538

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +IN+RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  
Sbjct: 539 AINERRSIALHRFIYALGIRHVGETTAKLLARSYGTYEAFAMAMKEAAPLSGDAWNDLNA 598

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G+++A+A+VEFY+ PRN+  +  L++EV+P          S +  K +VFTG+L+K
Sbjct: 599 IEGIGEVVARAMVEFYKEPRNVEVITRLIEEVTPQQAEQPVTTGSPVAGKTVVFTGSLEK 658

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 659 FTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|327194610|gb|EGE61460.1| DNA ligase (NAD+) protein [Rhizobium etli CNPAF512]
          Length = 718

 Score =  648 bits (1672), Expect = 0.0,   Method: Composition-based stats.
 Identities = 340/718 (47%), Positives = 493/718 (68%), Gaps = 5/718 (0%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
             +   ++ L+IE+A  EL  L +EI++HD  Y+   +P I D++YDALKRR DA+   F
Sbjct: 2   STEGSAVDTLTIEEAAAELERLAKEIAHHDSLYHGKDQPEISDADYDALKRRNDALEVRF 61

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L R    + P   +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +  
Sbjct: 62  PELIRE---DSPSRHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLP 118

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D SI FT EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   +P
Sbjct: 119 DQSIAFTAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKGVP 178

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 179 AVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAY 238

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ +E+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDIDG
Sbjct: 239 AWGEMAEMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDIDG 298

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD   LQ++LG R+RSPRW  +HKF  +QA T +  I+IQ+GRTG LTPVARL+P+
Sbjct: 299 VVYKVDSLELQQRLGFRSRSPRWATAHKFPAEQAFTEVEKIEIQVGRTGALTPVARLKPI 358

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
            +GG ++TNATLHNEDYIKG+  SG+ +R    DIR GD V+V+RAG+VIP+++D+++ +
Sbjct: 359 TVGGVVVTNATLHNEDYIKGIGNSGERIRPEEHDIREGDTVIVQRAGDVIPQILDVVMEK 418

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ + FP  CP+C S  VR++N KTGK+ +  RCTGG  C AQ  E LKHFVSR+A
Sbjct: 419 RAADARSYEFPKTCPVCGSHAVREVNEKTGKMDSVRRCTGGFICRAQATEHLKHFVSRNA 478

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+DFFF++EDP+  IR   +IFTL++RQQ S TK+ENI GFG VSV  LY 
Sbjct: 479 FDIEGLGAKQVDFFFENEDPSLQIRTAPEIFTLEKRQQDSLTKLENIDGFGKVSVGKLYA 538

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +IN+RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y+ FA  +      + D W  L  
Sbjct: 539 AINERRSIALHRFIYALGIRHVGETTAKLLARSYGTYEAFATAMKEAAPLSGDAWNDLNA 598

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G+++A+A+VEFY+ PRN+  +  LL EV+P+         S +  K +VFTG+L+K
Sbjct: 599 IEGIGEVVARAMVEFYKEPRNVEVIGRLLDEVTPAEAEQPVTAGSPVAGKTVVFTGSLEK 658

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 659 FTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 716


>gi|227822641|ref|YP_002826613.1| NAD-dependent DNA ligase LigA [Sinorhizobium fredii NGR234]
 gi|254781400|sp|C3MEL9|DNLJ_RHISN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|227341642|gb|ACP25860.1| DNA ligase [Sinorhizobium fredii NGR234]
          Length = 717

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 353/716 (49%), Positives = 493/716 (68%), Gaps = 4/716 (0%)

Query: 4   RQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFP 63
            +  P+E L+  +A +EL+ L  E++ HD  Y+    P I D++YDALKRR D I   FP
Sbjct: 3   NEKKPVEQLTETEAAEELAFLVTELARHDALYHGQDAPEISDADYDALKRRNDLIEELFP 62

Query: 64  DLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD 123
            L R    + P  KIG   +L+   V H+ P LSL+  ++ ED R F+  IYRF  K  D
Sbjct: 63  ALIRE---DSPSRKIGAAPSLTFQPVLHARPMLSLDNTFSDEDARDFVAGIYRFLGKLPD 119

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPE 183
           +SI FT EPKIDG  +++RYE  K V AA RGDG +GE+V+A IR I  IP+ L  + P+
Sbjct: 120 HSIAFTAEPKIDGLSMSLRYENRKLVTAATRGDGTTGENVTANIRTIRMIPQTLPADAPD 179

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHG 242
           ++EVRGE+Y++K+DF ALN EM A GR  Y NPRN ASG LR+L+     +R L FF + 
Sbjct: 180 VVEVRGEIYMAKSDFAALNAEMAAQGRPLYVNPRNTASGSLRQLDAKVTASRKLRFFAYA 239

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+ S + +  Q+ M++  +  GFPVN  +++ ++   ++ +Y+ ++  R  L YDIDG+
Sbjct: 240 WGEISAMPSDTQFGMVETFKAWGFPVNPLMQRLSSADELLQHYHHIERERPDLDYDIDGV 299

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD   LQ +LG R+RSPRW  +HKF  +QA TRL  IDIQ+GRTG LTPVARLEP+ 
Sbjct: 300 VYKVDRLDLQARLGFRSRSPRWATAHKFPAEQAFTRLKGIDIQVGRTGALTPVARLEPIT 359

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG ++TNATLHNEDYI+G+  SG+ +R GRDIR+GD V+V+RAG+VIP++VD++++ER 
Sbjct: 360 VGGVVVTNATLHNEDYIRGIGNSGEPIREGRDIRIGDMVIVQRAGDVIPQIVDVVMDERA 419

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
             A+P+ FP+ CP+C S  VRD+N KTGK+ A  RCTGG  C AQ +E LKHFVSR AF+
Sbjct: 420 EGAEPYRFPTTCPVCGSHAVRDINEKTGKVDAVRRCTGGFVCRAQAIEHLKHFVSRHAFD 479

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           IEGLG +Q++FFF+SEDP  SIR   DIFTL+RRQ+ S TK+ENI GFG VSV  LY++I
Sbjct: 480 IEGLGSKQIEFFFESEDPTLSIRTAPDIFTLERRQEASLTKLENIEGFGKVSVRKLYEAI 539

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           N RR I+L RFI++LGIRHVG   A+ LA+ Y +Y++F   + +  +   D W  L  + 
Sbjct: 540 NARREIALHRFIYALGIRHVGETTAKLLARSYGTYEHFRAAMVDAGSLAGDAWNELNSIE 599

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+++A+AIVEFY+ PRN+  V  LL+EV P       +  S +  K +VFTG+L+K+ 
Sbjct: 600 GIGEVVARAIVEFYKEPRNLKVVSDLLEEVRPESAETRVSTDSPVAGKTVVFTGSLEKMT 659

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 660 RDEAKAKAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDEWLALI 715


>gi|222149123|ref|YP_002550080.1| NAD-dependent DNA ligase LigA [Agrobacterium vitis S4]
 gi|254781248|sp|B9JY41|DNLJ_AGRVS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221736108|gb|ACM37071.1| DNA ligase [Agrobacterium vitis S4]
          Length = 719

 Score =  643 bits (1657), Expect = 0.0,   Method: Composition-based stats.
 Identities = 343/716 (47%), Positives = 478/716 (66%), Gaps = 6/716 (0%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           LIP+E LS EQA +EL  L   I++HD  Y+   +P I D++YDALKRR DAI   FP L
Sbjct: 5   LIPVEDLSEEQAGQELIRLAAAIAHHDALYHGKDQPEISDADYDALKRRNDAIEARFPTL 64

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            RS   + P  ++G        ++TH+ P LSL+  ++ ED+  F+  +YRF     DNS
Sbjct: 65  VRS---DSPSQRVGAAPAGIFSQITHARPMLSLDNTFSDEDVADFVASVYRFLGVMPDNS 121

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE  K   AA RGDG +GE+V+A I  I  IP  L  + P+++
Sbjct: 122 IAFTAEPKIDGLSMSIRYEHRKLKTAATRGDGTTGENVTANILTIKEIPTELPADAPDVV 181

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A GR+ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 182 EVRGEVYMAKSDFLALNAQMEAEGRQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWG 241

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S + A+ Q  M++  +  GFPVN   R+  +   I+++Y E+   R+ L YDIDG+VY
Sbjct: 242 EMSTMPAETQSGMVEAFKRWGFPVNPLTRRLTSVEEIIAHYREIGLQRADLDYDIDGVVY 301

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW  +HKF  +QA T +  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 302 KVDRLDLQARLGFRSRSPRWATAHKFPAEQAFTTVEAIDIQVGRTGALTPVARLEPITVG 361

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           G ++TNATLHN DYI+G+   G+ +R    DIR+GD V+V+RAG+VIP+V+D+++ +R  
Sbjct: 362 GVVVTNATLHNADYIEGIGNGGERIRPEGHDIRIGDTVIVQRAGDVIPQVLDVVLEKRPE 421

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
            +  + FP  CP+C S  VR+ N KTGKL +  RCTGG  CSAQ  E +KHFVSR+AF+I
Sbjct: 422 TSVKYEFPKTCPVCGSHAVREKNEKTGKLDSVTRCTGGFVCSAQAKEHIKHFVSRNAFDI 481

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSI 542
           EGLG +Q+DFFF+SEDPA  IR   DIFTL++RQ+ S+ T++ENI GFG VSV  L+D+I
Sbjct: 482 EGLGTKQVDFFFESEDPALMIRTAPDIFTLKQRQEASSLTRLENIDGFGRVSVRKLFDAI 541

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           + RR I+L RFIF+LGIRHVG   A+ LA+ Y SY  FA  +        + W  L  + 
Sbjct: 542 DARREIALNRFIFALGIRHVGETTAKLLARSYGSYAAFADAMQEAAPKFGEAWNELNSID 601

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+++A ++VEF++ PRN+  V  LLKEV+P          S +  K +VFTG+L++  
Sbjct: 602 GIGEVVAASMVEFFKEPRNLEVVSRLLKEVTPLDAEAVTASDSPVAGKTVVFTGSLERFT 661

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA V+  +S+KTD ++ G   GSKL+KA+++GV +M E+++L L+
Sbjct: 662 RDEAKARAESLGAKVAGSVSKKTDYLVAGPGAGSKLDKAREVGVTVMTEDEWLALI 717


>gi|254502790|ref|ZP_05114941.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
 gi|222438861|gb|EEE45540.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
          Length = 725

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 314/717 (43%), Positives = 466/717 (64%), Gaps = 9/717 (1%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
             I +  L+ E A+ EL  L  EI+ HD  Y+Q   P I D++YDAL+RR  AI   FPD
Sbjct: 14  PDIAVLDLTPEAAKAELERLASEIAEHDRRYHQEDAPTISDADYDALRRRNSAIEARFPD 73

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD- 123
           L  +   +GP  ++G        K+TH +P LSL+  ++ +D+R F+ R+ RF +     
Sbjct: 74  LILA---DGPSAQVGAAPASGFGKITHRVPMLSLDNAFSDDDVRDFVGRVRRFLKFDPLM 130

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPE 183
            ++  T EPKIDG  +++RYE GK VYAA RGDG +GE+V+A  + I  IP  L+ ++ +
Sbjct: 131 GALAVTAEPKIDGLSLSLRYEDGKLVYAATRGDGTTGENVTANAKTITDIPHTLAGSVLD 190

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHG 242
           ++EVRGEVY++  DF ALN  M+A G K +ANPRNAA+G LR+L      +R L FF + 
Sbjct: 191 VVEVRGEVYMAHKDFEALNARMVANGGKVFANPRNAAAGSLRQLKSEITASRPLRFFAYA 250

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+ S +    Q  M+ ++   GF +N  +++  T   +++ Y+ ++  R+ L YDIDG+
Sbjct: 251 WGEMSTLPKDTQDGMVAQLAAWGFQINPLMKRCETVEELLAVYHGIEENRAQLDYDIDGV 310

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD   LQ++LG  +RSPRW I+HKF  +QA T L DI+IQ+GRTG LTPVA+LEP+ 
Sbjct: 311 VYKVDRLDLQERLGFVSRSPRWAIAHKFPAEQAWTVLNDIEIQVGRTGALTPVAKLEPIT 370

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG +++NATLHNEDYIKG+   G+ +RGG+D+R GD V ++RAG+VIP++VD+ +++R 
Sbjct: 371 VGGVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRKGDAVKIQRAGDVIPQIVDVDLDKRL 430

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
             A+P+ FP+ CP C S  VR+ N KTG+  A  RCTGGL C AQ  E+LKHFVSR+AF+
Sbjct: 431 DGAEPYEFPTRCPRCNSHAVREENEKTGRKDAVRRCTGGLICPAQATEKLKHFVSRNAFD 490

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           IEG G +Q+D F++ +     +   ADIFTL  R + S TK+ N  G+G VS  NL+++I
Sbjct: 491 IEGFGDKQVDAFYQDD----LVMTAADIFTLAERDKQSLTKLRNREGWGAVSAKNLFEAI 546

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           + RR I L RFIF+LGIRHVG   A+ LA+ Y S+ NF + +     H ++ W  L  + 
Sbjct: 547 DARREIDLHRFIFALGIRHVGEGNAKLLARAYGSWANFYKAMTEASDHGSEAWAELNDID 606

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G I+A A+VEF+    N   ++ALL+EV+P+         S +  K +VFTG+L+++ 
Sbjct: 607 GIGHIVADALVEFFAENHNREQLDALLQEVTPTDAEKIDASGSPVAGKTVVFTGSLERMT 666

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           R +A+    + GA VS  +S+KTD+++ G   GSKL+KA +L +++++E+ +  L+ 
Sbjct: 667 RDEAKAMAERFGAKVSGSVSKKTDLVVAGPGAGSKLKKASELEIEVISEDDWFDLVD 723


>gi|307944884|ref|ZP_07660221.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
 gi|307771808|gb|EFO31032.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
          Length = 721

 Score =  637 bits (1644), Expect = e-180,   Method: Composition-based stats.
 Identities = 323/720 (44%), Positives = 465/720 (64%), Gaps = 9/720 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           +   + + +EAL+ EQA  EL  L   I+ HD  Y+Q   P I D++YDAL+RR  AI  
Sbjct: 7   VSAFEKLDVEALTSEQAETELERLANAIAKHDKLYHQDDAPAISDADYDALRRRNTAIEA 66

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FPDL R    + P   +G   + +  K+ H +P LSL+  +N ED++ F+ R+ RF + 
Sbjct: 67  RFPDLVRD---DSPSRNVGAAPSEAFSKIEHKVPMLSLDNAFNDEDVQDFVGRVRRFLKF 123

Query: 121 KDD-NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL 179
                ++  T EPKIDG  +++RYE G  VYAA RGDG +GE+V+A  + I  IP+ LS 
Sbjct: 124 DPLMGALAVTAEPKIDGLSLSLRYEAGALVYAATRGDGTTGENVTANAKTISDIPQKLSG 183

Query: 180 NIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNF 238
           + P+++E+RGEVY++  DF  LN  M A G K +ANPRNAA+G LR+L      +R L F
Sbjct: 184 DAPDVVEIRGEVYMAHADFQVLNQRMEANGGKVFANPRNAAAGSLRQLKSEITASRPLKF 243

Query: 239 FVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
           F +  G  S + A  Q  M+++M+  GF +N  +++  T   +++ Y+ ++  R+TL YD
Sbjct: 244 FAYAWGDMSALPADTQMGMVEQMKVWGFQINPLMKRCETVEELLAVYHGIEEDRATLGYD 303

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD   LQ++LG  +RSPRW I+HKF  ++A T L +IDIQ+GRTG LTPVA+L
Sbjct: 304 IDGVVYKVDRLDLQQRLGFVSRSPRWAIAHKFPAEKAYTILNEIDIQVGRTGALTPVAKL 363

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GG +++NATLHNEDYIKG+   G+ +RGG+D+R GD V V+RAG+VIP++VD+ +
Sbjct: 364 EPVTVGGVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRPGDTVQVQRAGDVIPQIVDVDL 423

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R   A+PF FPS CP C S  VR+ NPKTG+L A  RCTG L C AQ  ERLKHFVSR
Sbjct: 424 SKRKEGAEPFEFPSVCPRCGSHAVREENPKTGRLDAVRRCTGALICPAQATERLKHFVSR 483

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
           +AF+IEG G +Q+D FF        ++  ADIFTL+ R + S TK+ N  G+G VS  NL
Sbjct: 484 NAFDIEGFGDKQVDAFFAD----GLVKTAADIFTLEERDKQSLTKLRNREGWGTVSAKNL 539

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           +++IN +RNI L R IF LGIRHVG   A+ LA+ Y S+Q F   +      N + W  L
Sbjct: 540 FEAINAKRNIDLHRLIFGLGIRHVGEGNAKLLARAYGSWQAFYDAMVKAHDKNGEAWEDL 599

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +G I+A+A+ EF+    N   ++ALL ++SP       +  S +  K +VFTG L
Sbjct: 600 NAIDGIGHIVAEALTEFFAEEHNREQLDALLAQISPKQVEQIDSSGSPVAGKTVVFTGAL 659

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +++ R +A+    +LGA VS  +S+KTD+++ G   GSKL+KAQ L ++++ E+ +  L+
Sbjct: 660 ERMTRDEAKAMAERLGAKVSGSVSKKTDLLVAGPGAGSKLKKAQGLQIEVITEDVWFDLV 719


>gi|325293451|ref|YP_004279315.1| DNA ligase [Agrobacterium sp. H13-3]
 gi|325061304|gb|ADY64995.1| DNA ligase [Agrobacterium sp. H13-3]
          Length = 724

 Score =  637 bits (1644), Expect = e-180,   Method: Composition-based stats.
 Identities = 342/726 (47%), Positives = 485/726 (66%), Gaps = 12/726 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K Q IP+E L+  +A  EL+ L  E++ HD  Y+    P I D++YDALKRR DAI  
Sbjct: 1   MSKDQ-IPVENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEA 59

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP L R+   + P  K+G     +   + H+ P LSL+  ++  DLR F++ +YRF   
Sbjct: 60  AFPALVRA---DSPSKKVGFTPLPTFAPIVHARPMLSLDNTFSEGDLRDFVSSVYRFLGH 116

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             D+SI FT EPKIDG  ++IRYE GK   AA RGDG +GE+V+A I+ I  IP  L  +
Sbjct: 117 LPDDSIAFTAEPKIDGLSMSIRYENGKLKTAATRGDGTTGENVTANIKTIKEIPNQLPAD 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P+++EVRGEVY++K+DF+ALN +M A G++ Y NPRN ASG LR+ +      R L FF
Sbjct: 177 VPDVVEVRGEVYMAKSDFMALNAQMEADGKQTYVNPRNTASGSLRQFDANVTAKRKLRFF 236

Query: 240 VHGLGKT-----SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
            + LG+          A  QY +++K R  GFPVN  +++  +   ++ +YNE+   R  
Sbjct: 237 AYALGEVSNGGQPTRIADTQYGIVEKFREWGFPVNPLMKRFTSAEQLLEHYNEIGVARPD 296

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           L YDIDG+VYKVD   LQ++LG R+RSPRW  +HKF  +QA T + +I+IQ+GRTG LTP
Sbjct: 297 LDYDIDGVVYKVDRLDLQERLGFRSRSPRWATAHKFPAEQAFTTVENIEIQVGRTGALTP 356

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKV 413
           VARL P+ +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V
Sbjct: 357 VARLTPITVGGVVVTNATLHNADYIEGIGNSGERIRPEDHDIRIGDTVIVQRAGDVIPQV 416

Query: 414 VDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLK 473
           +D+++ +R  +A  ++FP  CP+C S  VR+ N KTGKL +  RCTGG  C AQ +E LK
Sbjct: 417 LDVLLEKRPAEAVKYAFPEKCPVCGSHAVRERNEKTGKLDSVTRCTGGFVCRAQAVEHLK 476

Query: 474 HFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGD 532
           HFVSR+AF+IEGLG +Q+DFFF+SEDPA SI+   DIFTL+ RQ+ S  TK+ENI GFG 
Sbjct: 477 HFVSRNAFDIEGLGSKQIDFFFESEDPALSIKTAPDIFTLKARQEASHLTKLENIDGFGK 536

Query: 533 VSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNN 592
           VSV  L+D+I+ RR I L R IF+LGIRHVG   A+ LA+ Y +Y++F + +       +
Sbjct: 537 VSVKKLFDAIDARREIDLHRLIFALGIRHVGETTAKLLARSYGTYEHFEEAMKAAADPAS 596

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           D W  L  +  +G+++A+AI+EFY+ PRN+  ++ L++E+ P          S +  K +
Sbjct: 597 DAWAELNSIDGIGEVVARAIIEFYKEPRNLDVIDRLIRELRPKEAEKPSTEGSPVAGKTV 656

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L+K  R +A+     LGA V+  +S+KTDI++ G   GSKL KA +LGV+ M+E+
Sbjct: 657 VFTGSLEKFTRDEAKARAESLGAKVAGSVSKKTDILVAGPGAGSKLAKAAELGVQTMDED 716

Query: 713 QFLFLL 718
           ++L L+
Sbjct: 717 EWLALI 722


>gi|15889366|ref|NP_355047.1| NAD-dependent DNA ligase LigA [Agrobacterium tumefaciens str. C58]
 gi|166215388|sp|A9CIB3|DNLJ_AGRT5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15157212|gb|AAK87832.1| DNA ligase [Agrobacterium tumefaciens str. C58]
          Length = 724

 Score =  634 bits (1635), Expect = e-179,   Method: Composition-based stats.
 Identities = 345/726 (47%), Positives = 484/726 (66%), Gaps = 12/726 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K Q IP+E L+  +A  EL+ L  E++ HD  Y+    P I D++YDALKRR DAI  
Sbjct: 1   MSKDQ-IPVENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEA 59

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFP L R+   + P  K+G     +   + H+ P LSL+  ++ EDLR F++ +YRF   
Sbjct: 60  AFPALVRA---DSPSKKVGFTPLPTFAPIVHARPMLSLDNTFSEEDLRDFVSSVYRFLGH 116

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             D+SI FT EPKIDG  ++IRYE  K   AA RGDG +GE+V+A IR I  IP  L  +
Sbjct: 117 LPDDSIAFTAEPKIDGLSMSIRYENRKLKTAATRGDGTTGENVTANIRTIKEIPNELPAD 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P+++EVRGEVY++K+DFLALN +M A G++ Y NPRN ASG LR+L+      R L FF
Sbjct: 177 APDVVEVRGEVYMAKSDFLALNAQMEADGKQTYVNPRNTASGSLRQLDANVTAKRKLRFF 236

Query: 240 VHGLGKTSE-----IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
            + LG+ S        A  QY +++K R  GFPVN  +++  +   ++ +YNE+   R  
Sbjct: 237 AYALGEVSNGGQPARIADTQYGIVEKFREWGFPVNPLMKRFTSAQQLLEHYNEIGVARPD 296

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           L YDIDG+VYKVD   LQ++LG R+RSPRW  +HKF  +QA T + +I+IQ+GRTG LTP
Sbjct: 297 LDYDIDGVVYKVDRLDLQERLGFRSRSPRWATAHKFPAEQAFTTVENIEIQVGRTGALTP 356

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGG-RDIRVGDRVLVKRAGEVIPKV 413
           VARL P+ +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V
Sbjct: 357 VARLTPITVGGVVVTNATLHNADYIEGIGNSGERIRPEDHDIRIGDTVIVQRAGDVIPQV 416

Query: 414 VDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLK 473
           +D+++ +R   A  + FP  CP+C S  VR+ N KTGKL +  RCTGG  C AQ +E LK
Sbjct: 417 LDVLLEKRAAGAAKYVFPEKCPVCGSHAVRERNEKTGKLDSVTRCTGGFVCRAQAVEHLK 476

Query: 474 HFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGD 532
           HFVSR+AF+IEGLG +Q+DFFF+S+DPA SI+   DIFTL+ RQ+ S  TK+ENI GFG 
Sbjct: 477 HFVSRNAFDIEGLGTKQIDFFFESDDPALSIKTAPDIFTLKARQEASHLTKLENIDGFGK 536

Query: 533 VSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNN 592
           VSV  L+D+I+ RR I L R IF+LGIRHVG   A+ LA+ Y +Y++F + +       +
Sbjct: 537 VSVKKLFDAIDARRAIDLHRLIFALGIRHVGETTAKLLARSYGTYEHFEKAMKAAADPAS 596

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           D W  L  +  +G+++A+AI+EFY+ PRN+  ++ L++E+ P          S +  K +
Sbjct: 597 DAWAELNSIDGIGEVVARAIIEFYKEPRNLDVIDRLIRELQPKEAEKPSTEGSPVAGKTV 656

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L+K  R +A+     LGA V+  +S+KTDI++ G   GSKL KA +LGV+ M+E+
Sbjct: 657 VFTGSLEKFTRDEAKARAESLGAKVAGSVSKKTDILVAGPGAGSKLAKATELGVQTMDED 716

Query: 713 QFLFLL 718
           ++L L+
Sbjct: 717 EWLALI 722


>gi|192292401|ref|YP_001993006.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
 gi|254781404|sp|B3QFL8|DNLJ_RHOPT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|192286150|gb|ACF02531.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
          Length = 715

 Score =  634 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 304/727 (41%), Positives = 448/727 (61%), Gaps = 27/727 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +    I  L+  +A+ EL  L  EI  HD  YYQ   P I D++YDAL+RR +AI   
Sbjct: 4   KTKPAPDIATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQK 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L  +   + P   +G        KV H++P LSL   +  +++ +F+ R+ RF +  
Sbjct: 64  FPELVNA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFVERVQRFLRLD 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           D  +I    EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L    
Sbjct: 121 DVPAI--VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKH 178

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNP-TDITRYLNFF 239
            P   E+RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L FF
Sbjct: 179 IPAACELRGEVYMLKQDFLALNKRQEEAGETVFANPRNSAAGSLRQKDVLVTASRPLKFF 238

Query: 240 VHGLGK--TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
            +  G+  T  +    Q++MLQ +   GF VN  +   ++    +++Y  +   R++LPY
Sbjct: 239 AYAWGEMSTYPMDEPTQHKMLQWLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPY 298

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVAR
Sbjct: 299 DIDGVVYKVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVAR 358

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           L+PV +GG ++ NATLHNEDYI+G+   G+ +R G DIR GD V+V+RAG+VIP++V ++
Sbjct: 359 LQPVTVGGVVVQNATLHNEDYIRGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVV 418

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           + +R   A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVS
Sbjct: 419 MQKRPAGAEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFVS 472

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R AF+I+GLG++Q++ F +       ++ PADIFTL+ R      K+E + G+G+ SV N
Sbjct: 473 RLAFDIDGLGEKQIELFHER----GWVQEPADIFTLKAR--NDQLKLEQLEGYGETSVRN 526

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH------N 591
           L+ +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +             
Sbjct: 527 LFAAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNT 586

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
           ++ +  L  +  +GD++A+A+VEF+   RNI A++ALL E++  +   +    + +  K 
Sbjct: 587 SEAYQDLDNIAGIGDVVAEAVVEFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKT 646

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E
Sbjct: 647 VVFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTE 706

Query: 712 EQFLFLL 718
           +++L L+
Sbjct: 707 DEWLALI 713


>gi|118590881|ref|ZP_01548281.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
 gi|118436403|gb|EAV43044.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
          Length = 750

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 315/714 (44%), Positives = 463/714 (64%), Gaps = 9/714 (1%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
             I+AL+ E+A+ EL  L  EI+ HD  Y+Q   P+I D++YDAL+RR  +I   FP+L 
Sbjct: 42  TDIDALTQEEAQVELKRLAAEIAEHDRRYHQEDAPVISDADYDALRRRNASIEARFPNLI 101

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD-NS 125
                +GP  ++G        K+TH +P LSL+  +N +D+R F+ R+ RF +      +
Sbjct: 102 LD---DGPSAQVGAAPASGFGKITHRVPMLSLDNAFNDDDVRDFVGRVRRFLKYDPLMGA 158

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           +  T EPKIDG  +++RYE G  VYAA RGDG +GE+V+   + I  IP  LS  +P+++
Sbjct: 159 LAVTAEPKIDGLSLSLRYENGTLVYAATRGDGTTGENVTENAKTIKDIPEKLSGTVPDVV 218

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++  DF ALN+ M A G K +ANPRNAA+G LR+L      +R L FF +  G
Sbjct: 219 EVRGEVYMAHKDFQALNERMAANGGKVFANPRNAAAGSLRQLKSEITASRPLRFFAYAWG 278

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S +    Q+ M++++   GF +N  +R+  T   ++  Y+ ++  R+ L YDIDG+VY
Sbjct: 279 EMSALPEDTQFGMVKQLEAWGFQINPLMRRCETVEELLGVYHGIEESRAQLDYDIDGVVY 338

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ++LG  +RSPRW I+HKF  +QA T L DI+IQ+GRTG LTPVA+LEP+ +G
Sbjct: 339 KVDRLDLQERLGFVSRSPRWAIAHKFPAEQAYTVLNDIEIQVGRTGALTPVAKLEPITVG 398

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYIKG+   G+ +RGG+D+R+GD V ++RAG+VIP++VDI +++R   
Sbjct: 399 GVVVSNATLHNEDYIKGIGQDGEPIRGGKDLRIGDTVKIQRAGDVIPQIVDIDLDKRPEG 458

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+ F FP+ CP C S  VR+   KTG+  A  RCTGGL C AQ  E+LKHFVSR+AF+IE
Sbjct: 459 AEAFEFPTICPACGSHAVREEKEKTGRRDAVRRCTGGLICPAQATEKLKHFVSRNAFDIE 518

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           G G +Q+D F+K       +  PADIFTL+ R + S TK+ N  G+G VS  NL+++IN 
Sbjct: 519 GFGDKQVDAFYKE----GLVMAPADIFTLEERDKRSLTKLRNREGWGAVSAKNLFEAINA 574

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR I L RFIF+LGIRHVG   A+ LA+ Y S+  F   +       ++ W  L  +  +
Sbjct: 575 RREIDLHRFIFALGIRHVGEGNAKLLARAYGSWAAFYAAMKAAHDTESEAWAELNDIDGI 634

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G I+A+A+ EF+    N+  ++ALL EVSP          S +  K +VFTG+L+++ R 
Sbjct: 635 GHIVAEALAEFFAEQHNLDQLDALLVEVSPKDAEKINASGSPVAGKTVVFTGSLERMTRD 694

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +A+    + GA  +  +S+KTD+++ G   GSKL+KAQ+L +++++E+ +  L+
Sbjct: 695 EAKAMAERFGAKTAGSVSKKTDLVVAGPGAGSKLKKAQELEIEVISEDDWFDLV 748


>gi|116253034|ref|YP_768872.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. viciae
           3841]
 gi|123261370|sp|Q1ME47|DNLJ_RHIL3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115257682|emb|CAK08780.1| putative DNA ligase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 718

 Score =  632 bits (1629), Expect = e-179,   Method: Composition-based stats.
 Identities = 344/720 (47%), Positives = 494/720 (68%), Gaps = 6/720 (0%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M       ++ L+IE+A  EL+ L +EI++HD  Y+   +P I D++YDALKRR DA+  
Sbjct: 1   MPTEGST-VDTLTIEEAAAELARLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEV 59

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L R    + P   +G   +++   V H+ P LSL+  ++ ED++ F+  +YRF  +
Sbjct: 60  RFPELIRE---DSPSRHVGAAPSVTFSPVVHARPMLSLDNTFSQEDVQDFVAGVYRFLGR 116

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             D SI FT EPKIDG  ++IRYE G+ V AA RGDG +GE+V+A IR I  IP  L   
Sbjct: 117 LPDQSIAFTAEPKIDGLSMSIRYENGRLVTAATRGDGTTGENVTANIRTIAEIPNELPKG 176

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P ++E+RGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF
Sbjct: 177 VPAVVEIRGEVYMAKSDFLALNRQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFF 236

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ SE+ A  Q+ M+Q  +  GFPVN  +++ N+   I+++Y+E+   R  L YDI
Sbjct: 237 AYAWGEMSEMPADTQFGMVQTFKDWGFPVNPLMKRLNSVADILAHYDEIGLERPDLDYDI 296

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD   LQ +LG R+RSPRW  +HKF  +QA T + +IDIQ+GRTG LTPVARL 
Sbjct: 297 DGVVYKVDSLELQARLGFRSRSPRWATAHKFPAEQAFTIVENIDIQVGRTGALTPVARLT 356

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRG-GRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           P+ +GG ++TNATLHN DYI+G+  SG+ +R    DIR+GD V+V+RAG+VIP+V+D+++
Sbjct: 357 PITVGGVVVTNATLHNADYIQGIGNSGERIRDDEHDIRIGDTVIVQRAGDVIPQVLDVVM 416

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
            +R  +A+P+ FP  CP+C S  VR+ + KTGKL +  RCTGG  C AQ  E LKHFVSR
Sbjct: 417 EKRPAEARPYEFPKTCPVCGSHAVRERHEKTGKLDSVTRCTGGFICRAQATEHLKHFVSR 476

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
           +AF+IEGLG +Q+DFFF++ED +  IR   DIFTL++RQQ S TK+ENI GFG VSV  L
Sbjct: 477 NAFDIEGLGSKQIDFFFENEDASLQIRTAPDIFTLEKRQQQSLTKLENIDGFGKVSVGKL 536

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           Y +I++RR+I+L RFI++LGIRHVG   A+ LA+ Y +Y+ F   +    A + D W  L
Sbjct: 537 YGAIDERRSIALHRFIYALGIRHVGETTAKLLARSYGTYEAFETAMREAEALSGDAWNDL 596

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +G+++A+AIVEFY+ PRN+  +  LL+EV+P      K   S +  K +VFTG+L
Sbjct: 597 NAIEGIGEVVARAIVEFYKEPRNVEVITRLLEEVTPEEAEQPKTAGSPVAGKTVVFTGSL 656

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+     LGA V+  +S+KTDI++ G   GSKL+KA++LGV+ M+E+Q+L L+
Sbjct: 657 EKLTRDEAKARAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGVQTMDEDQWLALI 716


>gi|182677699|ref|YP_001831845.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|254781257|sp|B2IGH4|DNLJ_BEII9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|182633582|gb|ACB94356.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 699

 Score =  631 bits (1626), Expect = e-178,   Method: Composition-based stats.
 Identities = 300/714 (42%), Positives = 452/714 (63%), Gaps = 21/714 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PIE+LS  QA++E   L ++I+ HD  YYQ   P + D+EYDAL+RR +A+  AFP+L  
Sbjct: 6   PIESLSPAQAKREHRRLGEQITEHDRLYYQEDAPRVSDAEYDALRRRYEALETAFPELVS 65

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +E       KIG        K+ H +P LSL  I++ E++ +F+ R+ RF     D  + 
Sbjct: 66  AE---SLTKKIGAAPAEKFAKIIHKVPMLSLANIFSDEEVGEFVARVRRFLGLGADAPLA 122

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            + EPKIDG   ++RYE G  V AA RGDG+ GEDV+A +R I  IP  L  + PEI+EV
Sbjct: 123 ISAEPKIDGLSCSLRYEGGYLVQAATRGDGYEGEDVTANVRTIQEIPHQLQGHAPEILEV 182

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY++  DF ALN+   A G+  +ANPRN+A+G LR+L+P     R L+FF +  G+ 
Sbjct: 183 RGEVYMTHADFAALNERQEAAGKTIFANPRNSAAGSLRQLDPKVTAGRPLHFFAYAWGEA 242

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A  Q  M+   +  G PVN  ++  ++   ++++Y+++++ R+ L YDIDG+VYKV
Sbjct: 243 SEEPADTQMGMVTAFKAFGLPVNPLMQLCHSAEDLIAHYHDIEARRALLDYDIDGVVYKV 302

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +  +LQK+LG  +R+PRW  +HKF  ++A T L DI+IQ+GRTG LTPVARLEP+ +GG 
Sbjct: 303 NSIALQKRLGFVSRAPRWATAHKFPAEKAVTLLRDIEIQVGRTGALTPVARLEPITVGGV 362

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           +++NATLHNED I             +DIR+GD V+++RAG+VIP+++  I+++R  DAQ
Sbjct: 363 VVSNATLHNEDEIAR-----------KDIRIGDMVMIQRAGDVIPQILGPILDKRPQDAQ 411

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP+C S  +R+++PKTG      RCTGGL C+AQ +ERLKHF SR+AF+IEGL
Sbjct: 412 PYEFPQVCPVCGSAAIREIDPKTGTADVVRRCTGGLVCAAQVVERLKHFASRNAFDIEGL 471

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++ F+        I  P DIFTLQ R   S  K+++  G+G+ SV NL+ +I  RR
Sbjct: 472 GDKQIEQFYHD----GLIHTPVDIFTLQERDARSLKKLKDREGYGETSVRNLFQAIEARR 527

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I + RFI++LGIRHVG   AR  A+ + ++      + +     +++   L  V   G 
Sbjct: 528 HIPVNRFIYALGIRHVGETNARRAARAFGTFDALR-AVASRAEEGSEERSELTNVEGFGP 586

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AI +F+    N   ++ LL++V+P          S +  K +VFTG L+ + R +A
Sbjct: 587 VVAEAIFDFFHEQHNQDVLDGLLEQVTPEP-MEAVAKESPVAGKTVVFTGALEHMTREEA 645

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +    +LGA V+  +S+KTD+++ G   GSKL KA +L ++ ++EE +L L+ +
Sbjct: 646 KAQAERLGAKVAGSVSKKTDLVVAGPGAGSKLAKAAELNIETISEEDWLKLVGE 699


>gi|254470147|ref|ZP_05083551.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
 gi|211960458|gb|EEA95654.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
          Length = 722

 Score =  631 bits (1626), Expect = e-178,   Method: Composition-based stats.
 Identities = 317/716 (44%), Positives = 466/716 (65%), Gaps = 5/716 (0%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
            IEAL+ E+A  EL  L + I+ +D+ Y+    PI+ D+ YD L+RR  A+   FP+L R
Sbjct: 10  DIEALNAEEAALELERLARLIAEYDEAYHTQDAPIVDDATYDGLRRRNAALEAKFPELVR 69

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD-NSI 126
           +   + P N++GG +     K+TH++P LSL+  ++ ED++ FI ++ RF +      ++
Sbjct: 70  A---DSPSNRVGGAVAEGFGKITHAVPMLSLDNAFSDEDVQDFIGKVRRFLKYDPLMGAL 126

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T EPKIDG  +++RYE GK VYAA RGDG +GE+V+A    I  IP+ L   +P+++E
Sbjct: 127 AVTAEPKIDGLSLSLRYESGKLVYAATRGDGATGENVTANALTIQDIPQELPAGVPDVVE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF ALN  M A G K +ANPRNAA+G LR+LNP    TR L FF +  G 
Sbjct: 187 VRGEVYMSHADFAALNARMEANGGKVFANPRNAAAGSLRQLNPEITKTRPLKFFAYAWGD 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+ A  Q  M++     GF +N  +++  T   ++  Y+ ++  RS L YDIDG+VYK
Sbjct: 247 MSEVPADTQMGMVELFGAWGFQINPLMKRCETVEALLKVYHGIEEDRSGLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ +LG  +RSPRW I+HKF  ++A T L  I+IQ+GRTG LTPVA+LEPV +GG
Sbjct: 307 VDRLDLQGRLGFVSRSPRWAIAHKFPAERAFTTLNAIEIQVGRTGALTPVAKLEPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKG+   G+ +R  +D+RVGD V+++RAG+VIP++VD+ +++R  D 
Sbjct: 367 VVVSNATLHNEDYIKGIGQDGESIRDSKDLRVGDTVIIQRAGDVIPQIVDVDLSKRAEDV 426

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           QP+ FP+ CP+C S  +R+ NP +GK+ A  RCTGGL C AQ +E+LKHFVSR+AF+IEG
Sbjct: 427 QPYEFPTECPVCNSHAIRETNPNSGKVDAVRRCTGGLICPAQAVEKLKHFVSRNAFDIEG 486

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q++ F++ +     IR PADIFTL  R + S  K+ +  GFG VS   L+++I+ +
Sbjct: 487 LGEKQMEAFYEYDMDKGGIRTPADIFTLAERDKVSLNKLRSREGFGAVSARKLFEAIDSK 546

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L R IF LGIRHVG   A+ LA+ Y S+Q F   +       ++ +  L  +  +G
Sbjct: 547 RQIELNRVIFGLGIRHVGEGNAKLLARAYSSWQGFYDAMIAATDTTSEAYRELNDIDGIG 606

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             +A A+VEF+    N+ A+ AL+++++P          S +  K LVFTG+L+++ R +
Sbjct: 607 GTVANALVEFFAEEHNLTALAALMEQITPLDVVVADTSGSPVAGKTLVFTGSLERMSRDE 666

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           A+     LGA VS  +S+KTD++I G   GSKL KAQ LG+ +++E+ +  L+   
Sbjct: 667 AKARAESLGAKVSGSVSKKTDLVIAGPKAGSKLTKAQSLGIDVISEDDWFELVGDQ 722


>gi|316933200|ref|YP_004108182.1| NAD-dependent DNA ligase [Rhodopseudomonas palustris DX-1]
 gi|315600914|gb|ADU43449.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris DX-1]
          Length = 715

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 305/728 (41%), Positives = 450/728 (61%), Gaps = 27/728 (3%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           +KK     I  L+  +A+ EL  L   I  HD  YYQ   P I D++YDAL+RR +AI  
Sbjct: 3   VKKNPAPDIATLTKAKAKVELMRLRLVIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQ 62

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L      + P   +G        KV H++P LSL   +  +++ +F  R+ RF + 
Sbjct: 63  KFPELV---SASSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKL 119

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
            D  +I    EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L   
Sbjct: 120 DDVPAI--VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGK 177

Query: 181 I-PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNF 238
             P   E+RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L F
Sbjct: 178 HIPAACELRGEVYMLKQDFLALNKRQEEAGETVFANPRNSAAGSLRQKDVAVTASRPLKF 237

Query: 239 FVHGLGKT--SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLP 296
           F +  G+     +    Q++MLQ +  +GF VN  +R  +T   I+++Y E+   R++LP
Sbjct: 238 FAYAWGEMSDYPMEEPTQHKMLQWLDHVGFVVNPLIRPCHTVEEILAFYREIGEQRASLP 297

Query: 297 YDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVA 356
           YDIDG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVA
Sbjct: 298 YDIDGVVYKVDRLDYQERLGFISRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVA 357

Query: 357 RLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDI 416
           RL+PV +GG ++ NATLHNEDYIKG+   G  +R G DIR GD V+V+RAG+VIP++V +
Sbjct: 358 RLQPVTVGGVVVQNATLHNEDYIKGIGNDGSPLRDGVDIREGDTVVVQRAGDVIPQIVSV 417

Query: 417 IVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFV 476
           ++++R   A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFV
Sbjct: 418 VLDKRPAGAEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFV 471

Query: 477 SRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVT 536
           SR AF+I+GLG++Q++ F +       ++ PADIFTL+ R   +  K+E + G+G+ SV 
Sbjct: 472 SRLAFDIDGLGEKQIELFHER----GWVQEPADIFTLKAR--NAELKLEQLEGYGETSVR 525

Query: 537 NLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH------ 590
           NL+ +I+ RR I L R +F+LGIRHVG   A+ LA++Y +   F   +            
Sbjct: 526 NLFAAIDARRTIELHRLVFALGIRHVGEGNAKLLARHYGTLDAFLTAMRAAADAQTEEGN 585

Query: 591 NNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENK 650
            ++ +  L  +  +GD++A+A+VEF+   RN+ A++ALL E++  +   +    + +  K
Sbjct: 586 TSEAYQDLDNIAGIGDVVAEAVVEFFAEERNVKALDALLAELTEVLPAEQARRDTAVAGK 645

Query: 651 KLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
            +VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ 
Sbjct: 646 TVVFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLT 705

Query: 711 EEQFLFLL 718
           E+++L L+
Sbjct: 706 EDEWLALI 713


>gi|166216284|sp|Q6N423|DNLJ_RHOPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score =  629 bits (1623), Expect = e-178,   Method: Composition-based stats.
 Identities = 302/727 (41%), Positives = 448/727 (61%), Gaps = 27/727 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +    I  L+  +A+ EL  L  EI  HD  YYQ   P I D++YDAL+RR +AI   
Sbjct: 4   KTKPAPDIATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQK 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L  +   + P   +G        KV H++P LSL   +  +++ +F  R+ RF +  
Sbjct: 64  FPELVNA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKLD 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           D  +I    EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L    
Sbjct: 121 DVPAI--VAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKH 178

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P   E+RGEVY+ K DFLALN          +ANPRN+A+G LR+ + T   +R L FF
Sbjct: 179 IPATCELRGEVYMLKQDFLALNKRQEEANETVFANPRNSAAGSLRQKDVTVTASRPLKFF 238

Query: 240 VHGLGKT--SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
            +  G+     +    Q++MLQ +   GF VN  +   ++    +++Y  +   R++LPY
Sbjct: 239 AYAWGEMSDYPMEEPTQHKMLQWLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPY 298

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVAR
Sbjct: 299 DIDGVVYKVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVAR 358

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           L+PV +GG ++ NATLHNEDYIKG+   G+ +R G DIR GD V+V+RAG+VIP++V ++
Sbjct: 359 LQPVTVGGVVVQNATLHNEDYIKGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVV 418

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           + +R   A+P+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVS
Sbjct: 419 MEKRPAGAEPYHFPHKCPVCGSHAVREEGE------AVWRCTGALICPAQAVERLKHFVS 472

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R AF+I+GLG++Q++ F +       ++ PADIFTL+ R   +  K+E + G+G+ SV N
Sbjct: 473 RLAFDIDGLGEKQIELFHER----GWVQEPADIFTLKAR--NAELKLEQLEGYGETSVRN 526

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH------N 591
           L+ +I+ RR+I L R +F+LGIRHVG   A+ LA++Y +   F   +             
Sbjct: 527 LFAAIDARRSIELHRLVFALGIRHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNT 586

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
           ++ +  L  +  +GD++A+A+VEF+   RNI A++ALL E++  +   +    + +  K 
Sbjct: 587 SEAYQDLDNIAGIGDVVAEAVVEFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKT 646

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E
Sbjct: 647 VVFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTE 706

Query: 712 EQFLFLL 718
           +++L L+
Sbjct: 707 DEWLALI 713


>gi|75675255|ref|YP_317676.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
 gi|123773282|sp|Q3STR7|DNLJ_NITWN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|74420125|gb|ABA04324.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
          Length = 716

 Score =  629 bits (1621), Expect = e-178,   Method: Composition-based stats.
 Identities = 307/726 (42%), Positives = 459/726 (63%), Gaps = 22/726 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +   P+++L+  QAR E   L  EI  H++ YYQ   P + D+ YDAL+RR +AI   
Sbjct: 4   KSKTPPPVDSLTRSQARVEHKRLALEIETHNERYYQQDAPTVSDATYDALQRRLEAIEAR 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FPDL  +   + P   +G        KV H++P LSL   ++  ++ +F+ RI RF +  
Sbjct: 64  FPDLVTA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDAEVAEFVERIRRFLKLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
            D+      EPKIDG  +++RYE G  V AA RGDG +GEDV+A +R I  +P  L+ + 
Sbjct: 121 ADDMPAIVAEPKIDGLSLSLRYENGDLVRAATRGDGFTGEDVTANVRTIADVPHKLNGHN 180

Query: 182 PEI-IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
                E+RGEVY+ K DFLALN +    G   +ANPRN+A+G LR+ + +   +R L FF
Sbjct: 181 IPTACELRGEVYMLKEDFLALNKKQQEAGDTVFANPRNSAAGSLRQKDVSITASRPLKFF 240

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ ++  A+ Q +ML+ +R +GF VN  ++  ++   ++++Y  +   R+TL YDI
Sbjct: 241 AYAWGEMTDRPAETQNDMLEWLRDVGFIVNPLIQLCHSVDEVLAFYRRIGEQRATLGYDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG +TPVARLE
Sbjct: 301 DGVVYKVDRLDWQERLGFVSRSPRWAIAHKFAAEQAMTILRGIDIQVGRTGAMTPVARLE 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ NATLHNEDYI+GL   G+ +R G D+R+GD V+V+RAG+VIP+VV +I+ 
Sbjct: 361 PVTVGGVVVQNATLHNEDYIRGLGNDGQPIRDGIDLRIGDTVVVQRAGDVIPQVVSVIIE 420

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  +A+ + FP  CPIC S  VR+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 421 KRPANAKRYEFPDRCPICGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRL 474

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+  F+        +  P DIFTLQ R   +  K+ +  G+GDVSV NL+
Sbjct: 475 AFDIDGLGEKQIQEFYDD----GLVMHPVDIFTLQERDARAENKLRDRDGYGDVSVRNLF 530

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNND 593
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y S ++F   +    A      ++++
Sbjct: 531 AAIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGSIESFRSAMTEAAAAQTEAGNDSE 590

Query: 594 DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  +GDI+A A+VEF+  PRN+ A+  LL+E+   +   +    S +  K +V
Sbjct: 591 AYADLTNIGGIGDIVADAVVEFFAEPRNVKALNDLLEEIEV-LPVAQARSDSAVAGKTVV 649

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L+K  R +A+    ++GA  S+ +S+KTD+++ G   GSKL+ A++ GVK+++E++
Sbjct: 650 FTGSLEKFTRDEAKASAERVGAKTSSSVSKKTDLVVAGPGAGSKLKDAEKFGVKVISEDE 709

Query: 714 FLFLLQ 719
           +L L++
Sbjct: 710 WLKLIE 715


>gi|154252874|ref|YP_001413698.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
 gi|190359267|sp|A7HVV8|DNLJ_PARL1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154156824|gb|ABS64041.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
          Length = 710

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 304/712 (42%), Positives = 448/712 (62%), Gaps = 21/712 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
            ++ L++E+A +EL  L  EI  HD  YYQ   P I D+EYD L+RR +AI   +P+L R
Sbjct: 16  DVDHLTLEEAPEELERLAAEIEKHDKLYYQKDAPRISDAEYDTLRRRNEAIEARYPELVR 75

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P +++G +      KV H +P LSL   ++ ED+R F  RI RF   K+++ + 
Sbjct: 76  E---DSPSHRVGAQPADGFGKVVHKVPMLSLSNAFDDEDVRDFALRIRRFLNLKEEDILP 132

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIE 186
            T EPKIDG    +RYEKGKFV  A RGDG  GE+V+  ++ I  IP  L     P+++E
Sbjct: 133 ITAEPKIDGLSAALRYEKGKFVMGATRGDGREGENVTENLKTIGDIPAELKGKNIPDVVE 192

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF ALN+     G+  +ANPRNAA+G LR+L+     +R L FF +  G+
Sbjct: 193 VRGEVYMSHEDFAALNERQREAGKPVFANPRNAAAGSLRQLDAKITASRPLRFFAYTWGE 252

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++ A  Q  ++   R  GF VN    + +T   ++ +Y++++  R+TL YDIDG+VYK
Sbjct: 253 MSDLPADTQSGVMDAFRKWGFTVNPLFGRCDTVEALIDFYHDIEERRATLGYDIDGVVYK 312

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q +LG  +RSPRW ++HKF  +QA T L  I+IQ+GRTG LTPVARL PV +GG
Sbjct: 313 VDRLDWQNRLGFVSRSPRWALAHKFPAEQAMTVLEKIEIQVGRTGALTPVARLTPVTVGG 372

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHN D I+ L            +R GD V+V+RAG+VIP++V ++  +R    
Sbjct: 373 VVVSNATLHNADEIERL-----------GVRPGDTVVVQRAGDVIPQIVRVV-EDRPRGK 420

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + F FP  CP C S  VR++NPKTGKL A  RCTGGL C AQ +ERL+HFVSR+AF+IEG
Sbjct: 421 KKFVFPDTCPECGSHAVREVNPKTGKLDAVARCTGGLVCPAQAVERLRHFVSRNAFDIEG 480

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q+  FF+       I+ P DIFTL  R   S  K+++  G+G  S   L+D+I+ R
Sbjct: 481 LGEKQIAAFFED----GLIKKPDDIFTLAARDAKSLKKLKDREGWGATSARKLFDAIDAR 536

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R + L+RFIF LGIRHVG   AR LA+ Y +  +F +++       ++ +  L+ +  VG
Sbjct: 537 REVELDRFIFGLGIRHVGETNARLLARSYGTLDHFEEQMRAAADREDEAYAELLSIDGVG 596

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +++A++IV+F+    N   ++ L +     +   ++  SS +  K +VFTG+L+K+ R +
Sbjct: 597 EVLAESIVDFFAEKHNREVLDGLREAGVKGVPLPKQETSSPVAGKTVVFTGSLEKMTRSE 656

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           A+    QLGA V+  +S KTDI++ G + GSKL KA++LG++I++E+Q++ L
Sbjct: 657 AKARAEQLGAKVAGSVSAKTDILVAGADAGSKLAKARELGIEILDEDQWIEL 708


>gi|166216283|sp|Q07PR9|DNLJ_RHOP5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 307/727 (42%), Positives = 453/727 (62%), Gaps = 25/727 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + +  +  L+  +A+ EL  L  EI  HD  YYQ   P + D++YDAL+RR + I H 
Sbjct: 4   KSKTVPDVATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHK 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L        P  K+G        KV H++P LSL   ++ +++ +F+ R+ RF    
Sbjct: 64  FPELVSGA---SPSQKVGAAPARGFAKVQHAVPMLSLGNAFSDDEVAEFLQRVRRFLNLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           D+       EPKIDG  +++RYE+G+ V AA RGDG  GEDV+A +R +  IP  L  N 
Sbjct: 121 DEIP-AIVAEPKIDGLSLSLRYEQGELVRAATRGDGSVGEDVTANVRTLKDIPHTLKGNR 179

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P   E+RGEVY+ K+DFLALN +    G  P+ANPRN+A+G LR+ +     +R L FF
Sbjct: 180 IPAACELRGEVYMLKSDFLALNKKQEEAGEAPFANPRNSAAGSLRQKDVAITASRPLKFF 239

Query: 240 VHGLGKTSEIFA-KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S     + Q++ML  +   GF VN  +   ++    + +Y  +   R+ LPYD
Sbjct: 240 AYAWGEFSGETPERTQHDMLGWLDHAGFVVNPEITLCHSVDDALVFYRRIGEERAALPYD 299

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q +LG   R+PRW I+HKFA +QA+T L  I+IQ+GRTG LTPVARL
Sbjct: 300 IDGVVYKVDRLDWQARLGFAGRAPRWAIAHKFAAEQATTILEKIEIQVGRTGALTPVARL 359

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG ++ NATLHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP+VVD+++
Sbjct: 360 APVTVGGVVVQNATLHNEDYIKGVGNDGQPLREGRDIRVGDTVIIQRAGDVIPQVVDVVL 419

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R  DA P+ FP  CP+C S  VR+            RCTG L C AQ +ERLKHFVSR
Sbjct: 420 DKRPADAVPYEFPQACPVCGSHAVREDGE------VVRRCTGALICPAQAVERLKHFVSR 473

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q++ F +       ++ P DIFTL  + + +T K+E + G+G+ SV NL
Sbjct: 474 LAFDIDGLGEKQIELFHER----GWVKEPVDIFTL--KTRNATLKLEELEGYGETSVRNL 527

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNN 592
           + +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +    A      + +
Sbjct: 528 FAAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTIDAFLGAMRAAAAGQTEEGNTS 587

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           + +  L  +  +GDI+A+A+VEF+   RN+ A++ALL E+   +   +    S +  K +
Sbjct: 588 EAYQDLDNIGGIGDIVAEAVVEFFAEERNVEALDALLGELDEVLPAAQVKRDSAVAGKTV 647

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA++LGV +++E+
Sbjct: 648 VFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDFVVAGEDAGSKLTKARELGVSVLSED 707

Query: 713 QFLFLLQ 719
           ++L L+Q
Sbjct: 708 EWLALIQ 714


>gi|115524134|ref|YP_781045.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
 gi|115518081|gb|ABJ06065.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
          Length = 730

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 307/727 (42%), Positives = 453/727 (62%), Gaps = 25/727 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + +  +  L+  +A+ EL  L  EI  HD  YYQ   P + D++YDAL+RR + I H 
Sbjct: 19  KSKTVPDVATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHK 78

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L        P  K+G        KV H++P LSL   ++ +++ +F+ R+ RF    
Sbjct: 79  FPELVSGA---SPSQKVGAAPARGFAKVQHAVPMLSLGNAFSDDEVAEFLQRVRRFLNLG 135

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           D+       EPKIDG  +++RYE+G+ V AA RGDG  GEDV+A +R +  IP  L  N 
Sbjct: 136 DEIP-AIVAEPKIDGLSLSLRYEQGELVRAATRGDGSVGEDVTANVRTLKDIPHTLKGNR 194

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P   E+RGEVY+ K+DFLALN +    G  P+ANPRN+A+G LR+ +     +R L FF
Sbjct: 195 IPAACELRGEVYMLKSDFLALNKKQEEAGEAPFANPRNSAAGSLRQKDVAITASRPLKFF 254

Query: 240 VHGLGKTSEIFA-KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S     + Q++ML  +   GF VN  +   ++    + +Y  +   R+ LPYD
Sbjct: 255 AYAWGEFSGETPERTQHDMLGWLDHAGFVVNPEITLCHSVDDALVFYRRIGEERAALPYD 314

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q +LG   R+PRW I+HKFA +QA+T L  I+IQ+GRTG LTPVARL
Sbjct: 315 IDGVVYKVDRLDWQARLGFAGRAPRWAIAHKFAAEQATTILEKIEIQVGRTGALTPVARL 374

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
            PV +GG ++ NATLHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP+VVD+++
Sbjct: 375 APVTVGGVVVQNATLHNEDYIKGVGNDGQPLREGRDIRVGDTVIIQRAGDVIPQVVDVVL 434

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R  DA P+ FP  CP+C S  VR+            RCTG L C AQ +ERLKHFVSR
Sbjct: 435 DKRPADAVPYEFPQACPVCGSHAVREDGE------VVRRCTGALICPAQAVERLKHFVSR 488

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q++ F +       ++ P DIFTL  + + +T K+E + G+G+ SV NL
Sbjct: 489 LAFDIDGLGEKQIELFHER----GWVKEPVDIFTL--KTRNATLKLEELEGYGETSVRNL 542

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNN 592
           + +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +    A      + +
Sbjct: 543 FAAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTIDAFLGAMRAAAAGQTEEGNTS 602

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           + +  L  +  +GDI+A+A+VEF+   RN+ A++ALL E+   +   +    S +  K +
Sbjct: 603 EAYQDLDNIGGIGDIVAEAVVEFFAEERNVEALDALLGELDEVLPAAQVKRDSAVAGKTV 662

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTG+L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA++LGV +++E+
Sbjct: 663 VFTGSLSKFTRDEAKAAAERLGAKVAGSVSKKTDFVVAGEDAGSKLTKARELGVSVLSED 722

Query: 713 QFLFLLQ 719
           ++L L+Q
Sbjct: 723 EWLALIQ 729


>gi|254488738|ref|ZP_05101943.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
 gi|214045607|gb|EEB86245.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
          Length = 706

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 303/716 (42%), Positives = 441/716 (61%), Gaps = 15/716 (2%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
           + I ++ LS +QA +EL  L   ++  +  YY    P I D+EYD LKRR   I   FP 
Sbjct: 3   EHIAVQDLSKDQAAEELRRLSGLLAQANRQYYAEDAPQISDAEYDCLKRRNTEIETRFPS 62

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           L R+   + P  +IG   +    KV H +P LSL   +  ED+ +F  RI ++     D 
Sbjct: 63  LKRA---DSPTEQIGATPSEGFSKVRHEVPMLSLGNAFEDEDVVEFDGRIRKYLGLPSDA 119

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
            + FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A  R I TIP+ L  + P++
Sbjct: 120 DLDFTAEPKIDGLSLSLRYENGLLVQAATRGDGAVGENVTANARTIQTIPKKL-DSAPDV 178

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGL 243
           IE+RGEVY+S +DF ALN      G K +ANPRNAA+G LR+L+     +R L FF +  
Sbjct: 179 IEIRGEVYMSHDDFDALNARQGERGGKLFANPRNAAAGSLRQLDAEITRSRPLKFFAYAW 238

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G  SE   + Q E +++M  +GF  N      ++   ++  Y ++++ R+TL YDIDG+V
Sbjct: 239 GALSEPLGQTQSEAIKRMENMGFCTNPLTELCSSVAEMIDQYRKIEAQRATLGYDIDGVV 298

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKV++ +LQ++LG R+ +PRW I+HKF  + A T L DI IQ+GRTG L+PVARL+PV +
Sbjct: 299 YKVNDLALQERLGFRSTTPRWAIAHKFPAELAWTTLEDITIQVGRTGALSPVARLKPVTV 358

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG +++NATLHNEDYIKG+D+ G  +R G+DIRVGD V V RAG+VIPK+ D+ ++ R  
Sbjct: 359 GGVVVSNATLHNEDYIKGVDSKGNQIRDGKDIRVGDWVQVYRAGDVIPKIADVDLSRRPS 418

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
           D+ PF FP+ CP C S  +R+         A  RC GGL C AQ +E+LKHFVSR AF+I
Sbjct: 419 DSVPFDFPTICPECGSDAIREEG------DAVRRCMGGLVCPAQAVEKLKHFVSRAAFDI 472

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           +GLG +Q++ F+        I  PADIFTLQ R  +   +++N  G+G+ S T L+ +I+
Sbjct: 473 DGLGAKQVEQFYTD----GWIAEPADIFTLQARYGSGVQQLKNREGWGEKSATKLFQAID 528

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
            +R I L R IF+LGIRHVG   +  +A +Y ++  F   + N    +   W  LI V  
Sbjct: 529 DKRTIPLARLIFALGIRHVGEAASNLIALHYGTWSAFITAMENAREASGPAWDDLISVDG 588

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           VG ++AQ++V  +       +++ L+ E+S           S ++ K +VFTGTL+K+ R
Sbjct: 589 VGQVMAQSLVSTFAQEAERASIDRLVAELSIQDATRPDTQGSPVDGKTVVFTGTLEKMTR 648

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            +A+    +LGA VS  +S KTDI++ G   GSK +KA +LG++I++E+ +L L+ 
Sbjct: 649 AEAKARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAAELGIEILDEDAWLDLIA 704


>gi|254719452|ref|ZP_05181263.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|265984457|ref|ZP_06097192.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306839229|ref|ZP_07472046.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
 gi|264663049|gb|EEZ33310.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306405776|gb|EFM62038.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
          Length = 719

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 340/724 (46%), Positives = 476/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYEDGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPSVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLALNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ +R  D
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDVVLEKRSAD 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 AVPFQFPHECPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA SIR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALSIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|217979603|ref|YP_002363750.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
 gi|254781370|sp|B8ETN6|DNLJ_METSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|217504979|gb|ACK52388.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
          Length = 700

 Score =  621 bits (1601), Expect = e-175,   Method: Composition-based stats.
 Identities = 299/715 (41%), Positives = 447/715 (62%), Gaps = 22/715 (3%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           PI+A+++ QAR+E S L  EI+ HD  YY+   P + D+EYD L+RR   +  AFP+LA 
Sbjct: 5   PIDAMTLAQARREHSRLGAEIAAHDARYYREDAPTVSDAEYDRLRRRYGELESAFPELA- 63

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
              P+    K+G   +    K+ H IP LSL  +++  ++  F+ R+ RF     + S+ 
Sbjct: 64  --SPDSLTKKVGAAPSEKFAKIRHRIPMLSLGNVFSEAEVEDFVARVRRFLGLPTEASLA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG   ++R+E G+FV AA RGDG  GEDV+A +R I  IP  L    PE++EV
Sbjct: 122 ITAEPKIDGLSCSLRFENGEFVQAATRGDGFEGEDVTANVRTIAEIPARLKGEPPEVLEV 181

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY++  DF A+N      G+  +ANPRNAA+G LR+L+P     R L+FF +  G+ 
Sbjct: 182 RGEVYMTHADFAAMNVRQQEAGKPLFANPRNAAAGSLRQLDPNITAGRPLHFFAYAWGEI 241

Query: 247 -SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
                A  Q  M+   +  G PVN  +   ++   +++ Y  ++  R+ L YDIDG+VYK
Sbjct: 242 LPAPPAGTQMGMVAAFKSYGLPVNPLMVLCHSAEELIAKYRSIEEKRAALGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ++LG  +RSPRW ++HKF  +QA+T L DI+IQ+GRTG LTPVARL+PV +GG
Sbjct: 302 VDSLVLQERLGFVSRSPRWAVAHKFPAEQATTVLRDIEIQVGRTGALTPVARLDPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             + NATLHNED I             +D+R+GD V ++RAG+VIP+V+ +++N+R  +A
Sbjct: 362 VTVANATLHNEDEIAR-----------KDVRIGDTVRIQRAGDVIPQVLGVVLNKRPAEA 410

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +P+ FP  CPIC S  +R+++ KTG      RCTGGL C AQ +ERLKHF SR+A +IEG
Sbjct: 411 KPYVFPDHCPICGSAAIREIDEKTGVADVVRRCTGGLICPAQAIERLKHFASRNALDIEG 470

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F+        I  PADIFTL+ R + +  K+++  G+G+ S  NL+ +I +R
Sbjct: 471 LGDKQIEQFYHD----GLITKPADIFTLEARDKAALKKLKDREGYGETSTRNLFRAIEQR 526

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R  +L RFI++LGIRHVG   AR LA+++ S+    +      A  ++    +  +  VG
Sbjct: 527 RAPALNRFIYALGIRHVGETNARRLARHFGSFSALRE-TGRAAAPGSEARAEINNIEGVG 585

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +++A+A+ +F+  P N  A++ALL  V+P     E    + +  K +VFTG L+++ R +
Sbjct: 586 EVVAEAVADFFAEPHNEEALDALLAHVNPQP-MEEIVSDTPVAGKTVVFTGALERMTRDE 644

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+    +LGA V+A +S+KTD++I G   GSKL KA +LGV+ ++EE +L L+ +
Sbjct: 645 AKAMAERLGAKVAASVSKKTDLVIAGPGAGSKLAKAAELGVETISEEDWLKLVGR 699


>gi|299131914|ref|ZP_07025109.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
 gi|298592051|gb|EFI52251.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
          Length = 706

 Score =  621 bits (1600), Expect = e-175,   Method: Composition-based stats.
 Identities = 312/725 (43%), Positives = 449/725 (61%), Gaps = 33/725 (4%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           K+ + P+E L+  QA+ EL+ L  EIS HD+ YYQ   P + D++YD L++R  AI   F
Sbjct: 6   KKAVTPVENLTKAQAKVELTRLALEISMHDERYYQKDAPTVSDADYDKLRQRLSAIEERF 65

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L      + P  K+G + + +  K+ H++P LSL   ++ ED+ +F TR+ RF     
Sbjct: 66  PELVAK---DSPSQKVGAQPSRAFAKIRHAVPMLSLGNAFSDEDVAEFATRVRRFLNLGA 122

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-I 181
           D  +    EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  +P  L    +
Sbjct: 123 DEPLVIVAEPKIDGLSLSLRYENGELVSAATRGDGFEGEDVTANVRTIKDVPHTLRGKGV 182

Query: 182 PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFV 240
           P I EVRGEVY+ + DFLALN +        +ANPRN+A+G LR+ N     +R L FF 
Sbjct: 183 PAICEVRGEVYMMREDFLALNKKQAEADDTIFANPRNSAAGSLRQKNVEVTASRPLKFFA 242

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           +  G+ SE+ A  Q+EM++ +   GF VN  +        +++YY E+++ R++LPYDID
Sbjct: 243 YAWGEMSEMPAPTQFEMVKWLHKAGFVVNPRMTLCRDVEALLTYYREIETERASLPYDID 302

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKVD    Q +LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL P
Sbjct: 303 GVVYKVDRLDWQNRLGFISRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLTP 362

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG ++ NATLHNED I             +DIR GD V+++RAG+VIP+VV ++  +
Sbjct: 363 VTVGGVVVQNATLHNEDEIAR-----------KDIREGDTVVIQRAGDVIPQVVSVVTEK 411

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  +A+ +SFP  CPIC S  VR+ +       A  RCTG L C AQ +ERLKHFVSR A
Sbjct: 412 RRKNAKSYSFPHKCPICGSHAVREEDE------AVRRCTGALICPAQAVERLKHFVSRLA 465

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           F+IEGLG +Q+  F+        I  P DIFTLQ+R   +  K+++  G+GDVSV NL+ 
Sbjct: 466 FDIEGLGDKQIQEFYDD----GLIMHPVDIFTLQKRDARAVKKLKDREGYGDVSVNNLFA 521

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNNDD 594
           +I+ RR I L R IF+LGIRHVG   A+ LA++Y S +N    +    A      + ++ 
Sbjct: 522 AIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGSIENLRAAMAEAAAAQTEEGNTSEA 581

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVF 654
           +  L  +  +GDI+A A+VEF+   RN+ A++ LL E+       +    S +  K +VF
Sbjct: 582 YADLNNIGGIGDIVADAVVEFFAEKRNVKALDELLAEIEVLPAE-QVRTDSAVAGKTVVF 640

Query: 655 TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TG+L K  R +A+    +LGA VS  +S+KTD ++ G+  GSKL KA++LGV ++ E+++
Sbjct: 641 TGSLTKFTRDEAKAQAERLGAKVSGSVSKKTDYVVAGEEAGSKLTKARELGVAVLTEDEW 700

Query: 715 LFLLQ 719
           L L++
Sbjct: 701 LKLIE 705


>gi|150397271|ref|YP_001327738.1| NAD-dependent DNA ligase LigA [Sinorhizobium medicae WSM419]
 gi|166216245|sp|A6UB73|DNLJ_SINMW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150028786|gb|ABR60903.1| DNA ligase, NAD-dependent [Sinorhizobium medicae WSM419]
          Length = 717

 Score =  621 bits (1600), Expect = e-175,   Method: Composition-based stats.
 Identities = 343/712 (48%), Positives = 488/712 (68%), Gaps = 4/712 (0%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E ++  +A +EL+ L  E+S HD  Y+    P I D++YDALKRR D I   FP L R
Sbjct: 7   PVEQMTEAEAAEELAFLAAELSRHDMLYHGKDDPEISDADYDALKRRNDLIEERFPALIR 66

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  K+G   +L+   V H+ P LSL+  ++ ED R F+  IYRF  +  D SI 
Sbjct: 67  E---DSPSQKVGAAPSLTFAPVVHARPMLSLDNSFSDEDARAFVAGIYRFLGRLPDGSIA 123

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
           FT+EPKIDG  +++RYE  + V AA RGDG +GE+V+A +R I  IP+ L    P+++E+
Sbjct: 124 FTVEPKIDGLSMSLRYENRRLVTAATRGDGTTGENVTANVRTIGMIPQRLPAEAPDVVEI 183

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGE+Y++K+DF ALN EM A GR  Y NPRN ASG LR+L+     +R L FF +  G+ 
Sbjct: 184 RGEIYMAKSDFAALNAEMAAQGRPLYVNPRNTASGSLRQLDAKVTASRRLRFFAYAWGEM 243

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S + A  Q  M++  +  GFPVN  +++  +   ++ +Y+ ++  R  L YDIDG+VYKV
Sbjct: 244 SAMPADTQLGMVETFKAWGFPVNPLMQRFFSADELLEHYHHIERERPELDYDIDGVVYKV 303

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+  LQ +LG R+RSPRW  +HKF  ++A TRL  IDIQ+GRTG LTPVARLEP+ +GG 
Sbjct: 304 DQLDLQARLGFRSRSPRWATAHKFPAERAFTRLKGIDIQVGRTGALTPVARLEPITVGGV 363

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHNEDYI+G+  +G+ +R GRDIR+GD V+V+RAG+VIP++VD++++ER    +
Sbjct: 364 VVTNATLHNEDYIRGIGNTGEPIREGRDIRIGDMVIVQRAGDVIPQIVDVVMDERPEGTE 423

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP+ CPIC S  VRD+N KTGK+ A  RCTGG  C AQ +E LKHFVSR+AF+IEGL
Sbjct: 424 PYRFPTSCPICGSHAVRDINEKTGKVDAVRRCTGGFVCRAQAVEHLKHFVSRNAFDIEGL 483

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q++FFF+SED    IR   DIFTL+RRQ++S TK+ENI GFG VSV  LY++IN RR
Sbjct: 484 GSKQIEFFFESEDETLRIRTAPDIFTLERRQESSLTKLENIDGFGKVSVRKLYEAINARR 543

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I L RFI++LGIRHVG   A+ LA+ Y +Y++F   +      + D W  L  +  +G+
Sbjct: 544 SIGLHRFIYALGIRHVGETTAKLLARSYGTYEHFGAAMTEAGGFSGDAWNELNSIDGIGE 603

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++A+AIVEFY+ PRN+  +  LL+EV+P          S +  K +VFTG+L+K+ R +A
Sbjct: 604 VVARAIVEFYKEPRNLKVLSDLLEEVTPERAEMPVATDSPVAGKTVVFTGSLEKMTRDEA 663

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +     LGA V+  +S+KTDI++ G   GSKL+KA++LG++ M+E+++L L+
Sbjct: 664 KAKAESLGAKVAGSVSKKTDIVVAGPGAGSKLDKARELGLQTMDEDEWLALI 715


>gi|239832299|ref|ZP_04680628.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
 gi|239824566|gb|EEQ96134.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
          Length = 734

 Score =  620 bits (1598), Expect = e-175,   Method: Composition-based stats.
 Identities = 342/725 (47%), Positives = 474/725 (65%), Gaps = 19/725 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP+E L+  +A  EL  L +EI++HD+ Y+   +P I D+EYDALKRR DAI   FP L 
Sbjct: 19  IPVEKLTEPEAVSELGRLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLV 78

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P  ++G         V H+ P LSL   ++ ED+R F+  +YRF  +  DNSI
Sbjct: 79  RT---DSPSLRVGTAPVSKFAPVVHARPMLSLGNAFSDEDVRDFVGSVYRFLGQLPDNSI 135

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++E
Sbjct: 136 AFTAEPKIDGLSMSIRYENGVLVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPSVVE 195

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++K+DFLALN++M A G++ Y NPRN A+G LR+L+     +R L FF +  G+
Sbjct: 196 VRGEVYMAKSDFLALNEQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGE 255

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++ A  Q  M++  R  GFPVN   ++ +    ++++Y  +   R TL YDIDG+VYK
Sbjct: 256 MSDMPADTQMGMVEMFREWGFPVNPLTKRLHGADELLAHYRAIGLERPTLDYDIDGVVYK 315

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ +LG R+RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARLEP+ +GG
Sbjct: 316 VDRLDLQTRLGFRSRSPRWAIAHKFPAEQATTILRGIDIQVGRTGALTPVARLEPITVGG 375

Query: 366 ALITNATLHNEDYIKGLDASGKVMR-GGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
            ++TNATLHNEDYIKG+   G+ +R    DIR+GD V+V+RAG+VIP++VD+I+ +R  D
Sbjct: 376 VVVTNATLHNEDYIKGIGLKGERIRADEHDIRLGDTVIVQRAGDVIPQIVDVILEKRPVD 435

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP  CP+C S  VR+         A +RCTGGL C+AQ +ER++HFVSR+AF+IE
Sbjct: 436 AVPFHFPHECPVCGSHAVREEGE------AVYRCTGGLTCAAQAVERIRHFVSRNAFDIE 489

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +ED +  I+ PADIFTLQ+RQ  S  K+ENI GFG  SV  LYD+IN 
Sbjct: 490 GLGEKQVEFFFHAEDDSLKIKSPADIFTLQKRQAGSLKKLENIEGFGATSVKKLYDAIND 549

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+  A+ YLSY  F +                 N+ W 
Sbjct: 550 RREIALNRFLFGLGIRHVGEVNAKRFARSYLSYAAFEKAALEAVPPKEGDRTDKGNEAWQ 609

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            LI V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 610 DLIAVEGIGSIVAEAVVDFYAEPHNREVLAALLAEVTPLDEAARVATGSPVEGKTVVFTG 669

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +SRKTD+++ G   GSKL KA +LG+++++E+ +  
Sbjct: 670 SLERMSRDEAKAMAERYGAKTAGSVSRKTDLVVAGPGAGSKLAKASELGIEVIDEDAWFK 729

Query: 717 LLQQY 721
           L+ + 
Sbjct: 730 LVGEE 734


>gi|92116846|ref|YP_576575.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
 gi|123083742|sp|Q1QNT2|DNLJ_NITHX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91799740|gb|ABE62115.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
          Length = 714

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 312/726 (42%), Positives = 457/726 (62%), Gaps = 24/726 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +   P+++L+  QA+ E   L  EI  H++ YYQ   P + D+ YDAL++R +AI   
Sbjct: 4   KPKTPPPVDSLTRAQAKIEHKRLALEIETHNERYYQKDAPTVSDAAYDALRQRLEAIEAR 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FPDL  +   N P   +G        KV H++P LSL   ++ E++ +F+ RI RF +  
Sbjct: 64  FPDLITA---NSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDEEVAEFVERIQRFLKLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
            D+      EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L    
Sbjct: 121 PDDIPAIVAEPKIDGLSLSLRYENGELVRAATRGDGFTGEDVTANVRTIKDVPHNLRGRN 180

Query: 182 PEI-IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
                E+RGEVY+ K DFLALN +    G   +ANPRN+A+G LR+ +     +R L FF
Sbjct: 181 IPTACELRGEVYMLKTDFLALNKKQEDAGDTVFANPRNSAAGSLRQKDVAITASRPLKFF 240

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ ++  A  Q++ML+ ++ +GF VN  +   N+   ++ +Y ++   R++L YDI
Sbjct: 241 AYAWGEMTDRPADTQHDMLEWLKDVGFKVNPLIELCNSVEKVLKFYRKIGEQRASLGYDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVARLE
Sbjct: 301 DGVVYKVDRLDWQERLGFVSRSPRWAIAHKFAAEQATTILKGIDIQVGRTGAMTPVARLE 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV IGG ++ NATLHNEDYIKG+   G+ +R G D+RVGD V+V+RAG+VIP+VV ++++
Sbjct: 361 PVTIGGVVVQNATLHNEDYIKGIGNDGQPIRDGVDLRVGDTVVVQRAGDVIPQVVSVVID 420

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   AQP++FP  CPIC S  VR+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 421 KRPNSAQPYAFPHTCPICGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRL 474

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+  F +       I+ PADIFTL+ R      K+E + GFG+VSV NL+
Sbjct: 475 AFDIDGLGEKQIQEFHER----GWIKEPADIFTLRER--NPKIKLEELEGFGEVSVRNLF 528

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD----- 594
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y     F   ++   A   DD     
Sbjct: 529 AAIDARRTIELNRLIFALGIRHVGEGNAKLLARHYGGIDAFRAAMSEAAAAQTDDGNASE 588

Query: 595 -WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  +GDI+A A+VEF+   RN+ A+  LL+E+        +N  S +  K +V
Sbjct: 589 AYADLNNISGIGDIVADAVVEFFAETRNVKALNDLLEEIEVLPVAQARN-DSAVAGKTVV 647

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L+K  R +A+    ++GA VS  +S+KTD+++ G   GSKL+ A++ GV++++E++
Sbjct: 648 FTGSLEKFTRDEAKASAERMGAKVSGSVSKKTDLVVAGPGAGSKLKDAEKHGVQVISEDE 707

Query: 714 FLFLLQ 719
           +L L++
Sbjct: 708 WLKLIE 713


>gi|146342488|ref|YP_001207536.1| DNA ligase [Bradyrhizobium sp. ORS278]
 gi|166215400|sp|A4YZJ3|DNLJ_BRASO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146195294|emb|CAL79319.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+])
           [Bradyrhizobium sp. ORS278]
          Length = 716

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 294/721 (40%), Positives = 447/721 (61%), Gaps = 12/721 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +Q + +  L+  QA+ E   L  E+  HD  YYQ   P I D+ YD L+RR +AI   
Sbjct: 6   KSKQSVDVADLTKAQAKVEWKRLALELETHDRLYYQEDAPKISDAAYDELRRRFNAIEKR 65

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L      + P   +G   +    KV H++P LSL+  +  ED+R F+ RI RF +  
Sbjct: 66  FPELV---SRDSPSQTVGAAPSGRFKKVRHAVPMLSLDNAFAEEDVRDFVGRIARFLKLA 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           +D+ I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L    
Sbjct: 123 EDDRIAFSAEPKIDGLSMSLRYEGGQLVTAATRGDGAEGEDVTANIRTLKDVPQKLHGRN 182

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P+I E+RGEVY++K  FLALN+     G   +ANPRN+A+G LR+ +PT   +R L FF
Sbjct: 183 LPDICEIRGEVYMTKQAFLALNERQKEAGDTIFANPRNSAAGSLRQKDPTITASRPLGFF 242

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G  S + A+ Q  M++     GF  N   +  ++   +++++  ++  R+ L YDI
Sbjct: 243 AYAWGDMSAMPAETQSGMIKWFEHCGFTTNPLTKLCHSVEELIAFHRAIEEQRAELDYDI 302

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +R+PRW I+HKF  ++A T L DI+IQ+GRTG  TPV +LE
Sbjct: 303 DGVVYKVDRIDWQERLGFVSRTPRWGIAHKFPAERAMTVLKDIEIQVGRTGSFTPVGKLE 362

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD++++
Sbjct: 363 PVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVLID 422

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  DA+ F+FP  CP      V       G+  +  RCTG  AC  Q++E LK F SR 
Sbjct: 423 KRPADAEVFAFPRKCPCPLHTDVVREETAAGEEGSRARCTGEFACPYQKIEHLKLFASRR 482

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+ FFF        ++ PADIFTLQ+R   +  K+E + G+G+ SV NL+
Sbjct: 483 AFDIDGLGEKQIQFFFDE----GWVKEPADIFTLQKR--NAKLKLEEVEGYGETSVRNLF 536

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
           ++I  RR ++LERFI++LG+R+VG   A +LA+ Y S++ F      +   + +    + 
Sbjct: 537 NAIEARREMALERFIYALGMRYVGETTALALARGYGSWEAFHDACLKVANGDEEAIAEMD 596

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  +G+ + +++  ++    N   VE L +EV        K  +S I  K +VFTGTL+
Sbjct: 597 ALDQIGETVIKSVAAYFGEDHNRGIVERLTREVKILDAEKPKR-NSPIATKTVVFTGTLE 655

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K+ R +A+    +LGA VS  +S+KTD ++ G   GSKL+ A++ GVK++ E+++L L+ 
Sbjct: 656 KMTRDEAKATAERLGAKVSGSVSKKTDYVVAGPGAGSKLKDAEKHGVKVLTEDEWLQLIG 715

Query: 720 Q 720
           +
Sbjct: 716 E 716


>gi|222086432|ref|YP_002544966.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
 gi|254781247|sp|B9JH39|DNLJ_AGRRK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221723880|gb|ACM27036.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
          Length = 717

 Score =  619 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 339/690 (49%), Positives = 471/690 (68%), Gaps = 4/690 (0%)

Query: 30  YHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKV 89
            +D  Y+    P I D+EYDALKRR DAI   FP L R+   + P  ++G   + +   V
Sbjct: 29  RNDALYHGNDAPEISDAEYDALKRRNDAIEARFPALVRA---DSPSRRVGAAPSETFMPV 85

Query: 90  THSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFV 149
            H+ P LSL+  ++ ED++ F+  +YRF  +  D SI FT EPKIDG  ++IRYE G+ V
Sbjct: 86  VHARPMLSLDNTFSQEDVQDFVAGVYRFLGRLPDQSIAFTAEPKIDGLSMSIRYENGRMV 145

Query: 150 YAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVG 209
            AA RGDG +GE+V+A IR I  IP+ L    P ++E+RGEVY++K+DFLALN +M A G
Sbjct: 146 SAATRGDGTTGENVTANIRTIKEIPQTLPAGAPAVVEIRGEVYMAKSDFLALNAQMEAEG 205

Query: 210 RKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPV 268
           ++ Y NPRN A+G LR+L+     +R L FF +  G+ S++ A  Q+ M+Q     GFPV
Sbjct: 206 KQSYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGEMSDMPADTQFGMVQAFGEWGFPV 265

Query: 269 NNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISH 328
           N  +++ N+   I+++Y+E+   R  L YDIDG+VYKVD   LQ +LG R+RSPRW  +H
Sbjct: 266 NPLMKRLNSVADILAHYDEIGLQRPDLDYDIDGVVYKVDSLELQARLGFRSRSPRWATAH 325

Query: 329 KFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKV 388
           KF  +QA TRLLDIDIQ+GRTG LTPVARLEP+ +GG ++TNATLHN DYIKG+   G+ 
Sbjct: 326 KFPAEQALTRLLDIDIQVGRTGALTPVARLEPITVGGVVVTNATLHNADYIKGIGNKGEP 385

Query: 389 MRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPK 448
           +R GRDIR+GD V+V+RAG+VIP++VD+++ +R   +  + FP  CP+C S  VRD+N K
Sbjct: 386 IRDGRDIRIGDMVIVQRAGDVIPQIVDVVLEKREASSVAYEFPKTCPVCGSHAVRDINEK 445

Query: 449 TGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPA 508
           TGK+ A  RCTGG  C AQ  E LKHFVSR+A++IEGLG +Q+DFFF+S+DPA  +R   
Sbjct: 446 TGKVDAVTRCTGGFICRAQATEHLKHFVSRNAYDIEGLGSKQIDFFFESDDPALQVRTAP 505

Query: 509 DIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIAR 568
           DIFTL+RRQQ+S +K+ENI GFG VSV+ LY +IN+RR+I+L RFIF+LGIRHVG   A+
Sbjct: 506 DIFTLERRQQSSLSKLENIDGFGKVSVSKLYAAINERRDIALHRFIFALGIRHVGETTAK 565

Query: 569 SLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL 628
            LA+ Y +Y+ F   +        D W  L  +  VG+++A+A+VEFY+ PRN+  +  L
Sbjct: 566 LLARSYGTYEAFEAGMKEAAPLAGDAWNDLNNIEGVGEVVARAVVEFYKEPRNVEVISKL 625

Query: 629 LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDII 688
           L EV P          S +  K +VFTG+L+K  R +A+     LGA VS  +S+KTDI+
Sbjct: 626 LDEVRPQEAEQPTTSGSPVVGKTVVFTGSLEKFTRDEAKAKAESLGAKVSGSVSKKTDIV 685

Query: 689 IVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + G   GSKL+KA++  V++M E+++L L+
Sbjct: 686 VAGPGAGSKLDKAREFNVQVMTEDEWLELI 715


>gi|260892973|ref|YP_003239070.1| DNA ligase, NAD-dependent [Ammonifex degensii KC4]
 gi|260865114|gb|ACX52220.1| DNA ligase, NAD-dependent [Ammonifex degensii KC4]
          Length = 672

 Score =  618 bits (1594), Expect = e-175,   Method: Composition-based stats.
 Identities = 254/708 (35%), Positives = 380/708 (53%), Gaps = 45/708 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           LS E+A++ +  L +EI+YHD  YY    P+I D+EYD L     A+  AFP+      P
Sbjct: 5   LSKEEAKRRIEELRREIAYHDYRYYVLDSPVISDAEYDRLVLELMALEEAFPEFI---TP 61

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           N P  ++GG        V H +P LSL   +  EDLR F  R+           + + +E
Sbjct: 62  NSPTQRVGGAPREGFPTVRHLVPMLSLANAFEPEDLRDFDRRVREAL---PGEKVEYVVE 118

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  +++ Y  G+FV  A RGDG  GEDV+  +R I +IP     + P +IEVRGE 
Sbjct: 119 PKIDGLAVSLLYRDGEFVQGATRGDGEVGEDVTPNLRTIRSIPLRFLKDAPPLIEVRGEA 178

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF 250
           ++ K  F+ LN+     G  P+ANPRNAA+G +R+L+P     R L+FF +G+G    I 
Sbjct: 179 FMPKEAFVKLNERREEAGEPPFANPRNAAAGSIRQLDPRVTAGRKLDFFAYGIGHYEGIS 238

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               +E+L  +   GF VN   R  ++   ++ Y    +S R  LPY IDG+V KV+   
Sbjct: 239 FSTHWEVLDWLAEQGFRVNEHRRLFSSIDEVIDYVLSWQSKRFDLPYVIDGMVVKVNSLE 298

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q +LG   +SPRW ++ KF  ++A T+L  I+I +GRTG+LTPVA  +PV I G  ++ 
Sbjct: 299 SQARLGATMKSPRWAVAFKFPPEEAVTKLRRIEISVGRTGVLTPVAVFDPVQIAGTTVSR 358

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED I+            +DIRVGD ++V +AG+VIP+VV  +   R  + Q F  
Sbjct: 359 ATLHNEDLIR-----------EKDIRVGDYIVVHKAGDVIPEVVRSLPERRTGNEQIFRM 407

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP C ++ +R+      +          ++C A+  E + HF SR+A +I GLGK  
Sbjct: 408 PDHCPACGAKTIREEGEVAVR-------CPNISCPARLKESIFHFASRNAMDIRGLGKVL 460

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++           ++  ADI+ L+R           +   G  S  NL   I + ++  L
Sbjct: 461 VEQLVDR----GLVKNVADIYFLRREDL------LRLERMGPKSTANLLREIEESKSRGL 510

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            R IF LGIRHVG   A+ LA+++ S    AQ               L  +P +G  IA 
Sbjct: 511 NRLIFGLGIRHVGERAAKLLAEHFGSIDRLAQATE----------EELTEIPEIGPKIAA 560

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           ++  F+  PRN+  +E L +         E      ++ K  VFTG L+   R +A+  +
Sbjct: 561 SVRAFFAEPRNLEVIERLREAGVRLETTKEVREEGPLKGKVFVFTGALKSFTREEAKALI 620

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +LG  V++ +SR+TD ++VG+NPGSK ++A++LG+K++NEE+F  LL
Sbjct: 621 ERLGGRVASSVSRRTDYVVVGENPGSKYDRARELGIKMLNEEEFKRLL 668


>gi|306843233|ref|ZP_07475843.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
 gi|306286556|gb|EFM58135.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
          Length = 719

 Score =  618 bits (1593), Expect = e-174,   Method: Composition-based stats.
 Identities = 334/724 (46%), Positives = 472/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLVLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LY++I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYEAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040849|gb|ACT57645.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 731

 Score =  617 bits (1592), Expect = e-174,   Method: Composition-based stats.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH
Sbjct: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK
Sbjct: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
           KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN
Sbjct: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240
           IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV
Sbjct: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID
Sbjct: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP
Sbjct: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE
Sbjct: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA
Sbjct: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD
Sbjct: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR
Sbjct: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK
Sbjct: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ
Sbjct: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720

Query: 721 YNTTLRIHDDD 731
           YNTTLRIHDDD
Sbjct: 721 YNTTLRIHDDD 731


>gi|306844319|ref|ZP_07476911.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
 gi|306275391|gb|EFM57132.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
          Length = 719

 Score =  617 bits (1591), Expect = e-174,   Method: Composition-based stats.
 Identities = 337/724 (46%), Positives = 474/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+    P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEARFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFLALN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLALNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L DIDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRDIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYEFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDVVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|254714455|ref|ZP_05176266.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|254717353|ref|ZP_05179164.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261219183|ref|ZP_05933464.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261322244|ref|ZP_05961441.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|260924272|gb|EEX90840.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261294934|gb|EEX98430.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
          Length = 719

 Score =  617 bits (1591), Expect = e-174,   Method: Composition-based stats.
 Identities = 333/724 (45%), Positives = 473/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  S+  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSMKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIR+VG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRYVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|237815820|ref|ZP_04594817.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
 gi|237789118|gb|EEP63329.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
          Length = 725

 Score =  617 bits (1590), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/724 (46%), Positives = 473/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 10  ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 69

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 70  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 126

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 127 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 186

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 187 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 246

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 247 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 306

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 307 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 366

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 367 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 426

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 427 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 480

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 481 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 540

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 541 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 600

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 601 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 660

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 661 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 720

Query: 717 LLQQ 720
           L+ +
Sbjct: 721 LVGE 724


>gi|23502291|ref|NP_698418.1| NAD-dependent DNA ligase LigA [Brucella suis 1330]
 gi|62290313|ref|YP_222106.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 1 str. 9-941]
 gi|82700237|ref|YP_414811.1| NAD-dependent DNA ligase LigA [Brucella melitensis biovar Abortus
           2308]
 gi|161619368|ref|YP_001593255.1| NAD-dependent DNA ligase LigA [Brucella canis ATCC 23365]
 gi|163843675|ref|YP_001628079.1| NAD-dependent DNA ligase LigA [Brucella suis ATCC 23445]
 gi|189024547|ref|YP_001935315.1| NAD-dependent DNA ligase LigA [Brucella abortus S19]
 gi|225627871|ref|ZP_03785908.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|254689615|ref|ZP_05152869.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|254694105|ref|ZP_05155933.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|254697757|ref|ZP_05159585.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704678|ref|ZP_05166506.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|254708093|ref|ZP_05169921.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|254710462|ref|ZP_05172273.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|254730646|ref|ZP_05189224.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|256031956|ref|ZP_05445570.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|256113974|ref|ZP_05454757.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160155|ref|ZP_05457849.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|256257864|ref|ZP_05463400.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|256369836|ref|YP_003107347.1| DNA ligase [Brucella microti CCM 4915]
 gi|260169093|ref|ZP_05755904.1| NAD-dependent DNA ligase LigA [Brucella sp. F5/99]
 gi|260546856|ref|ZP_05822595.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260566074|ref|ZP_05836544.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260755142|ref|ZP_05867490.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260758361|ref|ZP_05870709.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260762187|ref|ZP_05874530.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884154|ref|ZP_05895768.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|261214403|ref|ZP_05928684.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261315595|ref|ZP_05954792.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261318033|ref|ZP_05957230.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261755371|ref|ZP_05999080.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|261758598|ref|ZP_06002307.1| DNA ligase [Brucella sp. F5/99]
 gi|265989064|ref|ZP_06101621.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|265995315|ref|ZP_06107872.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998527|ref|ZP_06111084.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|297248700|ref|ZP_06932418.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
 gi|75496544|sp|Q57C89|DNLJ_BRUAB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81752355|sp|Q8FZQ3|DNLJ_BRUSU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123768412|sp|Q2YLZ6|DNLJ_BRUA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359236|sp|A9M679|DNLJ_BRUC2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359237|sp|B0CHK8|DNLJ_BRUSI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781269|sp|B2S6P4|DNLJ_BRUA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|23348266|gb|AAN30333.1| DNA ligase, NAD-dependent [Brucella suis 1330]
 gi|62196445|gb|AAX74745.1| LigA, DNA ligase, NAD-dependent [Brucella abortus bv. 1 str. 9-941]
 gi|82616338|emb|CAJ11395.1| BRCT domain:NAD-dependent DNA ligase:ATP/GTP-binding site motif A
           (P-loop):Zn-finger in NAD-dependent DNA ligase, C4
           type:NAD [Brucella melitensis biovar Abortus 2308]
 gi|161336179|gb|ABX62484.1| DNA ligase, NAD-dependent [Brucella canis ATCC 23365]
 gi|163674398|gb|ABY38509.1| DNA ligase, NAD-dependent [Brucella suis ATCC 23445]
 gi|189020119|gb|ACD72841.1| DNA ligase [Brucella abortus S19]
 gi|225617876|gb|EEH14921.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|255999999|gb|ACU48398.1| DNA ligase [Brucella microti CCM 4915]
 gi|260095906|gb|EEW79783.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260155592|gb|EEW90672.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260668679|gb|EEX55619.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260672619|gb|EEX59440.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675250|gb|EEX62071.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260873682|gb|EEX80751.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|260916010|gb|EEX82871.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261297256|gb|EEY00753.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261304621|gb|EEY08118.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261738582|gb|EEY26578.1| DNA ligase [Brucella sp. F5/99]
 gi|261745124|gb|EEY33050.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|262553151|gb|EEZ08985.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|262766428|gb|EEZ12217.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|264661261|gb|EEZ31522.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|297175869|gb|EFH35216.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
          Length = 719

 Score =  617 bits (1590), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/724 (46%), Positives = 473/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|83953544|ref|ZP_00962265.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
 gi|83841489|gb|EAP80658.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
          Length = 706

 Score =  617 bits (1590), Expect = e-174,   Method: Composition-based stats.
 Identities = 293/714 (41%), Positives = 430/714 (60%), Gaps = 15/714 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
             ++ LS E+A+ EL+ L   +   +  Y+    P + D+EYD LKRR  AI   FP L 
Sbjct: 5   TALQELSEEEAKAELARLADLLGRANAAYHTQDAPDLSDAEYDRLKRRNQAIEERFPRLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P +K+G        KV H +  LSL   +  ED+  F  RI ++        +
Sbjct: 65  RA---DSPSDKVGAAPAEGFGKVRHDVAMLSLGNAFEDEDVVDFDARIRKYLGLPSGTPL 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I TIP  +    P ++E
Sbjct: 122 AFTAEPKIDGLSLSLRYENGELVQAATRGDGAVGENVTANARTIDTIPTRIQGA-PALLE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+  +DF ALN    A G K +ANPRNAA+G LR+L+      R L FF +  G 
Sbjct: 181 VRGEVYMRHHDFDALNARQTANGGKTFANPRNAAAGSLRQLDAEITRARPLAFFAYAWGA 240

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q+  ++++   GF  N      +    ++++Y +++  R+TL YDIDG+VYK
Sbjct: 241 LSAPLADTQFHAIERLSAFGFDTNPLTTLCDGPQEMIAHYRKIEEQRATLGYDIDGVVYK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++ +LQ +LG R+ +PRW I+HKF  + A TRL DI IQ+GRTG L+PVARL+PV +GG
Sbjct: 301 VNDLALQDRLGFRSTTPRWAIAHKFPAELAWTRLEDITIQVGRTGALSPVARLKPVTVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKGLD+ G  +R G+DIRVGD V V RAG+VIPK+ D+ + +R  D+
Sbjct: 361 VVVSNATLHNEDYIKGLDSKGASIRDGKDIRVGDWVQVYRAGDVIPKIADVDLGKRPEDS 420

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + + +P+ CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+I+G
Sbjct: 421 EAYVYPTTCPECGSDAIREEG------DAVRRCTGGLICPAQAVEKLKHFVSRAAFDIDG 474

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F+        I  PADIFTL+ R  +   +++N  G+G+ S   L+ +I  +
Sbjct: 475 LGAKQVEQFYAD----GWIAEPADIFTLKARYGSGMQQLKNREGWGEKSADKLFQAIEDK 530

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L R IF+LGIRHVG   +  +A++Y S+  F   + +  + +   W  LI V  VG
Sbjct: 531 RKIPLSRLIFALGIRHVGEAASNLIAQHYGSWTAFEAAMGHAKSGDGPAWDDLIGVDGVG 590

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++AQ++V  +       +++ L+ E+S           S +  K +VFTGTL+K+ R +
Sbjct: 591 QVMAQSLVSTFAQEAERASIDRLVTELSVQDVARPDTEGSPVAGKTVVFTGTLEKMTRAE 650

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+    +LGA VS  +S KTDI++ G   GSK +KA  LG++ ++E+ +L L+ 
Sbjct: 651 AKARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAADLGIQTLDEDGWLALID 704


>gi|254702142|ref|ZP_05163970.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261752711|ref|ZP_05996420.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261742464|gb|EEY30390.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
          Length = 719

 Score =  616 bits (1589), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/724 (46%), Positives = 472/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA     +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTVGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|225852902|ref|YP_002733135.1| NAD-dependent DNA ligase LigA [Brucella melitensis ATCC 23457]
 gi|256263616|ref|ZP_05466148.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|254781270|sp|C0RE59|DNLJ_BRUMB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225641267|gb|ACO01181.1| DNA ligase, NAD-dependent [Brucella melitensis ATCC 23457]
 gi|263093668|gb|EEZ17673.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409444|gb|ADZ66509.1| NAD-dependent DNA ligase LigA [Brucella melitensis M28]
 gi|326539150|gb|ADZ87365.1| DNA ligase, NAD-dependent [Brucella melitensis M5-90]
          Length = 719

 Score =  616 bits (1589), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/724 (46%), Positives = 473/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|148560656|ref|YP_001259312.1| NAD-dependent DNA ligase LigA [Brucella ovis ATCC 25840]
 gi|166215401|sp|A5VRG5|DNLJ_BRUO2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148371913|gb|ABQ61892.1| DNA ligase, NAD-dependent [Brucella ovis ATCC 25840]
          Length = 719

 Score =  616 bits (1589), Expect = e-174,   Method: Composition-based stats.
 Identities = 334/724 (46%), Positives = 472/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++    Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPVDTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|256255361|ref|ZP_05460897.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|261222562|ref|ZP_05936843.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|260921146|gb|EEX87799.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
          Length = 719

 Score =  616 bits (1589), Expect = e-174,   Method: Composition-based stats.
 Identities = 334/724 (46%), Positives = 472/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  + RF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVCRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|15965917|ref|NP_386270.1| NAD-dependent DNA ligase LigA [Sinorhizobium meliloti 1021]
 gi|307308227|ref|ZP_07587936.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
 gi|307319694|ref|ZP_07599119.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|81634276|sp|Q92NM8|DNLJ_RHIME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15075186|emb|CAC46743.1| Probable DNA ligase [Sinorhizobium meliloti 1021]
 gi|306894625|gb|EFN25386.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|306901225|gb|EFN31831.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
          Length = 717

 Score =  616 bits (1587), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/690 (48%), Positives = 469/690 (67%), Gaps = 4/690 (0%)

Query: 30  YHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKV 89
            HD  Y+    P I D++YDALKRR D I   FP L R    + P  K+G   +L+   V
Sbjct: 29  RHDMLYHGKDAPEISDADYDALKRRNDLIEERFPVLVRE---DSPSRKVGAAPSLTFAPV 85

Query: 90  THSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFV 149
            H+ P LSL+  ++ ED R F+  +YRF  K  D SI FT EPKIDG  +++RYE  + V
Sbjct: 86  VHARPMLSLDNTFSDEDARAFVAGVYRFLGKLPDGSIAFTAEPKIDGLSMSLRYENRRLV 145

Query: 150 YAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVG 209
            AA RGDG +GE+V+A +R I  IP+ L  + P+++E+RGE+Y++K+DF ALN EM A G
Sbjct: 146 TAATRGDGTTGENVTANVRTIGMIPQTLPADAPDVVEIRGEIYMAKSDFAALNAEMAAQG 205

Query: 210 RKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPV 268
           R  Y NPRN ASG LR+L+      R L FF +  G+ S + A  Q  M++  +  GFPV
Sbjct: 206 RPLYVNPRNTASGSLRQLDAKVTANRKLRFFAYAWGEMSAMPADTQLGMVETFKAWGFPV 265

Query: 269 NNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISH 328
           N  +++  +   ++ +Y+ ++  R  L YDIDG+VYKVD   LQ +LG R+RSPRW  +H
Sbjct: 266 NPLMQRFFSADELLEHYHHIERERPDLDYDIDGVVYKVDRLDLQARLGFRSRSPRWATAH 325

Query: 329 KFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKV 388
           KF  +QA TRL  IDIQ+GRTG LTPVARLEP+ +GG ++TNATLHNEDYI+G+  +G+ 
Sbjct: 326 KFPAEQAFTRLKGIDIQVGRTGALTPVARLEPITVGGVVVTNATLHNEDYIRGVGNTGEP 385

Query: 389 MRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPK 448
           +R GRD+R+GD V+V+RAG+VIP++VD++++ER   A+P+ FP+ CPIC S  VRD+N K
Sbjct: 386 IRDGRDVRIGDMVIVQRAGDVIPQIVDVVMDERPEGAEPYRFPTTCPICGSHAVRDINEK 445

Query: 449 TGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPA 508
           TGK+ A  RCTGG  C AQ +E LKHFVSR+AF+IEGLG +Q++FFF+SED    IR   
Sbjct: 446 TGKVDAVRRCTGGFVCRAQAVEHLKHFVSRNAFDIEGLGSKQIEFFFESEDENLRIRTAP 505

Query: 509 DIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIAR 568
           +IFTL+RRQ+ S  K+EN  GFG VSV  LY++IN RR+I+L R I++LGIRHVG   A+
Sbjct: 506 EIFTLERRQEASLNKLENTDGFGKVSVRKLYEAINARRSIALHRLIYALGIRHVGETTAK 565

Query: 569 SLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEAL 628
            LA+ Y SY++F   +      + D W  L  +  +G+++A+AIVEFY+ PRN+  V  L
Sbjct: 566 LLARSYGSYEHFGAAMTEAAGFSGDAWNELNSIDGIGEVVARAIVEFYKEPRNLKVVSEL 625

Query: 629 LKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDII 688
           L+EV+P          S +  K +VFTG+L+K+ R +A+     LGA V+  +S+KTDI+
Sbjct: 626 LQEVTPESAELPVATDSPVAGKTVVFTGSLEKMTREEAKAKAESLGAKVAGSVSKKTDIV 685

Query: 689 IVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           + G   GSKL+KA++LGV+ M+E+++L L+
Sbjct: 686 VAGPGAGSKLDKARELGVQTMDEDEWLALI 715


>gi|17986872|ref|NP_539506.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str. 16M]
 gi|256045051|ref|ZP_05447952.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565350|ref|ZP_05835834.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265991477|ref|ZP_06104034.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|81852173|sp|Q8YI56|DNLJ_BRUME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|17982511|gb|AAL51770.1| nad-dependent DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|260151418|gb|EEW86512.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|263002261|gb|EEZ14836.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 719

 Score =  616 bits (1587), Expect = e-174,   Method: Composition-based stats.
 Identities = 335/724 (46%), Positives = 472/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G          V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALAIFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFKKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|256061478|ref|ZP_05451622.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261325484|ref|ZP_05964681.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261301464|gb|EEY04961.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
          Length = 719

 Score =  615 bits (1586), Expect = e-174,   Method: Composition-based stats.
 Identities = 334/724 (46%), Positives = 471/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY+ K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMVKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GFPVN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFPVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF  +QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAEQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +ED A  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDSALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|323136604|ref|ZP_08071685.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
 gi|322397921|gb|EFY00442.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
          Length = 705

 Score =  615 bits (1586), Expect = e-174,   Method: Composition-based stats.
 Identities = 299/718 (41%), Positives = 463/718 (64%), Gaps = 24/718 (3%)

Query: 1   MKKRQL---IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDA 57
           M K+     + ++ LS  +AR E + L ++I+ +D+ YY+   P++ D+EYDA +RR +A
Sbjct: 1   MTKKPASRPLSVDELSPAEARAEHARLGEDIARYDEAYYREDAPLVPDAEYDAARRRYEA 60

Query: 58  IAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRF 117
           +  AFP+L     P     K+G + +    KV H++P LSL  +++ E++  F+ R+ RF
Sbjct: 61  LEKAFPELV---TPESLTRKVGAKPSEKFAKVKHAVPMLSLGNVFSDEEVFDFVARVRRF 117

Query: 118 WQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL 177
               +   + FT EPKIDG   ++RYE G+   AA RGDG+ GEDV+A IR +  IP  L
Sbjct: 118 LGLGERARLAFTAEPKIDGLSCSLRYEGGRLAQAATRGDGYEGEDVTANIRTLREIPHKL 177

Query: 178 SLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYL 236
             + P+++EVRGEVY++  DF ALN+   A G+ P+ANPRNAA+G LR+L+P     R L
Sbjct: 178 HGDAPDVLEVRGEVYMTHADFAALNERQTAAGKPPFANPRNAAAGSLRQLDPKITAGRPL 237

Query: 237 NFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLP 296
           +FF +G G+ SE+  + Q+ +L+    LG  VN   R  +    ++++Y  +++ R+TL 
Sbjct: 238 HFFAYGWGEASELPGETQWSVLEAFGRLGLKVNPLTRLCDGAEEMLAHYRAIEARRATLG 297

Query: 297 YDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVA 356
           YDIDG+VYKVD+ SLQ++LG  +R+PRW  +HKF  ++A+T L DI+IQ+GRTG LTPVA
Sbjct: 298 YDIDGVVYKVDDISLQERLGFVSRAPRWAAAHKFPAERATTILRDIEIQVGRTGALTPVA 357

Query: 357 RLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDI 416
           RLEPV +GG +++NATLHNED I             +DIRVGD V+V+RAG+VIP++V++
Sbjct: 358 RLEPVTVGGVVVSNATLHNEDEIAR-----------KDIRVGDTVVVQRAGDVIPQIVEV 406

Query: 417 IVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFV 476
           +  +R   A+P+ FP  CP C S  +R+++ KTG+     RCTG L C AQ +ERLKHF 
Sbjct: 407 VTEKRPHGAKPYHFPHVCPRCGSAALREIDEKTGEADVVRRCTGSLVCPAQAVERLKHFA 466

Query: 477 SRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVT 536
           SR+AF+IEGLG +Q+++F+        I+  +DIFTL+ R + S TKI+N  GFG+ SV 
Sbjct: 467 SRNAFDIEGLGDRQIEYFYDE----GLIKTASDIFTLEERDRASLTKIKNREGFGETSVR 522

Query: 537 NLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWL 596
           NL+ +I  RR I + RF+++LGIRHVG   AR LA+++  +++  +          +   
Sbjct: 523 NLFAAIEARRTIPINRFLYALGIRHVGETNARRLARHFGDFESLRETAREA-DPGTEARA 581

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            +  +  VG ++A+A+ +F+  P N   ++ALL +V+      E   SS +  K +VFTG
Sbjct: 582 RIDSIDGVGPVVAEALHDFFAEPHNEKELDALLSQVTLEP-MPEIASSSPVAGKTVVFTG 640

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
            L+++ R +A+    + GA V+A +S+KTD+++ G   GSKL KAQ+LG+++++E+++
Sbjct: 641 ALERLTRDEAKAQAERFGAKVAASVSKKTDLVVAGPGAGSKLAKAQELGIEVISEDEW 698


>gi|209884394|ref|YP_002288251.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
 gi|254781382|sp|B6JB45|DNLJ_OLICO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209872590|gb|ACI92386.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
          Length = 706

 Score =  615 bits (1585), Expect = e-174,   Method: Composition-based stats.
 Identities = 303/726 (41%), Positives = 442/726 (60%), Gaps = 33/726 (4%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
            K+ L  ++ L+  QA+ E   L  EI+ HD+ YYQ   P + D+ YD+L++R +A+   
Sbjct: 5   SKKPLPSVDQLTKAQAKVEHKRLALEIAMHDERYYQKDAPTVSDAAYDSLRQRLNAVEAR 64

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L  +   + P  K+G + + +  K+ H++P LSL   ++ E++ +F+ R+ RF    
Sbjct: 65  FPELVTT---DSPSQKVGAQPSRAFAKIRHAVPMLSLGNAFSDEEVAEFVARVRRFLNLG 121

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
            D  +    EPKIDG  +++RYE G+ V AA RGDG  GEDV+A +R I  +P  L    
Sbjct: 122 ADEPLAVVAEPKIDGLSLSLRYENGELVNAATRGDGFEGEDVTANVRTIKDVPHKLKGKN 181

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P + EVRGEVY+ + DFL LN +    G   +ANPRN+A+G LR+ N     +R L FF
Sbjct: 182 IPAVCEVRGEVYMLREDFLTLNKKQADSGDTIFANPRNSAAGSLRQKNVAITASRPLKFF 241

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ S + A  Q+EM++     GF VN  +        ++ YY E+++ R+ L YDI
Sbjct: 242 AYAWGEMSAMPATTQFEMVKWFEKAGFAVNPRMILCRDVEALLRYYREIETERAQLSYDI 301

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q +LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL 
Sbjct: 302 DGVVYKVDRLDWQTRLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLA 361

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
            V +GG ++ NATLHNED I             +DIR GD V+++RAG+VIP+VV ++ +
Sbjct: 362 AVTVGGVVVQNATLHNEDEIAR-----------KDIREGDTVVIQRAGDVIPQVVSVVTD 410

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   A+P+SFP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 411 KRPKHAKPYSFPHVCPVCGSHAVREEGE------AVRRCTGALICPAQAVERLKHFVSRL 464

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+IEGLG +Q+  F+ ++     I  P DIFTL +R   +T K+++  G+GDVSV NL+
Sbjct: 465 AFDIEGLGDKQIHEFYDAK----LIMHPVDIFTLAKRDAHATDKLKDREGYGDVSVRNLF 520

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN------ND 593
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y + +NF   +    A        ++
Sbjct: 521 AAIDARRRIELNRLIFALGIRHVGEGNAKLLARHYGTIENFRAAMAEAAAAQTEEGNPSE 580

Query: 594 DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  VGDI+A A+VEF+   RN+ A+  LL E+       +    S +  K +V
Sbjct: 581 AYADLNAIGGVGDIVADAVVEFFAEERNVKALNELLHEIEVLPAE-QVRADSAVAGKTVV 639

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L K  R +A+    +LGA VS  +S+KTD ++ G+  GSKL KA++LGV ++ E++
Sbjct: 640 FTGSLTKFTREEAKAQAERLGAKVSGSVSKKTDYVVAGEEAGSKLTKARELGVAVLTEDE 699

Query: 714 FLFLLQ 719
           +L L++
Sbjct: 700 WLKLIE 705


>gi|91977847|ref|YP_570506.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
 gi|123735250|sp|Q133Y4|DNLJ_RHOPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91684303|gb|ABE40605.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
          Length = 714

 Score =  614 bits (1584), Expect = e-173,   Method: Composition-based stats.
 Identities = 305/727 (41%), Positives = 445/727 (61%), Gaps = 28/727 (3%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
            K     I+ L+  +A+ EL  L   I  HD  YYQ   P I D++YDAL+RR +AI   
Sbjct: 5   SKTAAPDIDKLTKPKAKVELMRLRLAIEGHDKAYYQDDAPKIPDADYDALRRRLEAIEAK 64

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L      + P   +G        KV H++P LSL   ++ +++ +F+ R+ RF + +
Sbjct: 65  FPELL---SASSPSQTVGAAPARGFSKVQHAVPMLSLGNAFSDDEVGEFVERVQRFLKLE 121

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LN 180
           D  +I    EPKIDG  +++RYE G  V AA RGDG +GEDV+A +R I  IP  L    
Sbjct: 122 DIPAI--VAEPKIDGLSLSLRYENGTLVRAATRGDGFTGEDVTANVRTIADIPTTLKAKT 179

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           IP   E+RGEVY+ K+DFLALN      G   +ANPRN+A+G LR+ +     +R L FF
Sbjct: 180 IPAACELRGEVYMLKHDFLALNKRQEEAGDTVFANPRNSAAGSLRQKDVAITASRPLKFF 239

Query: 240 VHGLGKT--SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
            +  G+     + +  Q+ ML  +   GF VN  +   ++    +++Y  +   R+ LPY
Sbjct: 240 AYAWGEMSDYPMESPTQHAMLAWLGDAGFTVNPEITLCHSVDDALAFYRRIGEQRAALPY 299

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKVD    Q +LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG LTPVAR
Sbjct: 300 DIDGVVYKVDRLDYQARLGFVSRSPRWAIAHKFAAEQAVTVLEKIDIQVGRTGALTPVAR 359

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           L+PV +GG ++ NATLHNEDYIKG+ + G  +R G DIR GD V+V+RAG+VIP++V ++
Sbjct: 360 LQPVTVGGVVVQNATLHNEDYIKGVGSDGSPLRDGVDIREGDTVVVQRAGDVIPQIVTVV 419

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           +++R  D   + FP  CP+C S   R+         A  RCTG L C AQ +ERLKHFVS
Sbjct: 420 LDKRPADLPAYKFPHKCPVCGSHAAREEGE------AVWRCTGALICPAQAVERLKHFVS 473

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R AF+I+GLG++Q+  F +       +R PADIFTL+ R   +  K+E++ G+G+ SV N
Sbjct: 474 RLAFDIDGLGEKQIVLFHER----GWVREPADIFTLKAR--NAELKLEDLEGYGETSVRN 527

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HN 591
           L+ +I+ RRNI L R IF+LGIRHVG   A+ LA++Y S   F   +           + 
Sbjct: 528 LFAAIDARRNIELNRLIFALGIRHVGEGNAKLLARHYGSIDVFLAAMRAAAEGQTPEGNT 587

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKK 651
           ++ +  L  +  +GD++A+A+VEF+  PRN+ A++ALL+E+   +   +    + +  K 
Sbjct: 588 SEAYQDLDNIAGIGDVVAEAVVEFFAEPRNVGALDALLREIEV-LPVEQAKQDTAVAGKT 646

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +VFTG L K  R +A+    +LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E
Sbjct: 647 VVFTGALTKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGEDAGSKLTKARDLGVAVLTE 706

Query: 712 EQFLFLL 718
           +++L L+
Sbjct: 707 DEWLALI 713


>gi|39936579|ref|NP_948855.1| DNA ligase [Rhodopseudomonas palustris CGA009]
 gi|39650435|emb|CAE28958.1| DNA ligase [Rhodopseudomonas palustris CGA009]
          Length = 692

 Score =  614 bits (1582), Expect = e-173,   Method: Composition-based stats.
 Identities = 296/706 (41%), Positives = 438/706 (62%), Gaps = 27/706 (3%)

Query: 23  SLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM 82
            L  EI  HD  YYQ   P I D++YDAL+RR +AI   FP+L  +   + P   +G   
Sbjct: 2   RLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPELVNA---SSPTQTVGAAP 58

Query: 83  NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIR 142
                KV H++P LSL   +  +++ +F  R+ RF +  D  +I    EPKIDG  +++R
Sbjct: 59  ARGFAKVQHAVPMLSLGNAFADDEVAEFALRVQRFLKLDDVPAI--VAEPKIDGLSLSLR 116

Query: 143 YEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKNDFLAL 201
           YE G+ V AA RGDG +GEDV+A +R I  +P  L     P   E+RGEVY+ K DFLAL
Sbjct: 117 YENGELVRAATRGDGFTGEDVTANVRTIKDVPNTLKGKHIPATCELRGEVYMLKQDFLAL 176

Query: 202 NDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT--SEIFAKGQYEML 258
           N          +ANPRN+A+G LR+ + T   +R L FF +  G+     +    Q++ML
Sbjct: 177 NKRQEEANETVFANPRNSAAGSLRQKDVTVTASRPLKFFAYAWGEMSDYPMEEPTQHKML 236

Query: 259 QKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGER 318
           Q +   GF VN  +   ++    +++Y  +   R++LPYDIDG+VYKVD    Q++LG  
Sbjct: 237 QWLDHAGFVVNPEITLCHSVEDALAFYRRIGEKRASLPYDIDGVVYKVDRLDYQERLGFV 296

Query: 319 ARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDY 378
           +RSPRW I+HKFA +QA+T L  IDIQ+GRTG +TPVARL+PV +GG ++ NATLHNEDY
Sbjct: 297 SRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGAMTPVARLQPVTVGGVVVQNATLHNEDY 356

Query: 379 IKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQ 438
           IKG+   G+ +R G DIR GD V+V+RAG+VIP++V +++ +R   A+P+ FP  CP+C 
Sbjct: 357 IKGIGNDGEPIRDGVDIREGDTVVVQRAGDVIPQIVSVVMEKRPAGAEPYHFPHKCPVCG 416

Query: 439 SRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSE 498
           S  VR+         A  RCTG L C AQ +ERLKHFVSR AF+I+GLG++Q++ F +  
Sbjct: 417 SHAVREEGE------AVWRCTGALICPAQAVERLKHFVSRLAFDIDGLGEKQIELFHER- 469

Query: 499 DPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLG 558
                ++ PADIFTL+ R   +  K+E + G+G+ SV NL+ +I+ RR+I L R +F+LG
Sbjct: 470 ---GWVQEPADIFTLKAR--NAELKLEQLEGYGETSVRNLFAAIDARRSIELHRLVFALG 524

Query: 559 IRHVGAEIARSLAKYYLSYQNFAQEINNIIAH------NNDDWLSLIRVPLVGDIIAQAI 612
           IRHVG   A+ LA++Y +   F   +             ++ +  L  +  +GD++A+A+
Sbjct: 525 IRHVGEGNAKLLARHYGTLDAFLSAMRAAADAQTEEGNTSEAYQDLDNIAGIGDVVAEAV 584

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
           VEF+   RNI A++ALL E++  +   +    + +  K +VFTG+L K  R +A+    +
Sbjct: 585 VEFFAEERNIKALDALLAELTEVLPAEQARRDTAVAGKTVVFTGSLSKFTRDEAKAAAER 644

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           LGA V+  +S+KTD ++ G++ GSKL KA+ LGV ++ E+++L L+
Sbjct: 645 LGAKVAGSVSKKTDYVVAGEDAGSKLTKAKDLGVTVLTEDEWLALI 690


>gi|83942325|ref|ZP_00954786.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
 gi|83846418|gb|EAP84294.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
          Length = 706

 Score =  614 bits (1582), Expect = e-173,   Method: Composition-based stats.
 Identities = 296/714 (41%), Positives = 433/714 (60%), Gaps = 15/714 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
             ++ LS E+A+ EL+ L   +   +  Y+    P + D+EYD LKRR  AI   FP L 
Sbjct: 5   TALQELSEEEAKAELARLADLLGRANTAYHTQDAPDLSDAEYDRLKRRNQAIEERFPGLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P +K+G        KV H +  LSL   +  ED+  F  RI ++        +
Sbjct: 65  RA---DSPSDKVGATPAEGFGKVRHDVAMLSLGNAFEDEDVVDFDARIRKYLGLPSGTPL 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I TIP  +    P ++E
Sbjct: 122 AFTAEPKIDGLSLSLRYENGELVQAATRGDGAVGENVTANARTIDTIPTRIKGA-PALLE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+  +DF ALN    A G K +ANPRNAA+G LR+L+P     R L FF +  G 
Sbjct: 181 VRGEVYMRHDDFDALNARQTANGGKTFANPRNAAAGSLRQLDPEITRARPLAFFAYAWGA 240

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A+ Q++ +++++  GF  N      +    ++++Y +++  R+TL YDIDG+VYK
Sbjct: 241 LSAPLAESQFQAIERLKAFGFDTNPLTTLCDGPQEMIAHYRKIEEQRATLGYDIDGVVYK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++  LQ +LG R+ +PRW I+HKF  + A TRL DI IQ+GRTG L+PVARL PV +GG
Sbjct: 301 VNDLGLQDRLGFRSTTPRWAIAHKFPAELAWTRLEDITIQVGRTGALSPVARLHPVTVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKGLD+ G  +R G+DIRVGD V V RAG+VIPK+ D+ + +R  DA
Sbjct: 361 VVVSNATLHNEDYIKGLDSKGARIREGKDIRVGDWVQVYRAGDVIPKIADVDLGKRPEDA 420

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + + +P+ CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+I+G
Sbjct: 421 RAYVYPTTCPECGSDAIREEG------DAVRRCTGGLICPAQAVEKLKHFVSRAAFDIDG 474

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F+        I  PADIFTL+ R  +   +++N  G+G+ S   L+ +I  +
Sbjct: 475 LGAKQVEQFYGD----GWIAEPADIFTLKTRYGSGMQQLKNREGWGEKSADKLFQAIEDK 530

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R ISL R IF+LGIRHVG   +  +A++Y S+  F   + +  + +   W  LI V  VG
Sbjct: 531 RKISLSRLIFALGIRHVGEAASNLIAQHYGSWTAFEAAMGHAKSGDGPAWDDLIGVDGVG 590

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++AQ++V  +       +++ L+ E+S           S +  K +VFTGTL+K+ R +
Sbjct: 591 QVMAQSLVSTFAQEAERASIDRLVTELSVQDVALPDTEGSPVAGKTVVFTGTLEKMTRAE 650

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+    +LGA VS  +S KTDI++ G   GSK +KA  LG++ ++E+ +L L+ 
Sbjct: 651 AKARAERLGAKVSGSVSAKTDILVAGPGAGSKAKKAADLGIQTLDEDGWLALID 704


>gi|148257407|ref|YP_001241992.1| DNA ligase (polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
 gi|166215399|sp|A5EPJ2|DNLJ_BRASB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146409580|gb|ABQ38086.1| DNA ligase (Polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
          Length = 716

 Score =  614 bits (1582), Expect = e-173,   Method: Composition-based stats.
 Identities = 305/722 (42%), Positives = 452/722 (62%), Gaps = 14/722 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K ++ + +  L+  QA+ E   L  E+  HD  YYQ   P I D+EYD L+RR +AI   
Sbjct: 6   KPKKPVDVAELTKAQAKVEWKRLALELEVHDRLYYQDDAPKISDAEYDELRRRFNAIETR 65

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+L  SE    P  K+G   +    KV H++P LSL+  +  ED+R F+ RI RF +  
Sbjct: 66  FPELVSSE---SPSQKVGASPSGRFKKVRHAVPMLSLDNAFAEEDVRDFVGRIARFLKLA 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-N 180
           DD  I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L   N
Sbjct: 123 DDR-IDFSAEPKIDGLSMSLRYEGGELVTAATRGDGAEGEDVTANIRTLKDVPQKLHGRN 181

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P++ EVRGEVY++K  FLALN+     G   +ANPRN+A+G LR+ +P    +R L FF
Sbjct: 182 WPDVCEVRGEVYMTKQAFLALNERQKEAGDTIFANPRNSAAGSLRQKDPAITASRPLGFF 241

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +  G+ S    A+ Q  M++     GF  N   R  ++   +++++  ++  R+ L YD
Sbjct: 242 AYAWGEISGTPPAETQTGMIKWFEQCGFTTNPLTRLCHSVEELIAFHRSIEEQRAELDYD 301

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKVD    Q++LG  +R+PRW I+HKF  ++A T L DI+IQ+GRTG LTPV +L
Sbjct: 302 IDGVVYKVDRIDWQERLGFVSRTPRWAIAHKFPAERAMTVLKDIEIQVGRTGSLTPVGKL 361

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD+++
Sbjct: 362 EPVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVVI 421

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           ++R   A+PF  P  CP      V      TG+  +  RCTG  AC  Q++E LK F SR
Sbjct: 422 DKRPAQARPFHLPKTCPCPLHTDVVREETATGEEGSRARCTGEFACPYQKIEHLKLFASR 481

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            AF+I+GLG++Q+ FFF+       ++ PADIFTLQ+R   +  K+E I G+G+ SV NL
Sbjct: 482 RAFDIDGLGEKQIAFFFEQ----GWVKEPADIFTLQKR--NAGLKLEEIEGYGETSVRNL 535

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
           +++I+ RR I+LERFI++LG+RHVG   A +LA+ Y S+  F +    + A + +    +
Sbjct: 536 FNAIDARREIALERFIYALGMRHVGETTALALARGYGSWDAFHEACLKVAAGDEEAIAEM 595

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTL 658
             +  +GD + +++  ++    N   VE L +EV        K   S I  K +VFTGTL
Sbjct: 596 DALDQIGDTVIKSVAAYFAEDHNRGIVERLTQEVKILDAEKPKR-HSPIATKTVVFTGTL 654

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +K+ R +A+    +LGA VS  +S+KTD ++ G   GSKL++AQ+ GV+++ E+++L L+
Sbjct: 655 EKMTRDEAKATAERLGAKVSGSVSKKTDYVVAGPGAGSKLKEAQKHGVQVLTEDEWLQLI 714

Query: 719 QQ 720
            +
Sbjct: 715 AE 716


>gi|294852747|ref|ZP_06793420.1| DNA ligase [Brucella sp. NVSL 07-0026]
 gi|294821336|gb|EFG38335.1| DNA ligase [Brucella sp. NVSL 07-0026]
          Length = 719

 Score =  613 bits (1581), Expect = e-173,   Method: Composition-based stats.
 Identities = 334/724 (46%), Positives = 471/724 (65%), Gaps = 19/724 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +E L+  +A  EL  L + I++HD+ Y+   +P I D+ YDALKRR +AI   FP L 
Sbjct: 4   ISVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALV 63

Query: 67  RSEDPNGPLNKIGGEM-NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
           R    + P  ++G      +   V H+ P LSL+  ++ ED+R F+  +YRF  +  D+S
Sbjct: 64  RD---DSPSRRVGAAPALATFAPVVHARPMLSLDNAFSDEDVRDFVGSVYRFLGQLPDDS 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           I FT EPKIDG  ++IRYE G  V  A RGDG +GE+V+A IR I  IP  L    P ++
Sbjct: 121 IAFTAEPKIDGLSMSIRYENGILVSGATRGDGTTGENVTANIRTIAEIPNRLPAGAPAVV 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY++K+DFL LN +M A G++ Y NPRN A+G LR+L+     +R L FF +  G
Sbjct: 181 EVRGEVYMAKSDFLTLNAQMEAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + S++ A  Q  M++  R  GF VN  +++ N+  G++++Y  +   R TL YDIDG+VY
Sbjct: 241 EMSDMPADTQLGMVEVFRQWGFLVNPLMKRFNSVDGLLAHYRAIGMERPTLDYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD   LQ +LG R+RSPRW I+HKF   QA T L  IDIQ+GRTG LTPVARLEP+ +G
Sbjct: 301 KVDRLDLQTRLGFRSRSPRWAIAHKFPAGQALTILRGIDIQVGRTGALTPVARLEPITVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VD+++ E    
Sbjct: 361 GVVVTNATLHNEDYIKGIGQKGEPIREGRDIRIGDSVIVQRAGDVIPQIVDVVLEEGKKR 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
            +P+ FP  CP C S  VR+         A  RCTGGL C AQ +ER++HFVSR+AF+IE
Sbjct: 421 GEPYQFPHVCPACGSHAVREEGE------AVRRCTGGLICPAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q++FFF +EDPA  IR PADIFTL++RQ+ S TK++NI GFG  SV  LYD+I+ 
Sbjct: 475 GLGEKQVEFFFNAEDPALCIRSPADIFTLKKRQENSLTKLQNIEGFGATSVKKLYDAIDA 534

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNI--------IAHNNDDWL 596
           RR I+L RF+F LGIRHVG   A+ LA+ YLSY  F +                 ++ W 
Sbjct: 535 RREIALHRFLFGLGIRHVGEVNAKRLARAYLSYAAFEKAALEAVPPKEGDRTDKGSEAWQ 594

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            ++ V  +G I+A+A+V+FY  P N   + ALL EV+P          S +E K +VFTG
Sbjct: 595 DMLAVEGIGSIVAEAVVDFYGEPHNREVLAALLAEVTPLDEEARVATGSPVEGKTVVFTG 654

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG++++NE+ +  
Sbjct: 655 SLERMSRDEAKAMAERHGAKTAGSVSKKTDLVVAGPGAGSKLAKATELGIEVINEDDWFK 714

Query: 717 LLQQ 720
           L+ +
Sbjct: 715 LVGE 718


>gi|27381702|ref|NP_773231.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
 gi|81735382|sp|Q89FV8|DNLJ_BRAJA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|27354871|dbj|BAC51856.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
          Length = 716

 Score =  613 bits (1580), Expect = e-173,   Method: Composition-based stats.
 Identities = 302/721 (41%), Positives = 449/721 (62%), Gaps = 13/721 (1%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K + L  +  L+  QA+ EL  L  E+  HD  YYQ   P + D+EYDAL++R +AI   
Sbjct: 7   KSKPLRDVAELTKAQAKVELMRLALELEGHDKRYYQDDAPTVTDAEYDALRQRFNAIEKR 66

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FP+   +E    P  K+G   +    KV H++P LSL+  +  ED+R F+ RI RF +  
Sbjct: 67  FPEFVSAE---SPSQKVGAAPSGRFRKVRHAVPMLSLDNAFAEEDVRDFVGRIVRFLKL- 122

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
           DD+ I F+ EPKIDG  +++RYE G+ V AA RGDG  GEDV+A IR +  +P+ L    
Sbjct: 123 DDDKIDFSAEPKIDGLSMSLRYEGGELVTAATRGDGAEGEDVTANIRTLEDVPQKLKGRN 182

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P+I EVRGEVY++K  FLALN+   A G   +ANPRN+A+G LR+ +PT   +R L FF
Sbjct: 183 VPDICEVRGEVYMTKKAFLALNERQKAAGDTIFANPRNSAAGSLRQKDPTITASRPLGFF 242

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ S +  + Q  M+      GF  N   R  ++   +++++  ++  R+ L YDI
Sbjct: 243 AYAWGEMSAMPEETQTGMIHWFERCGFKTNPLTRLCHSVEELIAFHQRIEEERAELDYDI 302

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +R+PRW I+HKF  +QA T L DI+IQ+GRTG  TPV +LE
Sbjct: 303 DGVVYKVDRIDWQERLGFVSRTPRWGIAHKFPAEQAMTVLRDIEIQVGRTGSFTPVGKLE 362

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ N TLHNEDYIKG+   G+V+R GRDIR+GD V+++RAG+VIP+VVD++++
Sbjct: 363 PVGVGGVIVQNVTLHNEDYIKGIGNKGEVLREGRDIRIGDTVVIQRAGDVIPQVVDVVLD 422

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   A+ F FP  CP      V       G+  +  RCTG  AC  Q++E LK FVSR 
Sbjct: 423 KRPKTAKEFHFPKTCPCPLHTDVTREETAAGEEGSRARCTGEFACPYQKIEHLKLFVSRR 482

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++QL +FF        ++ PADIFTL++R   +  K+E I G+G  SV NL+
Sbjct: 483 AFDIDGLGEKQLQYFFDE----GFVKEPADIFTLEKR--NAKLKLEEIEGYGATSVRNLF 536

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
            +I  RR I+LERF+++LG+RHVG   A +LA+ Y S++ F      +   + +    + 
Sbjct: 537 AAIESRRRIALERFVYALGMRHVGETTALALARGYGSWEAFHDACLKVAKGDEEAMADMD 596

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  +GD + ++I +++    N   VE L KEV        K+ +S +  K +VFTG+L+
Sbjct: 597 ALDQIGDTVIKSIADYFGESHNRGIVERLTKEVEIVDAEKPKS-NSAVAGKTVVFTGSLE 655

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K+ R +A+    +LGA VS  +S+KTD+++ G   GSKL +A + GVK++ E+++L L+ 
Sbjct: 656 KMTRDEAKATAERLGAKVSGSVSKKTDLVVAGPGAGSKLAEANKHGVKVLTEDEWLKLIG 715

Query: 720 Q 720
           +
Sbjct: 716 E 716


>gi|85714986|ref|ZP_01045971.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
 gi|85698183|gb|EAQ36055.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
          Length = 705

 Score =  613 bits (1580), Expect = e-173,   Method: Composition-based stats.
 Identities = 304/726 (41%), Positives = 448/726 (61%), Gaps = 33/726 (4%)

Query: 2   KKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHA 61
           K +   P+++L+  QAR E   L  EI  H++ YYQ   P + D+ YDA++RR +AI   
Sbjct: 4   KSKVPPPVDSLTRSQARVEHKRLVLEIEAHNERYYQQDAPTVSDAAYDAMQRRLEAIEAR 63

Query: 62  FPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKK 121
           FPDL  +   + P   +G        KV H++P LSL   ++  ++ +F+ RI RF +  
Sbjct: 64  FPDLVTA---SSPTQTVGAAPARGFAKVQHAVPMLSLGNAFSDAEVAEFVERIRRFLKLG 120

Query: 122 DDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
            D+      EPKIDG  +++RYE G+ V AA RGDG +GEDV+A +R I  +P  L    
Sbjct: 121 ADDIPAIVAEPKIDGLSLSLRYEHGELVRAATRGDGFTGEDVTANVRTIRDVPHTLRGRD 180

Query: 182 -PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P   E+RGEVY+ K DFLALN +  A G   +ANPRN+A+G LR+ +     +R L FF
Sbjct: 181 IPAACELRGEVYMLKEDFLALNKKQEAAGDTVFANPRNSAAGSLRQKDVAITASRPLKFF 240

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ ++  A+ Q++ML+ +R +GF VN  +   ++   ++ +Y  +   R+TL YDI
Sbjct: 241 AYAWGEMTDRPAETQHDMLKWLRDVGFMVNPLIELCSSVEQVLQFYRRIGEQRATLGYDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +RSPRW I+HKFA +QA T L  IDIQ+GRTG +TPVARLE
Sbjct: 301 DGVVYKVDRLDWQERLGFVSRSPRWAIAHKFAAEQAMTILRGIDIQVGRTGAMTPVARLE 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ NATLHNED I             +DI VGD V+V+RAG+VIP+VV +I+ 
Sbjct: 361 PVTVGGVVVQNATLHNEDEITR-----------KDIHVGDTVVVQRAGDVIPQVVSVIIG 409

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  +AQP+ FP  CP+C S  VR+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 410 KRPRNAQPYVFPHKCPVCGSHAVREEGE------AVRRCTGTLICPAQAVERLKHFVSRL 463

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+  F+        I  P DIFTLQ+R   +T K+ +  G+GDVSV NL+
Sbjct: 464 AFDIDGLGEKQIQEFYDD----GLIMHPVDIFTLQKRDARATKKLRDREGYGDVSVRNLF 519

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAH------NND 593
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y   +NF   +             ++
Sbjct: 520 AAIDARRKIELNRLIFALGIRHVGEGNAKLLARHYGGIENFRSAMAEAAGAQTDEGNASE 579

Query: 594 DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  +G+I+A A+VEF+  PRN+ A+  LL+E+   +   +    S +  K +V
Sbjct: 580 AYADLNNIGGIGEIVANAVVEFFAEPRNVKALNDLLEEIEV-LPVAQTRSDSAVAGKTVV 638

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L+K  R +A+    ++GA VS  +S+KTD+++ G   GSKL+ A++ GV++++E++
Sbjct: 639 FTGSLEKFTRDEAKASAERMGARVSGSVSKKTDLVVAGPGAGSKLKDAEKFGVRVISEDE 698

Query: 714 FLFLLQ 719
           +L L++
Sbjct: 699 WLKLIE 704


>gi|240850882|ref|YP_002972282.1| DNA ligase [Bartonella grahamii as4aup]
 gi|240268005|gb|ACS51593.1| DNA ligase [Bartonella grahamii as4aup]
          Length = 719

 Score =  611 bits (1576), Expect = e-172,   Method: Composition-based stats.
 Identities = 338/721 (46%), Positives = 472/721 (65%), Gaps = 17/721 (2%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           + L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L R  
Sbjct: 7   KNLTAVEAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRV- 65

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
             + P +KIG  ++    K  H+ P LSL+  ++ ED+ +F+ RI RF +  +   +  T
Sbjct: 66  --DSPSHKIGAPISEKFEKSVHAQPMLSLDNAFSSEDVTEFVERIRRFLRLPETQVLEIT 123

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRG 189
            EPKIDG  +++RYEKG+ V AA RGDG  GE+V+A  R I  IP+VL  + P+IIEVRG
Sbjct: 124 AEPKIDGLSLSLRYEKGRLVGAATRGDGTVGENVTANARTIADIPQVLQGDFPDIIEVRG 183

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSE 248
           EVY+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ SE
Sbjct: 184 EVYMGREDFQALNISQQEKGKLTFANPRNAAAGSLRQLDSRITASRKLQFFAYACGEVSE 243

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           I A+ Q EM++K++  GF +N   +   T   I+SYY++++  R +L YDIDG+VYKV++
Sbjct: 244 ILAESQMEMMKKLKEYGFVINPLTKAFKTLEEIISYYHDIEECRHSLSYDIDGIVYKVND 303

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
             LQK+LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG ++
Sbjct: 304 LMLQKRLGFVSRSPRWAIAHKFPAEKAIALLKDIDIQVGRTGALTPVARLTPITVGGVVV 363

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           TNA+LHNEDYIKG+   G+ +R GRDIRVGD V+V+RAG+VIP+V+D+I+ +R  DA  F
Sbjct: 364 TNASLHNEDYIKGIGHKGEPIREGRDIRVGDSVIVQRAGDVIPQVIDVIIEKRPKDAAVF 423

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP C S  VR++        A  RCTGGL C AQ +ER++HFV+R+AF+IEGLGK
Sbjct: 424 IFPHLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVARNAFDIEGLGK 477

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           +Q++FFF ++D A  I  PADIFTL+RRQ+ S  ++ENI GFG VSV  LYD+IN RR I
Sbjct: 478 KQVEFFFYAQDEALCIHTPADIFTLERRQEKSLIRLENIEGFGTVSVRKLYDAINARREI 537

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI-------NNIIAHNNDDWLSLIRV 601
            L RF+F+LGIRHVG   AR LA+ Y +Y  F           +      N+ W+ L  +
Sbjct: 538 PLSRFLFALGIRHVGEVNARRLARTYKNYTAFETTAMGALMPCDKANEKGNEAWMELTNI 597

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  +  AIV+FYQ   N   +  LL+EV+P         SS I  K +VFTGTL  +
Sbjct: 598 EGIGPQVGSAIVDFYQEAHNREVLSVLLEEVTPLDEEPITTASSPIAEKTIVFTGTLAHM 657

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  LS+KTD+++ G   GSKL KA++LGV++++EE +L L++++
Sbjct: 658 SRDEAKALAERLGAKTSGSLSKKTDLLVAGPGAGSKLAKAEELGVEVIDEETWLQLIEEH 717

Query: 722 N 722
           +
Sbjct: 718 D 718


>gi|163868703|ref|YP_001609915.1| NAD-dependent DNA ligase LigA [Bartonella tribocorum CIP 105476]
 gi|190359235|sp|A9IW95|DNLJ_BART1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161018362|emb|CAK01920.1| DNA ligase [Bartonella tribocorum CIP 105476]
          Length = 719

 Score =  611 bits (1574), Expect = e-172,   Method: Composition-based stats.
 Identities = 337/723 (46%), Positives = 472/723 (65%), Gaps = 17/723 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L++ +A +EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I   FP+L R 
Sbjct: 6   IKNLTVVEAERELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRV 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P +KIG  ++    K  H+ P LSL+  ++ ED+ +F+ RI RF +  +   +  
Sbjct: 66  ---DSPSHKIGAAISEKFEKSVHAQPMLSLDNAFSAEDVYEFVERIRRFLRLPETQVLEI 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYEKG+ V AA RGDG  GE+V+A  R I  IP+VL  + P++IEVR
Sbjct: 123 TAEPKIDGLSLSLRYEKGRLVRAATRGDGTVGENVTANARTIADIPQVLQGDFPDVIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GEVY+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGREDFQALNISQQEKGKLTFANPRNAAAGSLRQLDSRITASRKLQFFAYACGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           EIFA+ Q EM+ K++  GF +N   +   T   I+SYY +++  R +L YDIDG+VYKV+
Sbjct: 243 EIFAESQMEMMTKLKEYGFVINPLTKVFKTVEDIISYYRDIEERRYSLNYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQK+LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ IGG +
Sbjct: 303 DLMLQKRLGFVSRSPRWAIAHKFPAEKAMALLEDIDIQVGRTGALTPVARLTPITIGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+ +R GRDIR+GD V+++RAG+VIP+VVDI++ +R  D+  
Sbjct: 363 VTNASLHNEDYIKGIGHKGEPIREGRDIRIGDTVIIQRAGDVIPQVVDIVLEKRQKDSSA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP C S  VR++        A  RCTGGL C AQ +ER++HFV+R+AF+IEGLG
Sbjct: 423 FVFPDLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVARNAFDIEGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           K+Q++FFF ++D A  I  PADIFTL+RRQ+ S  ++ENI GFG VSV  LYD+IN RR 
Sbjct: 477 KKQVEFFFHAQDEALCIHTPADIFTLERRQEKSLIRLENIEGFGTVSVRKLYDAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII-------AHNNDDWLSLIR 600
           I L RF+F+LGIRHVG   AR LA+ Y +Y  F       +          N+ W+ L  
Sbjct: 537 IPLSRFLFALGIRHVGEVNARRLARAYQTYTAFETAAMEALMPCKQDNKEGNEAWMELTN 596

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  +  AIV+FYQ   N   +  LL+E++P         SS I  K +VFTGTL  
Sbjct: 597 IEGIGPQVGSAIVDFYQEAHNREVLAVLLEEITPLDEVPIMTASSPIAEKIIVFTGTLAH 656

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R +A+    +LGA  S  LS+KTD+++ G   GSKL KAQ+ GV++++EE ++ L++ 
Sbjct: 657 MSRDEAKALAERLGAKTSGSLSKKTDLLVAGPGAGSKLTKAQEFGVQVIDEEAWMRLIKG 716

Query: 721 YNT 723
           +N 
Sbjct: 717 HNI 719


>gi|153009084|ref|YP_001370299.1| NAD-dependent DNA ligase LigA [Ochrobactrum anthropi ATCC 49188]
 gi|166216221|sp|A6WZR6|DNLJ_OCHA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151560972|gb|ABS14470.1| DNA ligase, NAD-dependent [Ochrobactrum anthropi ATCC 49188]
          Length = 721

 Score =  610 bits (1572), Expect = e-172,   Method: Composition-based stats.
 Identities = 332/727 (45%), Positives = 470/727 (64%), Gaps = 21/727 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
            P+E L+  +A  EL  L +EI++HD+ Y+   +P I D+EYDALKRR DAI   FP L 
Sbjct: 4   TPVEKLTEPEAVSELERLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLV 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P  ++G        +V H+ P LSL   ++ +D+R F+  +YRF     DNSI
Sbjct: 64  RT---DSPSLRVGTAPVSKFAQVVHARPMLSLGNAFSDDDVRDFVGSVYRFLGPLPDNSI 120

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  ++IRYE G  +  A RGDG +GE+V+  IR I  IP  L    P ++E
Sbjct: 121 AFTAEPKIDGLSMSIRYENGILISGATRGDGTTGENVTTNIRTIAEIPNRLPAGAPSVVE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++K+DFLALN++M A G++ Y NPRN A+G LR+L+     +R L FF +  G+
Sbjct: 181 VRGEVYMAKSDFLALNEQMAAEGKQTYVNPRNTAAGSLRQLDAKVTASRKLKFFAYAWGE 240

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++ A  Q  M++  R  GFPVN   ++ +    ++++Y  +   R+ L YDIDG+VYK
Sbjct: 241 MSDMPADTQMGMVEIFREWGFPVNPLTKRLHGADELLAHYRAIGLERAQLDYDIDGVVYK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD   LQ +LG R+RSPRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARLEP+ +GG
Sbjct: 301 VDRLDLQTRLGFRSRSPRWAIAHKFPAEQATTILRGIDIQVGRTGALTPVARLEPITVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMR-GGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
            ++TNATLHNEDYIKG+   G+ +R    DIRVGD V+V+RAG+VIP++VD+++ +R  D
Sbjct: 361 VVVTNATLHNEDYIKGIGLKGERIRADEHDIRVGDTVIVQRAGDVIPQIVDVVLEKRKAD 420

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP  CP+C S  VR+         A +RCTGGL C+AQ +ER++HFVSR+AF+IE
Sbjct: 421 ATPFVFPHECPVCHSHAVREEGE------AVYRCTGGLTCAAQAVERIRHFVSRNAFDIE 474

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSIN 543
           GLG++Q++FFF +ED    I+ PADIFTLQ+RQ  S   K+ENI GFG  SV  LYD+IN
Sbjct: 475 GLGEKQVEFFFHAEDDKLKIKSPADIFTLQQRQAESPLKKLENIEGFGATSVKKLYDAIN 534

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN--------NIIAHNNDDW 595
            RR I+L RF+F LGIRHVG   A+  A+ YLSY  F +           +     N+ W
Sbjct: 535 DRREIALHRFLFGLGIRHVGEVNAKRFARAYLSYAAFEEAALEAVPPKEGDRTDKGNEAW 594

Query: 596 LSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE-KNVSSEIENKKLVF 654
             LI V  +G I+A+A+V+FY  P N   ++ L K     +      +  S +E K +VF
Sbjct: 595 QELIAVEGIGSIVAEAVVDFYAEPHNREVLDNLFKAGVTPVDEVALVSTGSPVEGKTVVF 654

Query: 655 TGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           TG+L+++ R +A+    + GA  +  +S+KTD+++ G   GSKL KA +LG+++++E+ +
Sbjct: 655 TGSLERMSRDEAKAMAERYGAKTAGSVSKKTDLVVAGPGAGSKLAKASELGIEVIDEDAW 714

Query: 715 LFLLQQY 721
             L+ + 
Sbjct: 715 FTLVGEE 721


>gi|158421773|ref|YP_001523065.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
 gi|190359227|sp|A8IGY0|DNLJ_AZOC5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158328662|dbj|BAF86147.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
          Length = 739

 Score =  608 bits (1567), Expect = e-171,   Method: Composition-based stats.
 Identities = 314/733 (42%), Positives = 459/733 (62%), Gaps = 30/733 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
            +  LS  +A  E ++L QEI+ HD  YYQ   P+I D++YD L+RR + I   FP L  
Sbjct: 14  AVSDLSATEASDEHAALSQEIASHDARYYQEDAPVISDADYDRLRRRYEDIEARFPALKN 73

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               +    K+G   +    KV H +P LSL+  ++ E++ +F+ R+ RF    +   + 
Sbjct: 74  D---DSLSRKVGAAPSAKFAKVVHQVPMLSLQNAFSDEEVEEFVARVRRFLNLAESAELA 130

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           FT EPKIDG   ++RYE G  V AA RGDG  GEDV+A +R I  IP  L+   +P+II+
Sbjct: 131 FTAEPKIDGLSCSLRYEGGVLVRAATRGDGTQGEDVTANVRTIAEIPHRLTGAGVPDIID 190

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY+ K DFLALN      G+  +ANPRNAA+G LR+L+P    +R L FF +  G+
Sbjct: 191 IRGEVYMGKADFLALNARQEEAGKPVFANPRNAAAGSLRQLDPEITRSRPLRFFAYAWGQ 250

Query: 246 TSEIFAK-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
                    Q+E++   R  G P N    +     G++++Y ++ + R++L YDIDG+VY
Sbjct: 251 AEPGPPGASQHEVVDAFRRFGLPTNPLTIRVTDAAGLLAHYRKIGAERASLGYDIDGVVY 310

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD  +LQ++LG  +RSPRW I+HKFA +QA+T +  I+IQ+GRTG LTPVA+L PV +G
Sbjct: 311 KVDSLALQERLGFVSRSPRWAIAHKFAAEQATTVIEAIEIQVGRTGALTPVAKLTPVTVG 370

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI+ +  +G+ +R G DIRVGD V+V+RAG+VIP+VV +++++R   
Sbjct: 371 GVVVSNATLHNEDYIRAIGGNGEEIREGIDIRVGDTVVVQRAGDVIPQVVSVVLDKRPAG 430

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A  + FP  CP+C S+ VR+++PKTGK  A  RCTGGL C AQ +ERL+HFVSR+AF+IE
Sbjct: 431 ATAYQFPHHCPVCNSQAVREVDPKTGKQDAVRRCTGGLICPAQAVERLRHFVSRNAFDIE 490

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG++Q   F++ +     I  PADIF LQ R + S +K+EN  G+G  S  NL+ +I  
Sbjct: 491 GLGEKQAHAFYEWK----LIAEPADIFRLQARNEQSLSKLENREGWGRTSAQNLFAAIEA 546

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE-------------------IN 585
           RR I+L+RFIF+LGIRHVG   A+ LA++Y S +                          
Sbjct: 547 RRTIALDRFIFALGIRHVGETNAKRLARHYGSVEALRDAAIGAEMPTEMEEASEETPPTR 606

Query: 586 NIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSS 645
                 N+ W  +  +  +G ++A+A+VEF++ P N   VE LLKEV+P         +S
Sbjct: 607 RRKPQGNEVWQEMTDIDGIGAVVAEAVVEFFREPHNRQVVEELLKEVTPQP-LEAVASTS 665

Query: 646 EIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG 705
            +  K +VFTG+L+++ R +A+    +LGA V+  +S KTD+++ G   GSKLEKA+ LG
Sbjct: 666 PVSGKTVVFTGSLERMTRDEAKAMAERLGAKVAGSVSGKTDLLVAGPGAGSKLEKARSLG 725

Query: 706 VKIMNEEQFLFLL 718
           VK + E+++  L+
Sbjct: 726 VKTITEDEWFDLV 738


>gi|49475845|ref|YP_033886.1| NAD-dependent DNA ligase LigA [Bartonella henselae str. Houston-1]
 gi|81647763|sp|Q6G2R5|DNLJ_BARHE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49238653|emb|CAF27899.1| DNA ligase [Bartonella henselae str. Houston-1]
          Length = 716

 Score =  606 bits (1561), Expect = e-171,   Method: Composition-based stats.
 Identities = 334/727 (45%), Positives = 473/727 (65%), Gaps = 20/727 (2%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K +   I+ L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I  
Sbjct: 1   MHKDE---IQNLTALEAASELEWLAKEITRHDVLYNRNDQPEISDAEYDALRRRNAEIEA 57

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L R   P+ P +KIG  ++    K  HS P LSL+  ++ ED+ +F+ R+ RF + 
Sbjct: 58  LFPELIR---PDSPSHKIGAPISEKFEKSVHSQPMLSLDNAFSSEDVSEFMERVRRFLRL 114

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
            +   +  T EPKIDG  +++RYE+G+ V AA RGDG+ GE+V+A  R I  IP+VL   
Sbjct: 115 PETQMLEITAEPKIDGLSLSLRYEQGRLVCAATRGDGYVGENVTANARTISDIPQVLQGK 174

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFF 239
            P+IIEVRGEVY+ + DF ALN      G+  +ANPRNAA+G LR+L+     +R L FF
Sbjct: 175 FPDIIEVRGEVYMRRADFQALNVNQQEKGKLAFANPRNAAAGSLRQLDSRITASRKLQFF 234

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ SEIFA+ Q  M++K++  GF +N  +++  +   ++SYY++++  R  L YDI
Sbjct: 235 AYACGEVSEIFAESQMGMMEKLKEYGFVINPLIKKIKSLEELISYYHDIEERRHALSYDI 294

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKV++  LQ +LG  +RSPRW I+HKF  ++A T L  IDIQ+GRTG LTPVARL 
Sbjct: 295 DGIVYKVNDLMLQMRLGFVSRSPRWAIAHKFPAEKAMTVLEGIDIQVGRTGALTPVARLA 354

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           P+ +GG +ITNA+LHNEDYIKG+ + G+ +R G DIRVGD V+V+RAG+VIP+++DI+  
Sbjct: 355 PITVGGVVITNASLHNEDYIKGIGSKGEPIREGNDIRVGDTVIVQRAGDVIPQIIDIVAE 414

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  DA  F FP  CP C S  VR++        A  RCTGGL C AQ +ER++HFVSR+
Sbjct: 415 KRSKDASAFVFPYLCPACGSYAVREIGE------AVRRCTGGLICPAQAIERIRHFVSRN 468

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+IEGLGK+Q++FFF+ +D    I  PADIFTLQRRQ+ S   +EN+ GFG VSV  LY
Sbjct: 469 AFDIEGLGKKQVEFFFQIQDETLCIHTPADIFTLQRRQEKSLVHLENMEGFGTVSVRKLY 528

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEI-------NNIIAHNN 592
           D+IN RR I L RF+F+LGIR+VG   AR LA+ Y +Y  F           + +    N
Sbjct: 529 DAINARRKIPLSRFLFALGIRYVGEVNARRLARAYQNYTAFETAAMAATMPDDKVGKEGN 588

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           + W+ L  +  +G  + +AI++FY+   N   +  LL EV+P         SS I  K +
Sbjct: 589 EAWMELTNIEGIGPQVGEAIIDFYKEVHNREVLSGLLCEVTPLDEESVMTASSPIAGKII 648

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTGTL ++ R +A+    +LGA  S  LS+KT++++ G   GSKL KAQ+LGV++++EE
Sbjct: 649 VFTGTLTRMSRDEAKALAERLGAKTSGSLSKKTNLLVAGVGGGSKLTKAQELGVEVIDEE 708

Query: 713 QFLFLLQ 719
            +L L++
Sbjct: 709 AWLQLIE 715


>gi|260433791|ref|ZP_05787762.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417619|gb|EEX10878.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
          Length = 708

 Score =  603 bits (1554), Expect = e-170,   Method: Composition-based stats.
 Identities = 299/715 (41%), Positives = 445/715 (62%), Gaps = 13/715 (1%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP++ L+ +QA++EL+ L   +   ++ Y+    P I D+EYDALKRR   I   FP L 
Sbjct: 5   IPVQELTEDQAKEELARLASALLRANELYHGQDAPEISDAEYDALKRRNLEIEARFPHLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R   P+ P  ++G   +    KV HS+  +SL   ++  D+R F+  I ++    +D+  
Sbjct: 65  R---PDSPTEQVGARPSEGFDKVRHSVRMMSLGNAFDETDVRDFVRSIQKYLGLSEDDVP 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A    +  IP+ L+   P+I+E
Sbjct: 122 EFTAEPKIDGLSLSLRYENGTLVQAATRGDGEVGENVTANALTVGDIPKALTGA-PKILE 180

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF  LN +    G K +ANPRNAA+G LR+L+P    +R L FF +  G+
Sbjct: 181 VRGEVYMSHEDFARLNQKQSESGGKLFANPRNAAAGSLRQLDPEVTRSRPLRFFAYAWGE 240

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE   + Q E L ++  LGF  N   R   +   ++++Y  ++  R+TL YDIDG+VYK
Sbjct: 241 LSEPLGQTQIEGLARLASLGFATNGLTRLCRSVEDMLAHYRTIEEQRATLGYDIDGVVYK 300

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++ +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 301 VNDLALQARLGYRSTTPRWAIAHKFPAETAWTRLEAIDIQVGRTGALSPVARLHPVTVGG 360

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI G DA G V+R G+DIRVGD V V RAG+VIPK+ D+ +++R   A
Sbjct: 361 VVVSNATLHNEDYIAGRDAKGNVIRDGKDIRVGDWVQVYRAGDVIPKIADVDLSKRPDWA 420

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF FP+ CP C S  +R+         +  RCTGG+ C AQ +E+LKHFVSR AF+IEG
Sbjct: 421 VPFEFPTKCPECGSDAIREEG------DSVRRCTGGIICPAQAVEKLKHFVSRKAFDIEG 474

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F+   DP   ++ P DIFTLQ+R + +  K+ N  G+G  SV  L+ +I+++
Sbjct: 475 LGTKQIEMFYD--DPDLPVKTPVDIFTLQQRDEANLNKLANRKGWGRQSVAKLWAAIDEK 532

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R + L R +F+LGIRHVG   +  LA +Y S++ F + +         +W  L+ +  VG
Sbjct: 533 RTVPLARLLFALGIRHVGEAASNLLANHYGSWEAFEKAMTAAADFEGPEWQELLSIDGVG 592

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +++A+ +V  +        ++ L+ +++           S +  K +VFTGTL+K+ R +
Sbjct: 593 EVMARTLVSTFAQEAERKTIDDLVAQLNVLDAERPDTSDSPVAGKTIVFTGTLEKMTRAE 652

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+     LGA VS  +S+KTDI++ G   GSK +KA +LGVK+++E+++L L+  
Sbjct: 653 AKARAEALGAKVSGSVSKKTDIVVAGPGAGSKAKKAAELGVKVLDEDEWLHLIGD 707


>gi|121602535|ref|YP_989218.1| NAD-dependent DNA ligase LigA [Bartonella bacilliformis KC583]
 gi|166215397|sp|A1UTB5|DNLJ_BARBK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120614712|gb|ABM45313.1| DNA ligase, NAD-dependent [Bartonella bacilliformis KC583]
          Length = 717

 Score =  602 bits (1553), Expect = e-170,   Method: Composition-based stats.
 Identities = 323/723 (44%), Positives = 471/723 (65%), Gaps = 16/723 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
             + L+  +A +EL  L +EI+ HD  Y  + +P I D+ YDAL+RR   I   FP+L R
Sbjct: 4   DAKNLTALEAERELEWLAKEIARHDVLYNNHDQPEISDARYDALRRRNIEIETLFPELVR 63

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +   + P  K+G  ++    K  H+   LSL+  ++ ED+ +F+ R+ RF +     ++ 
Sbjct: 64  A---DSPSYKVGAPISERFEKSVHAQAMLSLDNAFSSEDVHEFVERVRRFLRLPVTKTLE 120

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG  +++RYEKGK V AA RGDG+ GE+V+   R +  IP+VL  + P+I+EV
Sbjct: 121 MTAEPKIDGLSLSLRYEKGKLVCAATRGDGYVGENVTVNARTLSDIPQVLQGDFPDILEV 180

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVY+  +DF  LN +    G+  +ANPRNAA+G LR+L+      R L FF +G G+ 
Sbjct: 181 RGEVYMRHSDFQDLNVDQQEKGKLVFANPRNAAAGSLRQLDTRMTARRKLKFFAYGWGEV 240

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE+ AK Q EM++K++  GF +N   +       ++SYY+ ++  R  L YDIDG+VYKV
Sbjct: 241 SEMPAKSQMEMVKKLKEYGFVINPLTKVFKAVEDLISYYHFIEEGRQHLDYDIDGVVYKV 300

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++  LQ +LG  +RSPRW I+HKF  ++A   L +IDIQIGRTG LTPVARL P+ +GG 
Sbjct: 301 NDLLLQTRLGNVSRSPRWAIAHKFPAEKAMALLENIDIQIGRTGALTPVARLAPITVGGV 360

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNA+LHNEDYIKGL +  + +R GRDIR+GD V+V+RAG+VIP+++D+I+ +R   A 
Sbjct: 361 VVTNASLHNEDYIKGLGSKSESIREGRDIRIGDTVIVQRAGDVIPQIIDVIIEKRPKGAS 420

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF FPS CP C S  VR++        A  RCTGGL C AQ +ER++HFVSR+AF+IEGL
Sbjct: 421 PFVFPSLCPACGSHAVREVGE------AVRRCTGGLICPAQAIERIRHFVSRNAFDIEGL 474

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G++Q++FFF ++D    I  PADIFTLQ+RQ+ S T++EN+ GFG +SV  LYD+IN RR
Sbjct: 475 GEKQVEFFFHAQDETLRIHSPADIFTLQKRQEKSLTRLENMEGFGTLSVRKLYDAINARR 534

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQ-EINNII-----AHNNDDWLSLIR 600
            I L RF+F+LGIRHVG   AR LA+ Y +Y  F    +  ++        N++WL L  
Sbjct: 535 KIPLSRFLFALGIRHVGEVNARRLARAYQNYNAFETVAMTALMPCNKEDKGNEEWLELTS 594

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  + +AI++FYQ   N   + +LL+EV+P          S +  K +VFTGTL  
Sbjct: 595 IEGIGVRVGKAIIDFYQETHNRDVLSSLLQEVTPLPEEAAVADYSPVAGKTIVFTGTLVH 654

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R + +    +LGA  S+ +S+KTD+++ G   GSKL KA++LG++IM+EE +L L+ +
Sbjct: 655 MSRDEVKALAERLGAKASSSISKKTDLLVAGIGAGSKLTKAKELGIEIMDEESWLQLINE 714

Query: 721 YNT 723
           ++ 
Sbjct: 715 HHI 717


>gi|319408814|emb|CBI82471.1| DNA ligase [Bartonella schoenbuchensis R1]
          Length = 718

 Score =  602 bits (1553), Expect = e-170,   Method: Composition-based stats.
 Identities = 331/721 (45%), Positives = 469/721 (65%), Gaps = 16/721 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
            ++ L+  +A  EL  L +EI+ HD  Y    +P I D++YDAL+RR   I   FP+L R
Sbjct: 5   AVKNLTALEAASELEWLAKEIARHDVLYNNNDQPEISDAQYDALRRRNTEIEALFPELIR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +   + P  KIG  ++    K  H+   LSL+  ++ ED+ +F+ R+ RF +     ++ 
Sbjct: 65  T---DSPSYKIGAPVSEKFEKSVHAQAMLSLDNAFSAEDVSEFVERVRRFLRLPSTQTLE 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG  +++RYE+GK V AA RGDG++GE+V+   R I  IP+VL    P+IIEV
Sbjct: 122 MTAEPKIDGLSLSLRYEQGKLVRAATRGDGYTGENVTTNARTISDIPKVLQGEFPDIIEV 181

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVYI + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ 
Sbjct: 182 RGEVYIRQEDFQVLNINQQKEGKIAFANPRNAAAGSLRQLDSRITASRKLKFFAYAWGEV 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE+ AK Q EM+ K++  GF VN   +       ++SYY+ ++  R +L YDIDG+VYKV
Sbjct: 242 SEMPAKSQMEMVNKLKEYGFIVNPFTKVFEKVEDLISYYHFIEEQRQSLSYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           ++  LQ +LG  +RSPRW I+HKF  ++A+  L  IDIQ+GRTG LTPVARL P+ +GG 
Sbjct: 302 NDLGLQMRLGFVSRSPRWAIAHKFPAEKATALLEGIDIQVGRTGALTPVARLAPITVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHNEDYIKG+   G+ +R GRDIR+GD V+V+RAG+VIP++VDII ++R  DA 
Sbjct: 362 VVTNATLHNEDYIKGVGRKGEPIREGRDIRIGDTVIVQRAGDVIPQIVDIISSKRPKDAV 421

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF FP  CP C S  VR++        A +RCTGGL CSAQ +ER++HFVSR+AF+IEGL
Sbjct: 422 PFVFPHHCPACGSHAVREVGE------AVYRCTGGLICSAQAIERIRHFVSRNAFDIEGL 475

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           GK+Q++FFF  +D    IR P DIFTL++RQ+ + T++ENI GFG +SV  L+D+IN RR
Sbjct: 476 GKKQVEFFFNIQDETLCIRSPVDIFTLEKRQKKALTRLENIEGFGSLSVRKLFDAINARR 535

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIR 600
            I L RF+F+LGIRHVG   A+ LA+ Y +Y  F   +   I         N++W  LI 
Sbjct: 536 EIPLSRFLFALGIRHVGEVNAQRLARVYRNYTAFEAAVMAAIVPHDKTDEGNEEWTDLIS 595

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G  + +AI++FYQ   N   + ALL+EV+P          S I  K +VFTGTL  
Sbjct: 596 IEGIGVRVGRAIIDFYQEAHNRDVLSALLQEVTPLPEEAIATDYSPIAGKIIVFTGTLMS 655

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + R +A+    +LGA  S  +S+KTD++I G   GSKL KA++LGV+I++E+ +  L+++
Sbjct: 656 MSRDEAKALAERLGAKTSGSISKKTDLLIAGLGAGSKLTKAKELGVEIIDEDSWSQLIKE 715

Query: 721 Y 721
           Y
Sbjct: 716 Y 716


>gi|163731899|ref|ZP_02139346.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
 gi|161395353|gb|EDQ19675.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
          Length = 705

 Score =  601 bits (1550), Expect = e-169,   Method: Composition-based stats.
 Identities = 287/715 (40%), Positives = 440/715 (61%), Gaps = 15/715 (2%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
            +P+++L+ + A +ELS L + +   +  Y+    P + D+EYDA KRR  A+   FP L
Sbjct: 3   FVPLDSLNEKAAEEELSRLAELLEQANTAYHTKDAPFMSDAEYDAYKRRNLALEDRFPHL 62

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R+   + P + +G   +    KV+HS+  LSL   ++ ED+  F+ RI +     D   
Sbjct: 63  KRA---DSPTDVVGAAPSAGFAKVSHSMAMLSLANAFDDEDVFDFVQRIRKHLGLSDAEP 119

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           + FT EPKIDG  +++RYE G  V AA RGDG  GE+V+A    I  IP+ +    P+++
Sbjct: 120 LHFTSEPKIDGLSLSLRYENGALVQAATRGDGAVGENVTANALTINDIPQRVPNA-PDVL 178

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLG 244
           EVRGEVY+S  DF ALN++  A G K +ANPRNAA+G LR+L+          FF +  G
Sbjct: 179 EVRGEVYMSHTDFEALNEKQNAAGAKAFANPRNAAAGSLRQLDARITQNRPLRFFAYAWG 238

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             +    K Q + +++++ LGF  N    + +    +++ Y  ++  R++L YDIDG+VY
Sbjct: 239 TLTAPLGKTQSDSIERLKNLGFQTNELTDRCDGPEALLAQYRRIEERRASLDYDIDGVVY 298

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD+  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+P+ +G
Sbjct: 299 KVDDLDLQRRLGFRSTTPRWAIAHKFPAELAWTELQSIDIQVGRTGALSPVARLKPITVG 358

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G D  G V+R G+DIR GD V V RAG+VIPKV D+ +++R  +
Sbjct: 359 GVVVSNATLHNEDYIAGRDNKGGVIRDGKDIRAGDYVQVYRAGDVIPKVADVDLDKRPAE 418

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A PF FP+ CP C S  +R+         A  RCTGGL C AQ +ERLKHFVSR AF+I+
Sbjct: 419 AIPFVFPTTCPECGSDALREAG------DAVRRCTGGLICPAQAVERLKHFVSRAAFDID 472

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+K       +  PADIFTL+ R ++   +++N  G+G+ S TNL+D+I++
Sbjct: 473 GLGAKQIEQFYKD----GWVSEPADIFTLRDRYESGMQQLKNRDGWGEKSATNLFDAIDE 528

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R I L R +F+LGIRHVG   +  +A++Y ++  F +          D W  L+ +  V
Sbjct: 529 KREIPLARLLFALGIRHVGEAASNLIAQHYSTFDAFEKSTLAAQIEEGDAWDDLLSIDGV 588

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++AQ++V     P    +++ L+ ++     +   +  S +  K +VFTGTL+++ R 
Sbjct: 589 GTVMAQSLVHTMGQPAERASIDRLVAQLKVQPSKPIVSDGSPVAGKTVVFTGTLERMTRA 648

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +A+     LGA V+  +S KTD ++ G   GSK +KA +LG++ ++E+ +L L++
Sbjct: 649 EAKSRAESLGAKVAGSVSAKTDFLVAGPGAGSKAKKAVELGIRTLDEDGWLALIE 703


>gi|323702801|ref|ZP_08114460.1| DNA ligase, NAD-dependent [Desulfotomaculum nigrificans DSM 574]
 gi|323532189|gb|EGB22069.1| DNA ligase, NAD-dependent [Desulfotomaculum nigrificans DSM 574]
          Length = 669

 Score =  601 bits (1549), Expect = e-169,   Method: Composition-based stats.
 Identities = 250/708 (35%), Positives = 385/708 (54%), Gaps = 48/708 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           + +  +  L +EI+YH+  YY    P I D +YD L +    + +A+P+L     P+ P 
Sbjct: 7   EIKARVEELRREINYHNHQYYVLDNPTITDGQYDQLVQELLRLENAYPELV---SPDSPT 63

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++GGE+      V H +P LSL   ++  DLR+F  R+           + + LE KID
Sbjct: 64  QRVGGEIQKGFTAVQHRVPMLSLSNAFSENDLREFDRRVRSNL---PGEEVEYVLELKID 120

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G  I++ YE+G FV  A RGDG  GED++A +R I  IP  +  +IP  +EVRGE Y+ K
Sbjct: 121 GLAISLWYEQGVFVRGATRGDGELGEDITANLRTIKAIPLRIKESIP-FLEVRGEAYMPK 179

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQ 254
             F+ LN+     G   +ANPRNAA+G LR+L+P    +R L+ F++ +G          
Sbjct: 180 ESFVRLNEAREEAGEPLFANPRNAAAGSLRQLDPRVTASRNLSVFMYAIGHLEGANPGTH 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
             +L  ++ LGF VN   +       ++   ++ +  R  LPY IDGLV KV+    Q++
Sbjct: 240 ARLLGWLKDLGFRVNQHYKLCKDIEEVIRQIDKWQEQRFELPYAIDGLVIKVNSLDQQQR 299

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG   +SPRW I++KF  +QA + + DI I++GRTG+LTP A LEPV + G  ++ ATLH
Sbjct: 300 LGATLKSPRWAIAYKFPAEQAVSTIKDIIIRVGRTGVLTPTAILEPVQLAGTTVSKATLH 359

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NED I+            +DIR+GD+ LV++AG++IP+VV +    R    +PF+ PS C
Sbjct: 360 NEDIIR-----------QKDIRIGDQALVQKAGDIIPEVVLVFPERRTGQEKPFTMPSTC 408

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P C + VVR          AAHRCT     +  + E + HFVSR A +I GLG+  ++  
Sbjct: 409 PECNAPVVRLPGE------AAHRCTNKNCPAISR-EGIIHFVSRGAMDIMGLGESIVNQL 461

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
                 A  ++ PAD++ L+            +   G  S  NL ++I   ++ SL + +
Sbjct: 462 IM----AGLVQDPADLYDLKYEDLIK------LERMGARSSQNLLNAIAASKHNSLAQLL 511

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
            +LGIRHVG   A+ LA+++ S                     L  +P +G  IA++IV+
Sbjct: 512 VALGIRHVGERAAKILARHFGSMSALMAAT----------VEDLTVIPEIGPKIAESIVD 561

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNVSS--EIENKKLVFTGTLQKIQRHKAQEYVTQ 672
           ++  P N   ++ L +        +++       +  K  V TGTL+   R +AQ  + +
Sbjct: 562 YFARPENKTLIQRLDRAGVNMEEANQQAEPGQQPLAGKTFVITGTLEGFSRQEAQRAIEE 621

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           LG  VS  +S+KTD ++VG+NPGSK +KAQQLG+ I+NE++F+ LL+Q
Sbjct: 622 LGGKVSGSVSKKTDYVVVGENPGSKYDKAQQLGIPILNEQEFVALLKQ 669


>gi|110634347|ref|YP_674555.1| DNA ligase, NAD-dependent [Mesorhizobium sp. BNC1]
 gi|123162160|sp|Q11GT5|DNLJ_MESSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110285331|gb|ABG63390.1| DNA ligase, NAD-dependent [Chelativorans sp. BNC1]
          Length = 703

 Score =  600 bits (1547), Expect = e-169,   Method: Composition-based stats.
 Identities = 298/713 (41%), Positives = 438/713 (61%), Gaps = 18/713 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           IP++ L+ EQA+ EL+ L QEI  HD  YY    P + D+EYDAL+RR  AI  AFP+L 
Sbjct: 6   IPVDELTEEQAKDELARLAQEIGRHDRLYYSEDAPEVSDAEYDALRRRNLAIEQAFPNLI 65

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P  +IG        KV H +P LSL+  +  +D+  F+ R+ RF + +    I
Sbjct: 66  RA---DSPSKRIGAPAVEKFEKVRHKVPMLSLDNAFTDDDVVDFVARVRRFLKMEPHAPI 122

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T EPKIDG  ++IRYE G+ V AA RGDG  GE+V+A  RA+  IP VLS + PEI+E
Sbjct: 123 AMTAEPKIDGLSLSIRYENGRLVSAATRGDGQVGENVTANARAVADIPNVLSGDFPEILE 182

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY++  DFLALN+   A G++ Y NPRN A+G LR+L+ +    R L FF +  G+
Sbjct: 183 VRGEVYMTHRDFLALNERQRAEGKQTYVNPRNTAAGSLRQLDASITAARPLKFFAYAWGE 242

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE+ ++ Q  M++ ++  GF  N  +    T   ++ +Y+ ++  R+TL YDIDG+VYK
Sbjct: 243 VSEMPSQTQMGMVEALKSYGFRTNKLMCLCETARELLEHYHAIEERRATLGYDIDGVVYK 302

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++ +LQ++LG  +RSPRW I+HKFA ++A T L DIDIQ+GRTG LTPVARLEPV +GG
Sbjct: 303 VNDLALQQRLGYVSRSPRWAIAHKFAAEKAFTILRDIDIQVGRTGALTPVARLEPVTVGG 362

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++TNATLHN + I+ L            I++GD V V+RAG+VIP+++    + R  DA
Sbjct: 363 VVVTNATLHNAEEIERL-----------GIKIGDTVQVQRAGDVIPQILGYAEDRRPADA 411

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           + F FPS CP      V   +   G      RC+G  AC  Q++E L+ FVSR AF+IEG
Sbjct: 412 KEFVFPSVCPCELKTPVVRDSTAGGGEGVVRRCSGEFACPFQRIEHLRLFVSRRAFDIEG 471

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++Q++FFF+  DP   ++ PADIFTL  R   +  K+++  G+G VS  NL+ +I  +
Sbjct: 472 LGEKQIEFFFR--DPDLPVKSPADIFTLAERDAQNIKKLKDKEGWGTVSAGNLFAAIEAK 529

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L+R I+ LGIRHVG   A +LA+ Y S++ F      I   +      +  +  +G
Sbjct: 530 RTIPLDRMIYGLGIRHVGERTAVTLARGYGSWKAFHDSALAIAGGDLSAREEMDALEDIG 589

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           D +  AI  ++    N   VEAL  +V+           S +  K +VFTG L+++ R +
Sbjct: 590 DAVIDAIATYFAEEHNCRLVEALAAQVNVLEAERPV-ADSPVAGKTIVFTGALERMSRDE 648

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A++   +LGA V+  +S KTD+++ G   GSKL+KA +LG+++++E+ +   +
Sbjct: 649 AKDMAERLGAKVAGSVSSKTDLVVAGPGAGSKLKKAAELGIEVIDEDMWFQRI 701


>gi|110679832|ref|YP_682839.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
 gi|123172419|sp|Q166E0|DNLJ_ROSDO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|109455948|gb|ABG32153.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
          Length = 705

 Score =  600 bits (1546), Expect = e-169,   Method: Composition-based stats.
 Identities = 295/715 (41%), Positives = 436/715 (60%), Gaps = 15/715 (2%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
             P+++L+ + A+KELS L   +   +  Y+    PII D+++DA KRR  AI   FP L
Sbjct: 3   FAPLDSLTEKAAKKELSKLADLLDQANTAYHANDAPIISDADFDAYKRRNLAIEERFPHL 62

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R+   + P +++G   +    KV HSI  LSL   ++  D+  F+ RI +     D  +
Sbjct: 63  KRA---DSPTDRVGAAPSAGFSKVVHSIAMLSLANAFDEADVSDFVQRIRKHLGLSDIEA 119

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           + FT EPKIDG  +++RYE G  V AA RGDG  GE+V+   R IP IP  +S   P+++
Sbjct: 120 LSFTSEPKIDGLSLSLRYENGTLVQAATRGDGAIGENVTENARTIPDIPEQISNA-PDVL 178

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLG 244
           EVRGEVY+S  DF ALN    + G K +ANPRNAA+G LR+L+          FF +  G
Sbjct: 179 EVRGEVYMSHADFEALNARQASAGAKLFANPRNAAAGSLRQLDARITQSRPLRFFAYAWG 238

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
             SE   K Q + +++++  GF  N+   + N    +++ Y  ++  R++L YDIDG+VY
Sbjct: 239 TLSEPLGKTQMQSIERLQSFGFQTNDLTEKCNGPEELLAQYRRIEERRASLDYDIDGVVY 298

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD+  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+PV +G
Sbjct: 299 KVDDLDLQRRLGFRSTTPRWAIAHKFPAELAWTELQGIDIQVGRTGALSPVARLKPVTVG 358

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHNEDYI G D  G V+RGG+DIRVGD V V RAG+VIPKV D+ + +R  D
Sbjct: 359 GVVVSNATLHNEDYIAGRDNKGDVIRGGKDIRVGDFVQVYRAGDVIPKVADVDLKKRPAD 418

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A P+ FP+ CP C S  +R+         A  RCTGGL C AQ +ERLKHFVSR AF+I+
Sbjct: 419 AIPYVFPATCPECGSDALREAG------DAVRRCTGGLICPAQAVERLKHFVSRAAFDID 472

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINK 544
           GLG +Q++ F+K       I  PADIFTL+ R  +   +++N  G+G+ S  NL+D+I+ 
Sbjct: 473 GLGAKQIEQFYKD----GWISEPADIFTLRDRFGSGIQQLKNRDGWGEKSANNLFDAIDD 528

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           +R I L R IF+LGIRHVG   +  +A++Y ++  F + +      + + W  L+ +  V
Sbjct: 529 KRQIPLARLIFALGIRHVGEAASNLIAQHYSTFDAFEKSMLAAQDKDGEAWDDLLSIDGV 588

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++AQ+++          +++ L+ ++            S +  K +VFTGTL K+ R 
Sbjct: 589 GTVMAQSVIHAMGQAAERASIDRLVAQLDVQPSEAVVTDGSPVAGKTVVFTGTLSKMTRA 648

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +A+     LGA V+  +S KTD ++ G   GSK +KA +LGV+ ++E+ +L L++
Sbjct: 649 EAKSRAESLGARVAGSVSAKTDFLVAGPGAGSKAKKAAELGVQTLDEDGWLALIE 703


>gi|49474446|ref|YP_032488.1| NAD-dependent DNA ligase LigA [Bartonella quintana str. Toulouse]
 gi|81646941|sp|Q6FZ81|DNLJ_BARQU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49239950|emb|CAF26355.1| DNA ligase [Bartonella quintana str. Toulouse]
          Length = 719

 Score =  599 bits (1545), Expect = e-169,   Method: Composition-based stats.
 Identities = 338/727 (46%), Positives = 471/727 (64%), Gaps = 20/727 (2%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M K +   I+ L+  +A  EL  L +EI+ HD  Y +  +P I D+EYDAL+RR   I  
Sbjct: 1   MNKDE---IKNLTALEAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEA 57

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L RS   + P +KIG  ++    K  H+   LSL+  ++ ED+ +FI RI RF + 
Sbjct: 58  LFPELIRS---DSPSHKIGAPVSEKFEKSVHAQAMLSLDNAFSSEDICEFIVRIRRFLRL 114

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
                +  T EPKIDG  +++RYEKG+ V AA RGDG+ GE+V+A  R I  IP+VL   
Sbjct: 115 PATQILEMTAEPKIDGLSLSLRYEKGRLVCAATRGDGYIGENVTANARTISDIPKVLRGE 174

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P+IIEVRGEVY+ + +F ALN      G+  +ANPRNAA+G LR+L+P    +R L+FF
Sbjct: 175 FPDIIEVRGEVYMRRENFQALNMSQQEKGKFVFANPRNAAAGSLRQLDPRITASRKLHFF 234

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ SE FA  Q EM++K++  GF +N   +   T   I+SYY++++  R +L YDI
Sbjct: 235 AYACGEVSETFAASQMEMMKKLKEYGFFINPLTKSFKTLEEIISYYHDIEECRHSLSYDI 294

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKV++  LQ +LG  +RSPRW ++HKF  ++A   L  IDIQ+GRTG LTPVARL 
Sbjct: 295 DGIVYKVNDLKLQMRLGFVSRSPRWAVAHKFPAEKAMALLEGIDIQVGRTGALTPVARLA 354

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           P+ IGG ++TNA+LHNEDYIKG+   G+ +R GRDIRVGD V+V+RAG+VIP++VDII  
Sbjct: 355 PITIGGVVVTNASLHNEDYIKGIGHKGESIREGRDIRVGDTVIVQRAGDVIPQIVDIIAE 414

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R   A  F FP  CP C S  VR++        +  RCTGGL C AQ +ER++HFVSR+
Sbjct: 415 KRPKGASAFVFPHLCPACGSHAVREVGE------SVRRCTGGLICPAQAIERIRHFVSRN 468

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+IEGLGK+Q++FFF  +D A  I  PADIFTLQRRQ+ +  ++EN+ GFG VSV  LY
Sbjct: 469 AFDIEGLGKKQVEFFFHIQDEALCIHTPADIFTLQRRQEKALVRLENMEGFGTVSVRKLY 528

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNF----AQEI---NNIIAHNN 592
           ++IN RR + L RF+F+LGIRH+G   AR LA  Y +Y  F           + +    N
Sbjct: 529 NAINMRRKVPLSRFLFALGIRHIGEVNARRLAHAYQNYTAFETVAMAATMPYDKVGEEGN 588

Query: 593 DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKL 652
           + WL L  +  +G  + +AI++FYQ   N   + ALL+EV+P    +    SS I  K +
Sbjct: 589 EAWLELTNIEGIGPQVGEAIIDFYQEAHNREVLAALLREVTPLDEENVMTASSPIAGKTI 648

Query: 653 VFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEE 712
           VFTGTL ++ R +A+    +LGA  S  LS+KTD+++ G   GSKL KAQ LGV++++EE
Sbjct: 649 VFTGTLARMSRDEAKALAERLGAKTSGSLSKKTDLLVAGSAVGSKLAKAQGLGVEVIDEE 708

Query: 713 QFLFLLQ 719
            +L L++
Sbjct: 709 AWLQLIE 715


>gi|86749131|ref|YP_485627.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
 gi|123004307|sp|Q2IYJ4|DNLJ_RHOP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86572159|gb|ABD06716.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
          Length = 714

 Score =  598 bits (1542), Expect = e-168,   Method: Composition-based stats.
 Identities = 303/725 (41%), Positives = 442/725 (60%), Gaps = 27/725 (3%)

Query: 4   RQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFP 63
           +    I  L+  +A+ E   L  EI  H+  YYQ+  P + D+EYDAL+RR +AI   FP
Sbjct: 6   KPAPDIATLTKAKAKVEAMRLRLEIERHNSAYYQHDAPTVSDAEYDALRRRLEAIEAKFP 65

Query: 64  DLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD 123
           +L      + P   +G        KV H++P LSL   +  +++ +F+ R+ RF +    
Sbjct: 66  ELV---SASSPTQTVGAAPARGFAKVQHAVPMLSLGNAFADDEVTEFVERVQRFLRLDAV 122

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIP 182
            SI    EPKIDG  +++RYE G+ + AA RGDG +GEDV+A +R I  IP  L    IP
Sbjct: 123 PSI--VAEPKIDGLSLSLRYEHGELMRAATRGDGFTGEDVTANVRTIADIPTTLKAKTIP 180

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
              E+RGEVY+ K DFLALN      G   +ANPRN+A+G LR+ +     +R L FF +
Sbjct: 181 AACELRGEVYMLKQDFLALNKRQEEAGDTVFANPRNSAAGSLRQKDVAITASRPLKFFAY 240

Query: 242 GLGKT--SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
             G+     +    Q++ML  ++  GF VN  +    +    +++Y  +   R+ LPYDI
Sbjct: 241 AWGEMSDYPMDEPTQFKMLGWLKQAGFVVNPEITLCTSVDDALAFYRRIGEQRAALPYDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKVD    Q++LG  +RSPRW I+HKFA +QA+T L  IDIQ+GRTG LTPVARL+
Sbjct: 301 DGVVYKVDRLDYQERLGFVSRSPRWAIAHKFAAEQATTVLEKIDIQVGRTGALTPVARLQ 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG ++ NATLHNEDYIKGL   G  +R G DIR GD V+V+RAG+VIP++V ++++
Sbjct: 361 PVTVGGVVVQNATLHNEDYIKGLGNDGSPLRDGVDIREGDTVVVQRAGDVIPQIVSVVLD 420

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  DA P+ FP  CP+C S   R+         A  RCTG L C AQ +ERLKHFVSR 
Sbjct: 421 KRPADATPYHFPHKCPVCGSHAAREEGE------AVWRCTGALICPAQAVERLKHFVSRL 474

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+I+GLG++Q+  F +       ++ PADIFTLQ R   +  K+E+I G+G+ SV NL+
Sbjct: 475 AFDIDGLGEKQIVLFHER----GWVKEPADIFTLQAR--NAALKLEDIEGYGETSVRNLF 528

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA------HNND 593
            +I+ RR I L R IF+LGIRHVG   A+ LA++Y +   F   +           + ++
Sbjct: 529 AAIDARRTIELHRLIFALGIRHVGEGNAKLLARHYGTLDAFLAAMRAAAEGQTEEGNTSE 588

Query: 594 DWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLV 653
            +  L  +  +G+++A A+VEF+  PRN+ A++ALL E+   +   +    + +  K +V
Sbjct: 589 AYQDLDNIAGIGEVVAAAVVEFFAEPRNVAALDALLAELKDVLPAEQARRDTAVAGKTVV 648

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
           FTG+L K  R +A+    +LGA V+  +S+KTD ++ G + GSKL KA+ LGV ++ E++
Sbjct: 649 FTGSLTKFTRDEAKAAAERLGAKVAGSVSKKTDYVVAGADAGSKLTKAKDLGVAVLTEDE 708

Query: 714 FLFLL 718
           +L L+
Sbjct: 709 WLALI 713


>gi|300021787|ref|YP_003754398.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523608|gb|ADJ22077.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
          Length = 712

 Score =  597 bits (1540), Expect = e-168,   Method: Composition-based stats.
 Identities = 289/709 (40%), Positives = 441/709 (62%), Gaps = 23/709 (3%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
               E++ L  EI  HD+ YY+   P I D++YDAL+RR   +  A P+L R+     P 
Sbjct: 22  SVEDEIARLSAEIERHDELYYRNDAPEISDADYDALRRRLTQLEDAHPELKRAG---SPS 78

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            K+G     +  K+ H +P LSL   ++ +D+  F+ R+ RF    + + +  T EPKID
Sbjct: 79  EKVGSAPVAAFGKIAHDVPMLSLGNAFDDQDVVDFVQRVRRFLNLGESDELEITAEPKID 138

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYIS 194
           G  I+IRYE G+ V AA RGDG  GE+V+A ++ I  IP +L     P++I++RGE+Y+ 
Sbjct: 139 GLSISIRYEGGRLVQAATRGDGAEGENVTANVKTIKDIPHLLVGKDVPDVIDIRGEIYLG 198

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
             DF  LN    A G K +ANPRNAA+G LR+L+ +    R L FF +  G  S++ +  
Sbjct: 199 HKDFEKLNAAQAASGGKVFANPRNAAAGSLRQLDSSITAQRPLQFFAYAWGAASKLPSDT 258

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
           Q  ++   +  G PVN  +    +   ++ YY  ++S R+ L YDIDG+VYKV+    Q+
Sbjct: 259 QRGVVAAFKSWGLPVNPLMEITRSPDELLDYYRGIESKRAKLDYDIDGVVYKVNRLDYQE 318

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           +LG  +RSPRW I+HKFA ++A+T L  IDIQ+GRTG LTPVA+LEPV +GG +++NATL
Sbjct: 319 RLGFVSRSPRWAIAHKFAAERATTVLNKIDIQVGRTGALTPVAKLEPVTVGGVVVSNATL 378

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HNED I             +DIR GD V+V+RAG+VIP++V++++++R   A P+ FP+ 
Sbjct: 379 HNEDEISR-----------KDIREGDTVVVQRAGDVIPQIVEVVLDKRPQHAAPYKFPAV 427

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CPIC S  VR+ + +        RCTGGL C AQ  ERLKHFVSR+AF+IEGLG ++++F
Sbjct: 428 CPICGSHAVRESDEEGNAADVVRRCTGGLVCGAQLKERLKHFVSRNAFDIEGLGGEKIEF 487

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
           FF++      I+  ADIFTL++R Q S   +  + GF + SV  L+ +IN RR + L+RF
Sbjct: 488 FFET----GRIKSAADIFTLEKRDQKSDEPLTKVRGFKETSVNKLFAAINARRTVPLDRF 543

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIA--HNNDDWLSLIRVPLVGDIIAQA 611
           +F+LGIRH+G   A+ LAK Y +++     ++  I     ++ +  +  +  +G+ +  A
Sbjct: 544 LFALGIRHIGETTAKDLAKAYGTFEALRAAVDAAIQGGKGSEAYQDIDNIEGIGETVVDA 603

Query: 612 IVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           +++F+    N   ++ALLKEV+ +  +  + VSS +  K +VFTGTL K+ R++A+    
Sbjct: 604 LIDFFSEQHNQEQLDALLKEVNVTAFKRVQ-VSSPVTGKTVVFTGTLTKLTRNEAKAQAE 662

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +LGA VS  +S+KTD ++ G   GSKL+ A+ LGV +++E+ +L L+ +
Sbjct: 663 RLGAKVSGSVSKKTDYVVAGAEAGSKLDNARALGVIVLDEDGWLELIGK 711


>gi|126736446|ref|ZP_01752187.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
 gi|126713984|gb|EBA10854.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
          Length = 715

 Score =  597 bits (1539), Expect = e-168,   Method: Composition-based stats.
 Identities = 305/719 (42%), Positives = 437/719 (60%), Gaps = 16/719 (2%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           +   +P+ +LS EQA KELS L  +++  +  Y++   P I D+ YDALKRR  AI   F
Sbjct: 11  QTGDVPVASLSPEQATKELSWLATQLNAANTAYHRDDAPDISDATYDALKRRNAAIEAQF 70

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           PDL R    + P   +GG++     KV H +  LSL   ++ +D+ +F  RI ++     
Sbjct: 71  PDLKRQ---DSPSETVGGQIAEGFGKVKHVVRMLSLGNAFDDDDVHEFDQRIRKYLGLAA 127

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIP 182
           D  + +T EPKIDG  +++RYE GK + AA RGDG +GE+V+   R I  IP  ++   P
Sbjct: 128 DALLTYTAEPKIDGLSLSLRYEDGKLIQAATRGDGETGENVTNNARTIADIPAKVNGA-P 186

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
           +++EVRGEVY+S +DF ALN     VG K +ANPRNAA+G LR+L+     +R L FF +
Sbjct: 187 DVLEVRGEVYMSHDDFTALNARQAEVGGKTFANPRNAAAGSLRQLDAEITKSRPLRFFAY 246

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G  S   A+ Q   + K++ LGF  N      +    ++++Y  +++ R+ L YDIDG
Sbjct: 247 AWGDLSARLAQTQSGAIAKLKTLGFSTNPLTEACDGPAAMIAHYKGIEAQRANLGYDIDG 306

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD+ +LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV
Sbjct: 307 VVYKVDDLTLQRRLGFRSTTPRWAIAHKFPAELAWTVLEAIDIQVGRTGALSPVARLRPV 366

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG +++NATLHNEDYI G D +G  +R GRDIRVGD V V RAG+VIPKV DI +  R
Sbjct: 367 TVGGVVVSNATLHNEDYIAGRDGNGDPIREGRDIRVGDWVQVYRAGDVIPKVKDIDLARR 426

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
             DA P+  P+ CP C S  +R+         A  RCTGG+ C AQ +E+LKHF+SR AF
Sbjct: 427 PKDAMPYQMPARCPECGSDAIREEG------DAVRRCTGGIICPAQAVEKLKHFISRTAF 480

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG +Q++ F+        I  PADIFTL+ R      +++N  G+GD S  NL+D+
Sbjct: 481 DIEGLGAKQVEQFYAD----GWIATPADIFTLRVRFSEGLQQLKNREGWGDKSAANLFDA 536

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I+++R ISL R I+SLGIRHVG   A  LA +Y S+  F Q +          W  L  +
Sbjct: 537 IDEKREISLARVIYSLGIRHVGENSAALLANHYTSWTAFEQAMTAAQIGEGHAWDELNNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             VG ++A +++   Q      +++ L+KE+        +   S +  K +VFTGTL+++
Sbjct: 597 DGVGAVMATSLITTMQQEAERASIDQLIKELDVQDAE-ARATDSPVAGKTVVFTGTLERM 655

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            R +A+     LGA VS  +S KTDI+I G   GSK +KA  LG++ M+E+ +L L+  
Sbjct: 656 TRAEAKARAETLGAKVSGSVSAKTDILIAGPGAGSKAKKAADLGIETMDEDAWLSLIGD 714


>gi|298293088|ref|YP_003695027.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
 gi|296929599|gb|ADH90408.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
          Length = 725

 Score =  597 bits (1538), Expect = e-168,   Method: Composition-based stats.
 Identities = 299/735 (40%), Positives = 450/735 (61%), Gaps = 32/735 (4%)

Query: 1   MKKR-QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIA 59
           M  R   I +E L+ ++A KE + L  EI+ HD  YYQ   P + D++YDAL+RR +AI 
Sbjct: 1   MSARTPDIDVEKLTADEAAKEHARLGDEIAGHDRRYYQDDAPSVSDADYDALRRRYEAIE 60

Query: 60  HAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQ 119
             FP+L      +    K+G   +    KV H +P LSL   +  E++ +F+ R+ RF  
Sbjct: 61  AQFPELKGI---DSLSEKVGAAPSSKFAKVRHRVPMLSLGNAFADEEVEEFVARVRRFLG 117

Query: 120 KKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL 179
              D  + FT EPKIDG   ++RYE G+FV AA RGDG  GEDV+  +R I  IP  L  
Sbjct: 118 LSADAEVAFTAEPKIDGLSCSLRYENGQFVQAATRGDGFEGEDVTNNVRTIGEIPERLKG 177

Query: 180 NI-PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLN 237
           N  P I EVRGEVY+   DF A+N+   A G+  +ANPRNAA+G LR+L+P    +R L 
Sbjct: 178 NDVPGIFEVRGEVYMGHADFAAINERQSASGKPLFANPRNAAAGSLRQLDPKITASRPLR 237

Query: 238 FFVHGLGKTSE--IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTL 295
           FF +  G+ ++  + +  Q+ +++     G P N       +   ++++Y+ ++  R++L
Sbjct: 238 FFAYAWGEVADGALPSDTQFGVIEAFSRWGLPTNPLTVLCRSAQELLAHYHAIEEQRASL 297

Query: 296 PYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPV 355
            YDIDG+VYKVD  +LQ++LG  +RSPRW ++HKF  ++A T+L  I+IQ+GRTG LTPV
Sbjct: 298 GYDIDGVVYKVDSLALQQRLGFVSRSPRWALAHKFPAQRAITQLERIEIQVGRTGALTPV 357

Query: 356 ARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGG-----RDIRVGDRVLVKRAGEVI 410
           A+L P+ +GG +++NA+LHNEDYIKG+   G  +RG       DIR GD V+++RAG+VI
Sbjct: 358 AKLTPITVGGVVVSNASLHNEDYIKGIGGDGLPIRGTFNDEPVDIREGDWVVIQRAGDVI 417

Query: 411 PKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLE 470
           P+VV + +  R  DA+P+ FP+ CP C S  VR+         A  RCTGGL C AQ +E
Sbjct: 418 PQVVSVELERRPKDAKPYQFPTICPACGSHAVREDGE------AVRRCTGGLICPAQAVE 471

Query: 471 RLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQ--QTSTTKIENIL 528
           R++HFVSRDAF+IEGLG++Q+  FF        ++ PADIFTL+ R     S T+++N  
Sbjct: 472 RIRHFVSRDAFDIEGLGEKQVQAFFDW----GLVKQPADIFTLEARDSAPDSLTRLKNRD 527

Query: 529 GFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN--- 585
           G+G+ S  NL+ +I  RR + + RF+++LGIRH+G   A+ L ++Y + +   +      
Sbjct: 528 GWGETSAKNLFAAIAARRKVPVNRFLYALGIRHIGETNAKRLMRHYPTIEALREAALAAE 587

Query: 586 ---NIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKN 642
                    N+ W  +  +  +G ++A+A+V+F+  P N  A++ALLKEV+P        
Sbjct: 588 MPGEAYPKGNEAWAEMNAIEGIGAVVAEAVVDFFHEPNNEAALDALLKEVTPEPMEAVAG 647

Query: 643 VSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQ 702
             +    K +VFTG L+K+ R +A+    +LGA V+  +S+KTD ++ G + GSKL KA+
Sbjct: 648 GGAVAG-KTVVFTGALEKMTRDEAKAMAERLGAKVAGSVSKKTDYVVAGADAGSKLAKAR 706

Query: 703 QLGVKIMNEEQFLFL 717
           +LGV ++ E+++L L
Sbjct: 707 ELGVSVLTEDEWLEL 721


>gi|159044058|ref|YP_001532852.1| DNA ligase [Dinoroseobacter shibae DFL 12]
 gi|190359252|sp|A8LK52|DNLJ_DINSH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157911818|gb|ABV93251.1| DNA ligase [Dinoroseobacter shibae DFL 12]
          Length = 741

 Score =  596 bits (1536), Expect = e-168,   Method: Composition-based stats.
 Identities = 298/712 (41%), Positives = 433/712 (60%), Gaps = 15/712 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           + +EALS   ARKEL+ L + ++  +  Y++   P + D++YDALK+R  AI   FPDL 
Sbjct: 40  VAVEALSEAAARKELARLSELLARANAEYHRDDAPSLSDADYDALKQRNAAIEARFPDLK 99

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R    + P +++G   + +  KVTH++  LSL   ++ ED+R F TRI RF    +D  +
Sbjct: 100 RG---DSPSDQVGAAPSDTFSKVTHAVRMLSLANAFSDEDIRDFDTRIRRFLGLAEDAPL 156

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  V AA RGDG  GE+V+A  R I  IP  L    PE++E
Sbjct: 157 AYTAEPKIDGLSLSLRYEHGTLVQAATRGDGAVGENVTANARTIDDIPHRLDGA-PEVLE 215

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF  LN      G K +ANPRNAA+G LR+L+      R L FF +  G+
Sbjct: 216 VRGEVYMSHADFAELNARQAETGGKTFANPRNAAAGSLRQLDAEITRARPLKFFAYAWGE 275

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A+ Q E L + R  GF +N    +  T   +++ Y  +++ R+TL YDIDG+VYK
Sbjct: 276 ISAPLAETQTETLARFREFGFTINPLTVRCETPEDMLAQYRAIEAQRATLGYDIDGVVYK 335

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           +D+  LQ++LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 336 LDDLDLQRRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLAPVTVGG 395

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI+G D +G  +R G DIRVGD V V RAG+VIPK+ D+ ++ R   A
Sbjct: 396 VVVSNATLHNEDYIQGRDNTGAPIRWGTDIRVGDWVQVYRAGDVIPKIRDVDLSRRPEGA 455

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF FP+ CP C S   R+         A  RC+GGL C AQ +E+LKHFVSR A +I+G
Sbjct: 456 APFDFPTTCPECGSDAPREPG------DAVRRCSGGLICPAQAVEKLKHFVSRGALDIDG 509

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F++       I  PADIFTL+ R      +++N  G+GD S  NL+ +I+  
Sbjct: 510 LGAKQVEQFYRD----GWIAEPADIFTLRARFGQGLQQLKNREGWGDKSAENLFRAIDTA 565

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R     + +F LGIRH+G   +  LA +YL+ +     ++  +   +D W  L+ +  VG
Sbjct: 566 RTAPFAKVLFGLGIRHIGESASSLLANHYLTMEALLAAVDAAVDETSDAWADLLNIDGVG 625

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +++A+A+V          +V  LL ++ P+     +   S +  K LVFTGTL+ + R +
Sbjct: 626 EVMARALVTTLTQEAERASVNRLLAQIDPAPATPPQVGDSPVAGKTLVFTGTLETMSRAE 685

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           A+     LGA V+  +S KTD++I G   GSK  KA+ LG+++++E+ +  L
Sbjct: 686 AKATAEALGAKVAGSVSAKTDLLIAGPGAGSKATKAEALGIEVIDEDAWRVL 737


>gi|85708859|ref|ZP_01039925.1| DNA ligase [Erythrobacter sp. NAP1]
 gi|85690393|gb|EAQ30396.1| DNA ligase [Erythrobacter sp. NAP1]
          Length = 698

 Score =  595 bits (1534), Expect = e-168,   Method: Composition-based stats.
 Identities = 271/717 (37%), Positives = 402/717 (56%), Gaps = 33/717 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+  +S   A  EL  L ++I++HD  Y+    P I D EYDAL RR   +  AFP L R
Sbjct: 13  PVSQMSEADAANELMRLAKQIAHHDRLYHADDDPEISDQEYDALVRRNRELEEAFPQLVR 72

Query: 68  SEDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
               + P  ++G  +  S L KVTH +  +SL+  +N E++  +  RI R+     D  +
Sbjct: 73  E---DSPSKRVGHAVAASPLSKVTHEVRMMSLDNAFNREEVEDWTARIRRYLNLDADEEV 129

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T E KIDG   ++RYE GK + AA RGDG  GEDV+  +  I  IP+ L   +PE+ E
Sbjct: 130 AITAEDKIDGLSCSLRYENGKLMRAATRGDGQVGEDVTPNVGYISDIPQELPDGVPEVFE 189

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S+ DF ALN      G K +ANPRNAA+G LR+ + +    R L F+ +G G 
Sbjct: 190 VRGEVYMSRADFAALNTAQEEAGGKLFANPRNAAAGSLRQKDASVTAKRPLKFWAYGWGA 249

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S++  + Q +M++ +   GFP++  + +  +   ++++Y E+   R  L Y+IDG+VYK
Sbjct: 250 ASDVPCESQNDMMRMIESWGFPLSPFLTRTMSVDEMIAHYEEIGRQRPDLGYEIDGVVYK 309

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q++LG  A++PRW ++HKF  ++A T L  IDIQ+GRTG LTPV RL PV +GG
Sbjct: 310 VDRLDWQQRLGFVAKAPRWALAHKFPAEKAQTTLEAIDIQVGRTGKLTPVGRLAPVLVGG 369

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             +TN TLHN D I+ L            +R GDR++++RAG+VIP+V  +    R  + 
Sbjct: 370 VTVTNVTLHNRDEIERL-----------GVRPGDRIVIQRAGDVIPQV--VENLTRDEER 416

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +PF FP  CP C S  V +            RCTGGL C AQ+ +RL+HFVSR A +I+G
Sbjct: 417 EPFVFPDHCPECDSEAVAEEGE------VDVRCTGGLICPAQRTQRLEHFVSRKALDIDG 470

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
            G + +  FF        +  PADIF L+ R++     I  + G+ D SV NL  S+  R
Sbjct: 471 FGSKTIAQFF----ALGWLESPADIFRLKDRRE----DILALEGWQDKSVDNLLASVENR 522

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R     R +F LGIRHVG   AR L K+               A + D    L  +  +G
Sbjct: 523 REPDAARLLFGLGIRHVGEVTARDLLKHVHELPALRTIAEKARAGDEDAASELTAIDGIG 582

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             + +A+ +F+  P N+   E +L EV+P     E  + S +  K +VFTG L+ + R +
Sbjct: 583 PSVVEALGDFFHEPHNVAVWEDILSEVTPPRYEVE-TLDSPVAGKTVVFTGKLETMSRDE 641

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           A+    +LGA  +  +S KTD+++ G   GSKL+KA+QLG+++++E  +  ++ +  
Sbjct: 642 AKAQAERLGAKAAGSVSAKTDLLVAGPGAGSKLKKAEQLGIEVVDEAGWAEIVAKAG 698


>gi|83647417|ref|YP_435852.1| DNA ligase, NAD-dependent [Hahella chejuensis KCTC 2396]
 gi|123767368|sp|Q2SD47|DNLJ_HAHCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83635460|gb|ABC31427.1| DNA ligase, NAD-dependent [Hahella chejuensis KCTC 2396]
          Length = 683

 Score =  595 bits (1533), Expect = e-167,   Method: Composition-based stats.
 Identities = 250/719 (34%), Positives = 393/719 (54%), Gaps = 45/719 (6%)

Query: 12  LSI--EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           +S      ++EL++L + I+ H+  YY    P I D+EYD L RR   I   FP    + 
Sbjct: 1   MSEVPAAIQEELNTLRETINDHNYRYYTLDDPSIPDAEYDRLMRRLREIEAEFPQ---TI 57

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P+ P  ++G         V+H +P LSL+  +  +DL  F  R+    ++ +D  I + 
Sbjct: 58  TPDSPTQRVGAAPAEGFETVSHRLPMLSLDNAFEEQDLLDFDRRVRERLKEAEDARIDYC 117

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVR 188
            EPK+DG  I++ Y  G  V    RGDG +GED++A ++ +  IP  L     P  +EVR
Sbjct: 118 CEPKLDGIAISLLYRDGYLVRGVTRGDGSAGEDITANVKTVKNIPLKLRGEGYPAELEVR 177

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+Y+ K  F A+N +  A G K + NPRNAA+G LR+L+P     R L    + +G   
Sbjct: 178 GEIYLPKAAFDAINKDAAAKGEKTFVNPRNAAAGSLRQLDPRITAKRALEMCCYSVGYFE 237

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
                 Q+++L +++  G  +N+ ++ A+     + YY  + S+R  LPY+IDG+V+KV+
Sbjct: 238 GELPGTQHDILTQLQQWGLKINSQMKLASGAQECLDYYRHIMSVRDQLPYEIDGVVFKVN 297

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
              LQ++LG  +R+PRW I+HKF   +  T LL +D Q+GRTG +TPVARL+PV +GG  
Sbjct: 298 RIDLQQELGFVSRAPRWAIAHKFPAHEEMTELLAVDFQVGRTGAVTPVARLKPVFVGGVT 357

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHN D I+ L           D+ +GD V+++RAG+VIP+VV ++ + R  +A P
Sbjct: 358 VSNATLHNMDEIRRL-----------DVHIGDTVIIRRAGDVIPQVVSVVQDRRPENAVP 406

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
              P  CP+C S V++          A  RC+GGL CSAQ+ E +KHF SR A +I+GLG
Sbjct: 407 VDRPEHCPVCGSDVLQLEGE------AVARCSGGLYCSAQRKEAIKHFASRKAMDIDGLG 460

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + ++   + E     I  PA +++L+            +   G+ S  NL ++I   + 
Sbjct: 461 DRLVELLVEKE----LIDSPASLYSLKAPDVAG------LERMGEKSAQNLINAIEASKQ 510

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +  RFI++LGIR VG   A+ LA+++ +     Q               L+  P +G I
Sbjct: 511 TTFARFIYALGIREVGEATAKVLAQHFPTLDLLKQATE----------EDLVEAPDIGPI 560

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSS-EIENKKLVFTGTLQKIQRHKA 666
            A  I  F+Q   N+  ++ALL +         ++  +  +  +  V TG L    R +A
Sbjct: 561 SAGHIRSFFQQEHNLETIDALLNQGVSWPEVVVRSTETLPLSGQTAVVTGVLADYSRDEA 620

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTTL 725
           ++ +T+LGA VS  +S KT  ++ G+  GSKL KAQ LGVK+++E+ F  LL+++   L
Sbjct: 621 KDLLTRLGAKVSGSVSAKTGFVVAGEKAGSKLTKAQDLGVKVLDEDAFKQLLEEHQAHL 679


>gi|90418183|ref|ZP_01226095.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337855|gb|EAS51506.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
          Length = 703

 Score =  595 bits (1533), Expect = e-167,   Method: Composition-based stats.
 Identities = 297/714 (41%), Positives = 436/714 (61%), Gaps = 18/714 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
            +E L  ++A  EL  L  EI+ HD  YY+   P + D+EYD L+RR  AI   FP+L R
Sbjct: 5   AVETLDRDEAAAELERLAGEIAAHDRAYYREDAPTVTDAEYDTLRRRNAAIEARFPELIR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  ++G E++    K+ H++P LSL+  ++ ED+  F  R+ RF +  DD  + 
Sbjct: 65  E---DSPSARVGTEVSEKFGKIRHAVPMLSLDNAFSDEDVADFAKRVRRFLKLDDDAPLA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
            T EPKIDG  +++RYEKG+ V AA RGDG +GEDV+   R I  IP  L    PE+ EV
Sbjct: 122 ITAEPKIDGLSLSLRYEKGELVSAATRGDGATGEDVTRNARTIDDIPNRLKGKAPEVFEV 181

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKT 246
           RGEVY+S   F  LN      G+  YANPRNAA+G LR+L+      R L FF +  G+ 
Sbjct: 182 RGEVYMSHAAFTDLNARQAEEGKPVYANPRNAAAGSLRQLDAGITRARKLQFFAYAWGEA 241

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE+  + Q E++  +   GFPVN  +++  T  G++++Y+ ++  R+ L YDIDG+VYKV
Sbjct: 242 SEVPGETQTEVVAAIAGFGFPVNERMKRFETIEGLIAHYHAIEENRAGLGYDIDGVVYKV 301

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D+ +LQK+LG  +RSPRW I+HKF  +QA+T L  I+IQ+GRTG LTPVA+L+PVN+GG 
Sbjct: 302 DDLALQKRLGFVSRSPRWAIAHKFPAEQATTVLRAIEIQVGRTGALTPVAKLDPVNVGGV 361

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++ NATLHN + I+ L           D+RVGD V ++RAG+VIP+V+ I+ ++R  DA+
Sbjct: 362 MVANATLHNAEEIERL-----------DVRVGDTVQIQRAGDVIPQVLGIVADKRPEDAE 410

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           PF+FPS CP      V      +G      RCTG  AC  Q+ E LK FVSR AF+IEGL
Sbjct: 411 PFAFPSVCPCELKTDVVREETASGAQSVVRRCTGEFACPFQRREHLKLFVSRKAFDIEGL 470

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+D F+   DP F +R PADIF +  R Q    K+++  GFG+VS  NL+ +I  RR
Sbjct: 471 GDKQIDLFYD--DPDFQVRTPADIFRMHGRNQEGLKKLKDKEGFGEVSAKNLFAAIEARR 528

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I L+R IFSLGIRHVG   A++LA+ Y +++ F +    + A + +    +  +  +G 
Sbjct: 529 TIPLDRLIFSLGIRHVGETTAKTLARAYGTFEAFHEAALKVAAGDEEASGEMDALDDIGG 588

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  A   F+    N+  VE L+ E+            S +  + +VFTG+L+K+ R +A
Sbjct: 589 AVITATARFFSEDHNLKLVEDLVAELDVQPAEQPAAT-SPVSGQTIVFTGSLEKMTRDEA 647

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +     LGA V+  +S+KTD+++ G   GSKL+KA +LGV++++E+ +   + +
Sbjct: 648 KAMAEGLGAKVAGSVSKKTDLVVAGPGAGSKLKKAAELGVEVIDEDAWFVRIGR 701


>gi|296132371|ref|YP_003639618.1| DNA ligase, NAD-dependent [Thermincola sp. JR]
 gi|296030949|gb|ADG81717.1| DNA ligase, NAD-dependent [Thermincola potens JR]
          Length = 665

 Score =  595 bits (1533), Expect = e-167,   Method: Composition-based stats.
 Identities = 237/710 (33%), Positives = 373/710 (52%), Gaps = 47/710 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +    A K ++ L ++I  H+  YY   +P I D+EYD L R    +   +PDL     P
Sbjct: 1   MDKAAAAKRINELRKQIEEHNYYYYVLDRPRITDAEYDRLMRELTELEQQYPDLV---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG        V H  P LSL   ++  DL  F  R+           + + +E
Sbjct: 58  DSPTQRVGGAPAQGFQSVRHLAPMLSLSNAFSAADLLDFDKRVRNGL---AGARVEYVVE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            KIDG  +++ YE G+FV  A RGDG  GED++  ++ I +IP  L  +  E++EVRGE 
Sbjct: 115 LKIDGLAVSLLYENGRFVRGATRGDGEVGEDITQNLKTIKSIPLRLRQD-LELLEVRGEA 173

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF 250
           Y+ K +F  +N+     G   +ANPRNAA+G LR+L+P     R L+ F++ LG      
Sbjct: 174 YMPKKEFARVNEAREEAGEPLFANPRNAAAGSLRQLDPAVTAERSLDIFLYALGAVQGQA 233

Query: 251 A-KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             K   E L  ++ LGF +N  +      + ++ Y       R  LPY+IDG+V KV+  
Sbjct: 234 PVKTHLEGLHLLKDLGFRINPNIVLLPNINEVIDYCQNWTEKRHDLPYEIDGMVIKVNSL 293

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           + Q  LG  ++SPRW I++KF  +QA T++  I +++GRTG+LTP A LEPV + G+ I+
Sbjct: 294 AQQAALGFTSKSPRWAIAYKFPAEQAVTKVKRIYVRVGRTGVLTPTAELEPVRVAGSTIS 353

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           +ATLHNED I+            +DIR+GD V++ +AG+VIP++++++  +R    Q F 
Sbjct: 354 SATLHNEDIIR-----------EKDIRIGDTVIIHKAGDVIPEIIEVVKEKRTGQEQEFF 402

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C   V +       +            C  +  E L HFVSRDA +IEGLG  
Sbjct: 403 MPAECPVCHGPVRKPAGEVAVR-------CVNKDCPGRGREGLIHFVSRDAMDIEGLGPA 455

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D        A  ++  AD++ L             +   G  SV NL ++I + +   
Sbjct: 456 VIDQLL----TAGLVKDAADLYYLNAEDLIK------LERMGKKSVENLLNAIERSKQKD 505

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L   IF+LGIRHVGA   + LA ++ S     +               L  +P +G  +A
Sbjct: 506 LASLIFALGIRHVGARAGKILAAHFGSMDRLKEARQ----------EELTAIPEIGPKMA 555

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           ++IV ++++P ++  +E L            +     +E K  V TG L+K  R +AQE 
Sbjct: 556 ESIVAYFRDPAHLRLIERLRGAGVKMTQDIPERGERPLEGKTFVLTGALEKYSRKEAQEL 615

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           + +LG  VS+ +S+KTD ++ G +PGSKLEKA+QLG+ +++E+ F  +++
Sbjct: 616 IEKLGGKVSSSVSKKTDYVLAGADPGSKLEKARQLGITVISEDDFERMIK 665


>gi|319899147|ref|YP_004159240.1| DNA ligase [Bartonella clarridgeiae 73]
 gi|319403111|emb|CBI76669.1| DNA ligase [Bartonella clarridgeiae 73]
          Length = 718

 Score =  594 bits (1532), Expect = e-167,   Method: Composition-based stats.
 Identities = 324/720 (45%), Positives = 464/720 (64%), Gaps = 16/720 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  YY+  +P I D+EYDAL+RR  AI + FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYYRDDQPEISDAEYDALRRRNGAIENLFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P  KIG  ++    K  H+ P LSL+  +N +D+ +F+ RI RF +  +   I  
Sbjct: 66  ---DSPTFKIGAPISEKFEKSVHAQPMLSLDNAFNFKDVSEFVERIRRFLRFPETQIIKM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G+ GE+V+   R I  IP+VL    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYETGKLVRAVTRGNGYIGENVTTNARTIADIPQVLQGKFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNISQQKEGKLAFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEMS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+  + Q EM+++++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPVESQMEMMERLKEYGFIINPLTKVFEKLEDLISYYHFIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A   L  IDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLVLQTRLGFVSRSPRWAIAHKFPAEKAIALLESIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+    + +R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 VTNASLHNEDYIKGIGYKNEPIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPRDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+         A  RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FVFPHLCPVCGSHAVREKGE------AVRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    I  PADIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDETLCIHSPADIFTLQRRQENSLKRLENMEGFGVVSVRKLYNAINARRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           +SL RF+F+LGIRHVG   A+ LA+ Y +Y  F     + I      +  N+ W+ L  +
Sbjct: 537 VSLSRFLFALGIRHVGEVNAQRLARAYQNYTAFETAAMSAIMPSDKFSKGNEIWVELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  + +AI++FYQ   N   + ALLKEV+P      +   S +  K +VFTGTL+ +
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRDVLLALLKEVTPFHEVPVEIDYSPLAGKIIVFTGTLEHM 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  +S+K D ++ G   GSKL KAQQLGV++++E+ +L L+  +
Sbjct: 657 SRDEAKALAERLGAKTSNSISKKVDFLVSGFGAGSKLAKAQQLGVEVLDEKSWLKLIDGH 716


>gi|227356188|ref|ZP_03840577.1| DNA ligase [Proteus mirabilis ATCC 29906]
 gi|227163652|gb|EEI48568.1| DNA ligase [Proteus mirabilis ATCC 29906]
          Length = 675

 Score =  594 bits (1532), Expect = e-167,   Method: Composition-based stats.
 Identities = 246/715 (34%), Positives = 404/715 (56%), Gaps = 49/715 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           +  ++++  L   + +H+  Y+    P I D+EYD L  +  A+    P+L     P+ P
Sbjct: 3   QNIQQQIDELRVTLRHHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELI---TPDSP 59

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G     +  +V H IP LSL+  ++      F  R+      K++  I F  E K+
Sbjct: 60  TQRVGALPLTAFEQVRHEIPMLSLDNAFDETTYLAFDKRLRERL--KNNEEITFCCELKL 117

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYI 193
           DG  +++ YE G+ V AA RGDG +GE+++  +R I  IP  L  +  P  IE+RGEV++
Sbjct: 118 DGLAVSLLYENGRLVQAATRGDGTTGENITENVRTIKAIPLRLYGDNIPARIEIRGEVFM 177

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIFA 251
           ++  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G        
Sbjct: 178 TEKGFEHLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELP 237

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
              Y  LQ+ +  G PV++ ++       ++ +Y+ +  IR  L +DIDG+V KVD+ +L
Sbjct: 238 TSHYARLQQFKKWGLPVSDAIKLCTGTKAVLDFYHHVAEIRPNLGFDIDGVVIKVDDIAL 297

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q++LG  +R+PRW I++KF  ++  T + D++ Q+GRTG +TPVARL+PV + G +++NA
Sbjct: 298 QEELGFVSRAPRWAIAYKFQAQEQMTVIKDVEFQVGRTGAITPVARLDPVQVAGVIVSNA 357

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D I+ L            +R+GD V+++RAG+VIP+VV +I  +R  +AQ   FP
Sbjct: 358 TLHNADEIERL-----------GLRIGDTVVIRRAGDVIPQVVSVIEEKRPENAQEIVFP 406

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           + CPICQS + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + +
Sbjct: 407 TQCPICQSDIERIEGE------AVARCTGGLICAAQRKEALKHFVSRRAMDVDGMGDKII 460

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           D   + E     ++ PAD+F L  +  +       +   G+ S   L +++ K ++ +  
Sbjct: 461 DQLVEKE----YVKTPADLFRLDEKILSG------LERMGEKSAKKLLNALEKAKSTTFA 510

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RFI++LGIR VG   A  L  +++S +   +           +  +L  VP VGDI+A+ 
Sbjct: 511 RFIYALGIREVGEATANGLTAHFVSLEALREA----------NIEALKAVPDVGDIVAKH 560

Query: 612 IVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +V F+Q   N   ++ L+ ++  +         +   +    K +V TG+L ++ R +A+
Sbjct: 561 VVNFFQEEHNKNVIDQLVNDIGITWPAPVVATHEAGDNPFAGKTVVLTGSLSQLTRDEAK 620

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           + +  LGA VS  +S+KTD++I G+  GSKL KA +LG+ +++E++ + LL+Q  
Sbjct: 621 DRLVALGAKVSGSVSKKTDMVIAGEAAGSKLAKANELGITVIDEDEMIRLLEQSK 675


>gi|16130337|ref|NP_416906.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109225|ref|AP_003005.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           W3110]
 gi|170019306|ref|YP_001724260.1| NAD-dependent DNA ligase LigA [Escherichia coli ATCC 8739]
 gi|170082020|ref|YP_001731340.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188495579|ref|ZP_03002849.1| DNA ligase, NAD-dependent [Escherichia coli 53638]
 gi|238901574|ref|YP_002927370.1| DNA ligase, NAD(+)-dependent [Escherichia coli BW2952]
 gi|256021895|ref|ZP_05435760.1| NAD-dependent DNA ligase LigA [Escherichia sp. 4_1_40B]
 gi|300951893|ref|ZP_07165701.1| DNA ligase, NAD-dependent [Escherichia coli MS 116-1]
 gi|300957240|ref|ZP_07169472.1| DNA ligase, NAD-dependent [Escherichia coli MS 175-1]
 gi|301023745|ref|ZP_07187485.1| DNA ligase, NAD-dependent [Escherichia coli MS 196-1]
 gi|312973347|ref|ZP_07787519.1| DNA ligase, NAD-dependent [Escherichia coli 1827-70]
 gi|2506362|sp|P15042|DNLJ_ECOLI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781324|sp|B1XA82|DNLJ_ECODH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781325|sp|B1IX60|DNLJ_ECOLC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|149242732|pdb|2OWO|A Chain A, Last Stop On The Road To Repair: Structure Of E.Coli Dna
           Ligase Bound To Nicked Dna-Adenylate
 gi|146613|gb|AAA24070.1| DNA ligase (EC 6.5.1.2) [Escherichia coli]
 gi|1788750|gb|AAC75464.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85675396|dbj|BAA16282.2| DNA ligase, NAD(+)-dependent [Escherichia coli str. K12 substr.
           W3110]
 gi|169754234|gb|ACA76933.1| DNA ligase, NAD-dependent [Escherichia coli ATCC 8739]
 gi|169889855|gb|ACB03562.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188490778|gb|EDU65881.1| DNA ligase, NAD-dependent [Escherichia coli 53638]
 gi|238860822|gb|ACR62820.1| DNA ligase, NAD(+)-dependent [Escherichia coli BW2952]
 gi|260448502|gb|ACX38924.1| DNA ligase, NAD-dependent [Escherichia coli DH1]
 gi|299880716|gb|EFI88927.1| DNA ligase, NAD-dependent [Escherichia coli MS 196-1]
 gi|300315993|gb|EFJ65777.1| DNA ligase, NAD-dependent [Escherichia coli MS 175-1]
 gi|300448878|gb|EFK12498.1| DNA ligase, NAD-dependent [Escherichia coli MS 116-1]
 gi|309702699|emb|CBJ02028.1| DNA ligase [Escherichia coli ETEC H10407]
 gi|310331942|gb|EFP99177.1| DNA ligase, NAD-dependent [Escherichia coli 1827-70]
 gi|315137042|dbj|BAJ44201.1| NAD-dependent DNA ligase LigA [Escherichia coli DH1]
 gi|315615662|gb|EFU96294.1| DNA ligase, NAD-dependent [Escherichia coli 3431]
 gi|323936436|gb|EGB32725.1| DNA ligase [Escherichia coli E1520]
 gi|323941344|gb|EGB37529.1| DNA ligase [Escherichia coli E482]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|82777805|ref|YP_404154.1| NAD-dependent DNA ligase LigA [Shigella dysenteriae Sd197]
 gi|309784866|ref|ZP_07679499.1| DNA ligase, NAD-dependent [Shigella dysenteriae 1617]
 gi|123728534|sp|Q32DE2|DNLJ_SHIDS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81241953|gb|ABB62663.1| DNA ligase [Shigella dysenteriae Sd197]
 gi|308927236|gb|EFP72710.1| DNA ligase, NAD-dependent [Shigella dysenteriae 1617]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTILAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGSEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++ +Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLVFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D++   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDSREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|323170330|gb|EFZ55983.1| DNA ligase, NAD-dependent [Escherichia coli LT-68]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 245/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGVPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +S+ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNSLEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|301022290|ref|ZP_07186186.1| DNA ligase, NAD-dependent [Escherichia coli MS 69-1]
 gi|300397609|gb|EFJ81147.1| DNA ligase, NAD-dependent [Escherichia coli MS 69-1]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|324009590|gb|EGB78809.1| DNA ligase, NAD-dependent [Escherichia coli MS 57-2]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y+E++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHEVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|157156100|ref|YP_001463741.1| NAD-dependent DNA ligase LigA [Escherichia coli E24377A]
 gi|193066723|ref|ZP_03047750.1| DNA ligase, NAD-dependent [Escherichia coli E22]
 gi|194430461|ref|ZP_03062941.1| DNA ligase, NAD-dependent [Escherichia coli B171]
 gi|209919893|ref|YP_002293977.1| NAD-dependent DNA ligase LigA [Escherichia coli SE11]
 gi|218554944|ref|YP_002387857.1| NAD-dependent DNA ligase LigA [Escherichia coli IAI1]
 gi|218696047|ref|YP_002403714.1| NAD-dependent DNA ligase LigA [Escherichia coli 55989]
 gi|256017438|ref|ZP_05431303.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
 gi|260845052|ref|YP_003222830.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O103:H2 str.
           12009]
 gi|260856513|ref|YP_003230404.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O26:H11 str.
           11368]
 gi|260869108|ref|YP_003235510.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O111:H- str.
           11128]
 gi|293446772|ref|ZP_06663194.1| DNA ligase [Escherichia coli B088]
 gi|300817349|ref|ZP_07097566.1| DNA ligase, NAD-dependent [Escherichia coli MS 107-1]
 gi|300820921|ref|ZP_07101071.1| DNA ligase, NAD-dependent [Escherichia coli MS 119-7]
 gi|300903139|ref|ZP_07121073.1| DNA ligase, NAD-dependent [Escherichia coli MS 84-1]
 gi|300921341|ref|ZP_07137704.1| DNA ligase, NAD-dependent [Escherichia coli MS 115-1]
 gi|301306250|ref|ZP_07212323.1| DNA ligase, NAD-dependent [Escherichia coli MS 124-1]
 gi|301328910|ref|ZP_07221944.1| DNA ligase, NAD-dependent [Escherichia coli MS 78-1]
 gi|307312589|ref|ZP_07592222.1| DNA ligase, NAD-dependent [Escherichia coli W]
 gi|309794543|ref|ZP_07688966.1| DNA ligase, NAD-dependent [Escherichia coli MS 145-7]
 gi|331669152|ref|ZP_08370000.1| DNA ligase, NAD-dependent [Escherichia coli TA271]
 gi|331678399|ref|ZP_08379074.1| DNA ligase, NAD-dependent [Escherichia coli H591]
 gi|332278439|ref|ZP_08390852.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
 gi|190359253|sp|A7ZPL2|DNLJ_ECO24 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781319|sp|B7LCF6|DNLJ_ECO55 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781323|sp|B7M6S1|DNLJ_ECO8A RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781327|sp|B6I4Y8|DNLJ_ECOSE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157078130|gb|ABV17838.1| DNA ligase, NAD-dependent [Escherichia coli E24377A]
 gi|192925627|gb|EDV80294.1| DNA ligase, NAD-dependent [Escherichia coli E22]
 gi|194411494|gb|EDX27836.1| DNA ligase, NAD-dependent [Escherichia coli B171]
 gi|209913152|dbj|BAG78226.1| DNA ligase [Escherichia coli SE11]
 gi|218352779|emb|CAU98567.1| DNA ligase, NAD(+)-dependent [Escherichia coli 55989]
 gi|218361712|emb|CAQ99309.1| DNA ligase, NAD(+)-dependent [Escherichia coli IAI1]
 gi|257755162|dbj|BAI26664.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O26:H11 str.
           11368]
 gi|257760199|dbj|BAI31696.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O103:H2 str.
           12009]
 gi|257765464|dbj|BAI36959.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O111:H- str.
           11128]
 gi|291323602|gb|EFE63030.1| DNA ligase [Escherichia coli B088]
 gi|300404835|gb|EFJ88373.1| DNA ligase, NAD-dependent [Escherichia coli MS 84-1]
 gi|300411729|gb|EFJ95039.1| DNA ligase, NAD-dependent [Escherichia coli MS 115-1]
 gi|300526674|gb|EFK47743.1| DNA ligase, NAD-dependent [Escherichia coli MS 119-7]
 gi|300529975|gb|EFK51037.1| DNA ligase, NAD-dependent [Escherichia coli MS 107-1]
 gi|300838493|gb|EFK66253.1| DNA ligase, NAD-dependent [Escherichia coli MS 124-1]
 gi|300844712|gb|EFK72472.1| DNA ligase, NAD-dependent [Escherichia coli MS 78-1]
 gi|306907512|gb|EFN38016.1| DNA ligase, NAD-dependent [Escherichia coli W]
 gi|308121999|gb|EFO59261.1| DNA ligase, NAD-dependent [Escherichia coli MS 145-7]
 gi|315061736|gb|ADT76063.1| DNA ligase, NAD(+)-dependent [Escherichia coli W]
 gi|315256427|gb|EFU36395.1| DNA ligase, NAD-dependent [Escherichia coli MS 85-1]
 gi|320199974|gb|EFW74563.1| DNA ligase [Escherichia coli EC4100B]
 gi|323156318|gb|EFZ42476.1| DNA ligase, NAD-dependent [Escherichia coli EPECa14]
 gi|323159458|gb|EFZ45441.1| DNA ligase, NAD-dependent [Escherichia coli E128010]
 gi|323177463|gb|EFZ63051.1| DNA ligase, NAD-dependent [Escherichia coli 1180]
 gi|323184284|gb|EFZ69660.1| DNA ligase, NAD-dependent [Escherichia coli 1357]
 gi|323377683|gb|ADX49951.1| DNA ligase, NAD-dependent [Escherichia coli KO11]
 gi|323944634|gb|EGB40701.1| DNA ligase [Escherichia coli H120]
 gi|324020175|gb|EGB89394.1| DNA ligase, NAD-dependent [Escherichia coli MS 117-3]
 gi|324118125|gb|EGC12023.1| DNA ligase [Escherichia coli E1167]
 gi|331064346|gb|EGI36257.1| DNA ligase, NAD-dependent [Escherichia coli TA271]
 gi|331074859|gb|EGI46179.1| DNA ligase, NAD-dependent [Escherichia coli H591]
 gi|332100791|gb|EGJ04137.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|301648064|ref|ZP_07247828.1| DNA ligase, NAD-dependent [Escherichia coli MS 146-1]
 gi|307139053|ref|ZP_07498409.1| NAD-dependent DNA ligase LigA [Escherichia coli H736]
 gi|331643032|ref|ZP_08344167.1| DNA ligase, NAD-dependent [Escherichia coli H736]
 gi|301073835|gb|EFK88641.1| DNA ligase, NAD-dependent [Escherichia coli MS 146-1]
 gi|331039830|gb|EGI12050.1| DNA ligase, NAD-dependent [Escherichia coli H736]
          Length = 671

 Score =  594 bits (1531), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K ++NPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFSNPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|293415682|ref|ZP_06658325.1| DNA ligase [Escherichia coli B185]
 gi|291433330|gb|EFF06309.1| DNA ligase [Escherichia coli B185]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|300923365|ref|ZP_07139409.1| DNA ligase, NAD-dependent [Escherichia coli MS 182-1]
 gi|300420362|gb|EFK03673.1| DNA ligase, NAD-dependent [Escherichia coli MS 182-1]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKGFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|331673883|ref|ZP_08374646.1| DNA ligase, NAD-dependent [Escherichia coli TA280]
 gi|331069156|gb|EGI40548.1| DNA ligase, NAD-dependent [Escherichia coli TA280]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPTPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|157161876|ref|YP_001459194.1| NAD-dependent DNA ligase LigA [Escherichia coli HS]
 gi|253772690|ref|YP_003035521.1| NAD-dependent DNA ligase LigA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162394|ref|YP_003045502.1| NAD-dependent DNA ligase LigA [Escherichia coli B str. REL606]
 gi|297517308|ref|ZP_06935694.1| NAD-dependent DNA ligase LigA [Escherichia coli OP50]
 gi|300928569|ref|ZP_07144093.1| DNA ligase, NAD-dependent [Escherichia coli MS 187-1]
 gi|190359254|sp|A8A2Q7|DNLJ_ECOHS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157067556|gb|ABV06811.1| DNA ligase, NAD-dependent [Escherichia coli HS]
 gi|242378018|emb|CAQ32789.1| DNA ligase [Escherichia coli BL21(DE3)]
 gi|253323734|gb|ACT28336.1| DNA ligase, NAD-dependent [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974295|gb|ACT39966.1| NAD-dependent DNA ligase LigA [Escherichia coli B str. REL606]
 gi|253978462|gb|ACT44132.1| NAD-dependent DNA ligase LigA [Escherichia coli BL21(DE3)]
 gi|300463441|gb|EFK26934.1| DNA ligase, NAD-dependent [Escherichia coli MS 187-1]
 gi|323961212|gb|EGB56824.1| DNA ligase [Escherichia coli H489]
 gi|323970900|gb|EGB66151.1| DNA ligase [Escherichia coli TA007]
 gi|332344237|gb|AEE57571.1| DNA ligase, NAD-dependent LigA [Escherichia coli UMNK88]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|218700877|ref|YP_002408506.1| NAD-dependent DNA ligase LigA [Escherichia coli IAI39]
 gi|254781321|sp|B7NPU7|DNLJ_ECO7I RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218370863|emb|CAR18680.1| DNA ligase, NAD(+)-dependent [Escherichia coli IAI39]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V K++  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKINSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|146615|gb|AAA24071.1| lig peptide [Escherichia coli]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G        ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLARFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|215487666|ref|YP_002330097.1| NAD-dependent DNA ligase LigA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312967700|ref|ZP_07781915.1| DNA ligase, NAD-dependent [Escherichia coli 2362-75]
 gi|254781317|sp|B7UGB2|DNLJ_ECO27 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|215265738|emb|CAS10145.1| DNA ligase, NAD(+)-dependent [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312287897|gb|EFR15802.1| DNA ligase, NAD-dependent [Escherichia coli 2362-75]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 391/711 (54%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L  L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLIELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y+E++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHEVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------VKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|218690549|ref|YP_002398761.1| NAD-dependent DNA ligase LigA [Escherichia coli ED1a]
 gi|254781322|sp|B7MY64|DNLJ_ECO81 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218428113|emb|CAR09030.2| DNA ligase, NAD(+)-dependent [Escherichia coli ED1a]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y+E++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHEVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGLKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|293410811|ref|ZP_06654387.1| DNA ligase [Escherichia coli B354]
 gi|291471279|gb|EFF13763.1| DNA ligase [Escherichia coli B354]
          Length = 671

 Score =  594 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|325496534|gb|EGC94393.1| NAD-dependent DNA ligase LigA [Escherichia fergusonii ECD227]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRSGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|320185101|gb|EFW59881.1| DNA ligase [Shigella flexneri CDC 796-83]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 245/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++IVG+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIVGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|238756322|ref|ZP_04617636.1| DNA ligase [Yersinia ruckeri ATCC 29473]
 gi|238705475|gb|EEP97878.1| DNA ligase [Yersinia ruckeri ATCC 29473]
          Length = 674

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/715 (33%), Positives = 400/715 (55%), Gaps = 47/715 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L      +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRASLRHHEHQYHVLDAPEIPDAEYDRLMGELRELEAQHPELITA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +   V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEPVRHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELIRAATRGDGTTGENITANVRTIHAIPLRLQGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LND+    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNDDARRKGGKIFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLVDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               +E LQ+ +  G PV+  V++      ++++Y++++  R+ L +DIDG+V KVD   
Sbjct: 236 PSSHFERLQQFKAWGLPVSERVQRCTGVDQVIAFYHQVEQDRAHLGFDIDGVVIKVDALD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQMTQVREVEFQVGRTGAITPVARLEPVLVAGVMVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP++V ++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVMVRRAGDVIPQIVGVVIDERPADAREIIF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RC+GGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PEHCPVCGSDIERIEGE------AVARCSGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + E     +  PAD+F L      S   +  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKE----YVHNPADLFNL------SAGILTGLDRMGPKSAQNLVAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAAHLAAHFRTLENLRAA----------DVEALKAVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR--HEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   ++ L + +S    +      + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLSEEHNQQVIQQLEQVISWPEPQLIIATEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +  +
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIQVIDEAEMIRLLGESES 673


>gi|15832537|ref|NP_311310.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str. Sakai]
 gi|168768500|ref|ZP_02793507.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4486]
 gi|168778374|ref|ZP_02803381.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4076]
 gi|208813694|ref|ZP_03255023.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4045]
 gi|208821178|ref|ZP_03261498.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4042]
 gi|209399429|ref|YP_002271890.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4115]
 gi|217326968|ref|ZP_03443051.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. TW14588]
 gi|254794365|ref|YP_003079202.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223146|ref|ZP_05937427.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259301|ref|ZP_05951834.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283640|ref|YP_003500458.1| DNA ligase [Escherichia coli O55:H7 str. CB9615]
 gi|166215595|sp|Q8XBL5|DNLJ_ECO57 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781320|sp|B5YZV8|DNLJ_ECO5E RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|13362753|dbj|BAB36706.1| DNA ligase [Escherichia coli O157:H7 str. Sakai]
 gi|189003243|gb|EDU72229.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4076]
 gi|189362250|gb|EDU80669.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4486]
 gi|208734971|gb|EDZ83658.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4045]
 gi|208741301|gb|EDZ88983.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4042]
 gi|209160829|gb|ACI38262.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4115]
 gi|209764248|gb|ACI80436.1| DNA ligase [Escherichia coli]
 gi|209764250|gb|ACI80437.1| DNA ligase [Escherichia coli]
 gi|209764252|gb|ACI80438.1| DNA ligase [Escherichia coli]
 gi|209764256|gb|ACI80440.1| DNA ligase [Escherichia coli]
 gi|217319335|gb|EEC27760.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. TW14588]
 gi|254593765|gb|ACT73126.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763513|gb|ADD57474.1| DNA ligase [Escherichia coli O55:H7 str. CB9615]
 gi|320188751|gb|EFW63410.1| DNA ligase [Escherichia coli O157:H7 str. EC1212]
 gi|320640925|gb|EFX10409.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str. G5101]
 gi|320646206|gb|EFX15133.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H- str.
           493-89]
 gi|320651712|gb|EFX20092.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H- str. H
           2687]
 gi|320657097|gb|EFX24906.1| NAD-dependent DNA ligase LigA [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320662857|gb|EFX30185.1| NAD-dependent DNA ligase LigA [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667743|gb|EFX34654.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326340214|gb|EGD64018.1| DNA ligase [Escherichia coli O157:H7 str. 1125]
 gi|326344216|gb|EGD67977.1| DNA ligase [Escherichia coli O157:H7 str. 1044]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P++CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTYCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|197285679|ref|YP_002151551.1| NAD-dependent DNA ligase LigA [Proteus mirabilis HI4320]
 gi|254781393|sp|B4EZR2|DNLJ_PROMH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194683166|emb|CAR43788.1| DNA ligase [Proteus mirabilis HI4320]
          Length = 675

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 246/715 (34%), Positives = 403/715 (56%), Gaps = 49/715 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           +  ++++  L   + +H+  Y+    P I D+EYD L  +  A+    P+L     P+ P
Sbjct: 3   QNIQQQIDELRVTLRHHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELI---TPDSP 59

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G     +  +V H IP LSL+  ++      F  R+      K++  I F  E K+
Sbjct: 60  TQRVGALPLTAFEQVRHEIPMLSLDNAFDETTYLAFDKRLRERL--KNNEEITFCCELKL 117

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYI 193
           DG  +++ YE G+ V AA RGDG +GE+++  +R I  IP  L  +  P  IE+RGEV++
Sbjct: 118 DGLAVSLLYENGRLVQAATRGDGTTGENITENVRTIKAIPLRLYGDNIPARIEIRGEVFM 177

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIFA 251
           ++  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G        
Sbjct: 178 TEKGFEHLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELP 237

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
              Y  LQ+ +  G PV++ ++       ++ +Y+ +  IR  L +DIDG+V KVD+ +L
Sbjct: 238 TSHYARLQQFKKWGLPVSDAIKLCTGTKAVLDFYHHVAEIRPNLGFDIDGVVIKVDDIAL 297

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q++LG  +R+PRW I++KF  ++  T + D++ Q+GRTG +TPVARL+PV + G +++NA
Sbjct: 298 QEELGFVSRAPRWAIAYKFQAQEQMTVIKDVEFQVGRTGAITPVARLDPVQVAGVIVSNA 357

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D I+ L            +R+GD V+++RAG+VIP+VV +I  +R  +AQ   FP
Sbjct: 358 TLHNADEIERL-----------GLRIGDTVVIRRAGDVIPQVVSVIEEKRPENAQEIVFP 406

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           + CPICQS + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + +
Sbjct: 407 TQCPICQSDIERIEGE------AVARCTGGLICAAQRKEALKHFVSRRAMDVDGMGDKII 460

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           D   + E     ++ PAD+F L  +  +       +   G+ S   L +++ K ++ +  
Sbjct: 461 DQLVEKE----YVKTPADLFRLDEKILSG------LERMGEKSAKKLLNALEKAKSTTFA 510

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RFI++LGIR VG   A  L  +++S +   +           +  +L  VP VGDI+A+ 
Sbjct: 511 RFIYALGIREVGEATANGLTAHFVSLEALREA----------NIEALKAVPDVGDIVAKH 560

Query: 612 IVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +V F+Q   N   ++ L+ ++  +         +   +    K +V TG+L ++ R +A+
Sbjct: 561 VVNFFQEEHNKNVIDQLVNDIGITWPAPVVATHEAGDNPFAGKTVVLTGSLSQLTRDEAK 620

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           + +  LGA VS  +S+KTD++I G+  GSKL KA +LG+ +++E++ + LL Q  
Sbjct: 621 DRLVALGAKVSGSVSKKTDMVIAGEAAGSKLAKANELGITVIDEDEMIRLLDQSK 675


>gi|320196260|gb|EFW70884.1| DNA ligase [Escherichia coli WV_060327]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------VKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|170767420|ref|ZP_02901873.1| DNA ligase, NAD-dependent [Escherichia albertii TW07627]
 gi|170123754|gb|EDS92685.1| DNA ligase, NAD-dependent [Escherichia albertii TW07627]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQKLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLRGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y +++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKEWGLPVSDRVTLCESAEEVLAFYRKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEELGFVARAPRWAVAFKFPAQEQMTYVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATATGLAAYFGTLETLEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLIELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|281179485|dbj|BAI55815.1| DNA ligase [Escherichia coli SE15]
          Length = 671

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHKVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|323967844|gb|EGB63256.1| DNA ligase [Escherichia coli M863]
 gi|327252066|gb|EGE63738.1| DNA ligase, NAD-dependent [Escherichia coli STEC_7v]
          Length = 671

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|91211748|ref|YP_541734.1| NAD-dependent DNA ligase LigA [Escherichia coli UTI89]
 gi|117624619|ref|YP_853532.1| NAD-dependent DNA ligase LigA [Escherichia coli APEC O1]
 gi|218559359|ref|YP_002392272.1| NAD-dependent DNA ligase LigA [Escherichia coli S88]
 gi|237704934|ref|ZP_04535415.1| NAD-dependent DNA ligase LigA [Escherichia sp. 3_2_53FAA]
 gi|331658566|ref|ZP_08359510.1| DNA ligase, NAD-dependent [Escherichia coli TA206]
 gi|123084405|sp|Q1R8W1|DNLJ_ECOUT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215402|sp|A1ADS8|DNLJ_ECOK1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781318|sp|B7MHR5|DNLJ_ECO45 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91073322|gb|ABE08203.1| DNA ligase [Escherichia coli UTI89]
 gi|115513743|gb|ABJ01818.1| NAD-dependent DNA ligase LigA [Escherichia coli APEC O1]
 gi|218366128|emb|CAR03873.1| DNA ligase, NAD(+)-dependent [Escherichia coli S88]
 gi|226901300|gb|EEH87559.1| NAD-dependent DNA ligase LigA [Escherichia sp. 3_2_53FAA]
 gi|294491726|gb|ADE90482.1| DNA ligase, NAD-dependent [Escherichia coli IHE3034]
 gi|307626016|gb|ADN70320.1| NAD-dependent DNA ligase LigA [Escherichia coli UM146]
 gi|315288164|gb|EFU47564.1| DNA ligase, NAD-dependent [Escherichia coli MS 110-3]
 gi|323949546|gb|EGB45434.1| DNA ligase [Escherichia coli H252]
 gi|323955668|gb|EGB51426.1| DNA ligase [Escherichia coli H263]
 gi|331054231|gb|EGI26258.1| DNA ligase, NAD-dependent [Escherichia coli TA206]
          Length = 671

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LG+R VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGVREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|209764254|gb|ACI80439.1| DNA ligase [Escherichia coli]
          Length = 671

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P++CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTYCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IEQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|332089820|gb|EGI94921.1| DNA ligase, NAD-dependent [Shigella dysenteriae 155-74]
          Length = 671

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P+    R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPSITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVKGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWSAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|332088205|gb|EGI93327.1| DNA ligase, NAD-dependent [Shigella boydii 5216-82]
          Length = 671

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 245/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +S+ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLKRMGPKSAQNVVNSLEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWSAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|154245706|ref|YP_001416664.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
 gi|254782313|sp|A7IG64|DNLJ_XANP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154159791|gb|ABS67007.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
          Length = 720

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 302/722 (41%), Positives = 457/722 (63%), Gaps = 27/722 (3%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
           + IP++ LS  +A  E  +L QEI+ HD  YY+   P++ D+EYDAL+ R +AI   FP 
Sbjct: 17  RAIPVDDLSPAEAASEHKALAQEITGHDAAYYREDAPVVSDAEYDALRHRYEAIEERFPG 76

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           L      +    K+G   +    KV H +P LSL   ++ E++ +F+ R+ RF     D+
Sbjct: 77  L---RGEDSLSEKVGAAPSEKFGKVAHKVPMLSLANCFSDEEVVEFVARVKRFLNLGPDD 133

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPE 183
            + FT EPKIDG   ++ YE G+   AA RGDG  GEDV+  +R I  IP  L+   +P+
Sbjct: 134 EVAFTCEPKIDGLSCSLHYENGRLTVAATRGDGSQGEDVTQNVRTIADIPERLAGKGVPQ 193

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHG 242
            I+VRGEVY++K DF ALN    A   K +ANPRNAA+G LR+L+ +   +R L FF + 
Sbjct: 194 TIDVRGEVYMAKADFEALNARQAAAEEKVFANPRNAAAGSLRQLDSSITASRPLKFFAYA 253

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+ S++ A+ Q+ +++     GF  N  +  A    G++++Y  +++ R+ L YDIDG+
Sbjct: 254 WGEASDLPAETQFGVVEAFARWGFTTNPLMVVAKDAAGLIAHYRSIEAQRALLGYDIDGV 313

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKV+   LQ++LG  +RSPRW I+HKF  +QA+T L DI+IQ+GRTG LTPVA+L PV 
Sbjct: 314 VYKVNSLELQRRLGFVSRSPRWAIAHKFPAEQATTVLEDIEIQVGRTGALTPVAKLTPVT 373

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG ++++ATLHNED I             +D+R+GD V+V+RAG+VIP+VV +I  +R 
Sbjct: 374 VGGVVVSSATLHNEDEIAR-----------KDVRIGDTVVVQRAGDVIPQVVRVIEEKRP 422

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
             ++P+ FP+ CP C S  VR+++ K+GK+ A  RCTGGL C AQ +ERL+HFVSR+AF+
Sbjct: 423 AGSKPYEFPTHCPACGSHAVREVDTKSGKVDAVRRCTGGLICPAQMVERLRHFVSRNAFD 482

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSI 542
           IEGLG++Q+  F++       I  PADIFTL+ R   S  ++EN  G+G  S  NL+ +I
Sbjct: 483 IEGLGEKQVRAFYEW----GLIASPADIFTLETRNARSLQRLENRDGWGKTSAANLFAAI 538

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEIN------NIIAHNNDDWL 596
            +RR ++++RF+F+LGIRHVG   A+ L ++Y + +                   N+ W 
Sbjct: 539 AERRTVAVDRFVFALGIRHVGETNAKRLMRHYGTVEALEAGALAAVIPGEEHPKGNEAWQ 598

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            +I +  +GD++A+A++EF+  PRN   V ALLKEV+P     +   +S +  K +VFTG
Sbjct: 599 EMIGIDGIGDVVAEAVIEFFGEPRNREVVTALLKEVTPEP-MEQVAAASPVSGKTVVFTG 657

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           +L+K+ R +A+    +LGA V+  +S KT++++ G   GSKLEKAQ LGV+++ E+++  
Sbjct: 658 SLEKMTRDEAKAMAERLGAKVAGSVSAKTNLVVAGPGAGSKLEKAQALGVQVITEDEWFE 717

Query: 717 LL 718
           L+
Sbjct: 718 LV 719


>gi|319405996|emb|CBI79627.1| DNA ligase [Bartonella sp. AR 15-3]
          Length = 718

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 326/720 (45%), Positives = 465/720 (64%), Gaps = 16/720 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL+RR + I   FP+L R 
Sbjct: 6   IKNLTALEAEGELEWLAKEIARHDVLYHRDDQPEISDAEYDALRRRNEEIEALFPELVRV 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P +KIG  ++    K  H+ P LSL+  +N +D+ +FI RI RF +  +   I  
Sbjct: 66  ---DSPSSKIGAPISEKFEKSIHAQPMLSLDNAFNFKDVSEFIERIRRFLRFPETQIIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G+ GE+V+   R I  IP++L    P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVCAITRGNGYIGENVTTNARTIADIPQILQGKFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNISQQKEGKLAFANPRNAAAGSLRQLDSQITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q EM++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIEMMEKLKEYGFIINPLTKVFEKVEDLISYYHSIEKCRQSLNYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  +RSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVSRSPRWAIAHKFPAEKAIALLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+++R GRDIRVGD V+++RAG+VIP++VD++V +R      
Sbjct: 363 VTNASLHNEDYIKGIGHKGELIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPKGTPT 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+         A  RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPRVCPVCGSHAVREEGE------AIRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF  +D    I  PADIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHIQDKTLCIHSPADIFTLQRRQENSLRRLENMEGFGVVSVRKLYNAINARRK 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F     + I         N+ W+ L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVNAQRLARAYQNYAAFETAAMSAIMPSGKNIEGNEIWMELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  + +AI++FYQ   N   + ALLKEV+P          S +  K +VFTGTLQ +
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRNVLLALLKEVTPLHEMPVAIDYSPVVGKTIVFTGTLQHM 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+  +
Sbjct: 657 SRDEAKSLAERLGAKTSNSISKKTDLLVAGSGAGSKLIKAQQLGIEVLDEKSWLKLIDGH 716


>gi|323188282|gb|EFZ73575.1| DNA ligase, NAD-dependent [Escherichia coli RN587/1]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 391/711 (54%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L  L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLIELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|283786048|ref|YP_003365913.1| DNA ligase [Citrobacter rodentium ICC168]
 gi|282949502|emb|CBG89116.1| DNA ligase [Citrobacter rodentium ICC168]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 247/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     S  ++ H +P LSL+ +++ E    F  R+      K  + + +  E K
Sbjct: 58  PTQRVGAAPLTSFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSSDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++A +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVRAATRGDGTTGEDITANVRTIRAIPLRLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGIGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV+N V   ++   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLMQFKAWGLPVSNRVTLCDSPEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGYVARAPRWAVAFKFPAQEQMTSVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPAETRPVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PAQCPVCGSDVERVEGE------AVTRCTGGLICAAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ D++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAFFGTLEALEAA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +    + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIRQLLAEGVHWPAPVAIKAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|331653837|ref|ZP_08354838.1| DNA ligase, NAD-dependent [Escherichia coli M718]
 gi|331048686|gb|EGI20762.1| DNA ligase, NAD-dependent [Escherichia coli M718]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKSKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVYNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLL 669


>gi|74312947|ref|YP_311366.1| NAD-dependent DNA ligase LigA [Shigella sonnei Ss046]
 gi|123732314|sp|Q3YZD1|DNLJ_SHISS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|73856424|gb|AAZ89131.1| DNA ligase [Shigella sonnei Ss046]
 gi|323169148|gb|EFZ54825.1| DNA ligase, NAD-dependent [Shigella sonnei 53G]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEVLEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|260462100|ref|ZP_05810344.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
 gi|259031960|gb|EEW33227.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
          Length = 734

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 300/737 (40%), Positives = 441/737 (59%), Gaps = 32/737 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P I D+EYDAL+RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELQRLAEEIAEHDRRYHTEDAPTITDAEYDALRRRNLAIEERFPGLVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  ++G        KV H++P LSL K +  ED+  FI R  RF+ +  D  I 
Sbjct: 65  E---DSPSLRVGAAPAEGFAKVRHAVPMLSLAKAYTDEDVTDFIERGRRFFDRDKDLDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           FT EPKIDG   ++RYEKG FV  A RG+G  GED++A +R I  IP  L  +  PEIIE
Sbjct: 122 FTAEPKIDGLSASLRYEKGVFVQGATRGNGTVGEDITANLRTIADIPAKLKGSGWPEIIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     A G + Y NPRN A+G LR+ + +   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKARSAAAGGQDYVNPRNTAAGSLRQKDASVTASRNLKFFAYAWGY 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+E  A  QY  +QK    GF ++  + +A +   +V++Y+ ++  RS+L YDIDG+VYK
Sbjct: 242 TTEDPAPTQYGAVQKFADWGFKISPLMVRAKSVEELVAHYHRIEEQRSSLGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW I+HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAIAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKG D++G+ +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGFDSNGQPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP+C S   R++N KTGK  +  RCTG L C+AQ +ERL+HFVSR A +IEG
Sbjct: 422 TPYEFPHTCPVCGSPATREINEKTGKEDSRRRCTGELICAAQAVERLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ----------------------TSTTK 523
           LG + +D FF     A  I+  ADIFTL+ R+                        +   
Sbjct: 482 LGAENIDTFFN----AGLIKTAADIFTLRDRRPAVTKALAERREEQARQREAASGKTRKN 537

Query: 524 IENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           + ++       +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LA+ + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAALLARTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       +  +GD +  A+ +F+ N RN   +E LL++V P       + 
Sbjct: 597 VGKETAAAEDPHTVFPSINGIGDTVIDALRDFFGNQRNDDVLEKLLEQVKPKPYIVTVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTGTL+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTIVFTGTLEKMTRSEAKAMAERLGAKVAGSVSAKTDLLVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFLFLLQQ 720
           LGV++++E+ +L  + +
Sbjct: 717 LGVEVIDEDTWLQRVGK 733


>gi|331648073|ref|ZP_08349163.1| DNA ligase, NAD-dependent [Escherichia coli M605]
 gi|331042933|gb|EGI15073.1| DNA ligase, NAD-dependent [Escherichia coli M605]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIIINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|26248787|ref|NP_754827.1| NAD-dependent DNA ligase LigA [Escherichia coli CFT073]
 gi|170680446|ref|YP_001744602.1| NAD-dependent DNA ligase LigA [Escherichia coli SMS-3-5]
 gi|227887457|ref|ZP_04005262.1| NAD-dependent DNA ligase LigA [Escherichia coli 83972]
 gi|300981618|ref|ZP_07175608.1| DNA ligase, NAD-dependent [Escherichia coli MS 45-1]
 gi|301046300|ref|ZP_07193464.1| DNA ligase, NAD-dependent [Escherichia coli MS 185-1]
 gi|81475373|sp|Q8FFC1|DNLJ_ECOL6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781328|sp|B1LMK5|DNLJ_ECOSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|26109193|gb|AAN81395.1|AE016764_77 DNA ligase [Escherichia coli CFT073]
 gi|170518164|gb|ACB16342.1| DNA ligase, NAD-dependent [Escherichia coli SMS-3-5]
 gi|227835807|gb|EEJ46273.1| NAD-dependent DNA ligase LigA [Escherichia coli 83972]
 gi|300301715|gb|EFJ58100.1| DNA ligase, NAD-dependent [Escherichia coli MS 185-1]
 gi|300408962|gb|EFJ92500.1| DNA ligase, NAD-dependent [Escherichia coli MS 45-1]
 gi|307554453|gb|ADN47228.1| DNA ligase [Escherichia coli ABU 83972]
 gi|315293473|gb|EFU52825.1| DNA ligase, NAD-dependent [Escherichia coli MS 153-1]
 gi|323977408|gb|EGB72494.1| DNA ligase [Escherichia coli TW10509]
          Length = 671

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|163747147|ref|ZP_02154503.1| DNA ligase, NAD-dependent [Oceanibulbus indolifex HEL-45]
 gi|161379708|gb|EDQ04121.1| DNA ligase, NAD-dependent [Oceanibulbus indolifex HEL-45]
          Length = 685

 Score =  592 bits (1527), Expect = e-167,   Method: Composition-based stats.
 Identities = 290/686 (42%), Positives = 419/686 (61%), Gaps = 15/686 (2%)

Query: 35  YYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIP 94
           Y+    P I D+EYDALKRR  AI   +PDL R    + P  ++G  +     KV H++ 
Sbjct: 12  YHTEDAPEISDAEYDALKRRNAAIEARYPDLKRD---DSPTEQVGAPVAEGFGKVRHAVS 68

Query: 95  TLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALR 154
            LSL   ++ E++  F  RI ++   + D  + +T EPKIDG  +++RYE G  V AA R
Sbjct: 69  MLSLANAFDAEEVTDFDARIRKYLGVEADAPLAYTAEPKIDGLSLSLRYENGLLVQAATR 128

Query: 155 GDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYA 214
           GDG  GE+V+A  R I  IP  +    P+++EVRGEVY+S  DF ALN+     G K +A
Sbjct: 129 GDGAVGENVTANARTIQDIPHQIDEA-PDLLEVRGEVYMSHADFAALNERQAERGGKTFA 187

Query: 215 NPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVR 273
           NPRNAA+G LR+L+      R L FF +  G  S   A+ Q   + ++  LGF  N    
Sbjct: 188 NPRNAAAGSLRQLDAEITRARPLRFFAYAWGALSAPLAETQKGAIDRLAKLGFVTNPLTA 247

Query: 274 QANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEK 333
             +    +V++Y ++++ R+TL YDIDG+VYKVD+ +LQ++LG R+ +PRW I+HKFA +
Sbjct: 248 LCDGPSDMVAHYAKIEAQRATLGYDIDGVVYKVDDLALQERLGFRSTTPRWAIAHKFAAE 307

Query: 334 QASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGR 393
            A TRL  IDIQ+GRTG L+PVARL+PV +GG +++NATLHNEDYIKGLD+ G  +RGG+
Sbjct: 308 LAWTRLEGIDIQVGRTGALSPVARLQPVTVGGVVVSNATLHNEDYIKGLDSKGAEIRGGK 367

Query: 394 DIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLV 453
           DIRVGD V + RAG+VIPKV D+ +++R  DA PF FPS CP C S  +R+         
Sbjct: 368 DIRVGDWVQIYRAGDVIPKVADVDLSKRPKDAAPFVFPSVCPECGSDAIREPG------D 421

Query: 454 AAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTL 513
           A  RCTGGL C AQ +E+LKHFV+R AF+I+GLG +Q++ F+        I  PADIFTL
Sbjct: 422 AVRRCTGGLICPAQAVEKLKHFVARGAFDIDGLGAKQVEQFYHD----GWIAEPADIFTL 477

Query: 514 QRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKY 573
           + R      +++N  G+G  S  NL+ +I  +R I + R IF+LGIRHVG   +  +A +
Sbjct: 478 KERFGNGVQQLKNREGWGPKSADNLFQAIKDKRKIPMSRLIFALGIRHVGDAASNLIALH 537

Query: 574 YLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS 633
           Y  + +F   +          W  LI V  VG ++A ++V  +       +++ L+  ++
Sbjct: 538 YGDWDSFETAMAEARGLEGPAWDDLIAVDGVGSVMAGSLVSAFAQEAERASIDRLVAHLT 597

Query: 634 PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDN 693
                      S +  K +VFTGTL+K+ R +A+    +LGA VS  +S KTDI++ G  
Sbjct: 598 VVPTERPDTEGSPVAGKTVVFTGTLEKMSRAEAKARAERLGAKVSGSVSAKTDILVAGPG 657

Query: 694 PGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            GSK +KA  LG++ ++E+ +L L++
Sbjct: 658 AGSKAKKAADLGIETLDEDGWLALIE 683


>gi|261340751|ref|ZP_05968609.1| DNA ligase, NAD-dependent [Enterobacter cancerogenus ATCC 35316]
 gi|288317173|gb|EFC56111.1| DNA ligase, NAD-dependent [Enterobacter cancerogenus ATCC 35316]
          Length = 671

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 246/713 (34%), Positives = 395/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MDSIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E   +  +V H +P LSL+ +++ E    F  R+      K  +++ +  E K
Sbjct: 58  PTQRVGAEPLGAFSQVRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSSDALTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVRAATRGDGTTGEDITTNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV+N V+  ++   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSNRVQLCDSPEAVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  D +   F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPDDTRAIEF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++   +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLDRMGPKSAQNVVNALETAKKTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +   +               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEKA----------SIDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNREVIGKLLAEGISWPAPVVVNAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLLGE 671


>gi|218548148|ref|YP_002381939.1| NAD-dependent DNA ligase LigA [Escherichia fergusonii ATCC 35469]
 gi|331684067|ref|ZP_08384663.1| DNA ligase, NAD-dependent [Escherichia coli H299]
 gi|254781331|sp|B7LL73|DNLJ_ESCF3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218355689|emb|CAQ88301.1| DNA ligase, NAD(+)-dependent [Escherichia fergusonii ATCC 35469]
 gi|315298233|gb|EFU57493.1| DNA ligase, NAD-dependent [Escherichia coli MS 16-3]
 gi|331079019|gb|EGI50221.1| DNA ligase, NAD-dependent [Escherichia coli H299]
          Length = 671

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|73541575|ref|YP_296095.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
 gi|123732913|sp|Q470D2|DNLJ_RALEJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|72118988|gb|AAZ61251.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
          Length = 711

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 259/726 (35%), Positives = 383/726 (52%), Gaps = 54/726 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P   L    A + +  L  E+  H+  YY    P I D+EYDAL     A+    P+L  
Sbjct: 15  PAGGLPPATAAERVQWLRDELDRHNYQYYVLDAPTIPDAEYDALFTELQALEAEHPELL- 73

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GG    +   V H +P LSL   ++ ED+  F  R  +   +       
Sbjct: 74  --TPDSPTQRVGGAPLSAFDTVRHRVPMLSLNNGFSDEDVTGFDRRCAQGLGRSAAAGGE 131

Query: 124 -------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV 176
                    + +  E K DG  +++RYE G+ V AA RGDG +GEDV+  +R I  IP  
Sbjct: 132 QDLFSAAEGVEYACELKFDGLAMSLRYEDGRLVQAATRGDGETGEDVTVNVRTIKAIPLK 191

Query: 177 LSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRY 235
           L    P ++EVRGEV++ + DF  LN      G K + NPRNAA+G LR+L+P     R 
Sbjct: 192 LRGAAPAVLEVRGEVFMYRRDFDKLNARQAEAGDKTFVNPRNAAAGSLRQLDPRITAKRP 251

Query: 236 LNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
           L+FF +GLG+            ML     +G PV N         G++ +Y ++   R  
Sbjct: 252 LSFFAYGLGELQGIERPATHSAMLDGFATMGLPVCNERAVVKGAQGLLDFYRKVGEKRDQ 311

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           LPYDIDG+VYKV+  + Q+QLG  +R+PR+ ++HKF  ++ +T + DI++Q+GRTG +TP
Sbjct: 312 LPYDIDGVVYKVNALAEQEQLGFVSRAPRFALAHKFPAQEMTTIVEDIEVQVGRTGAITP 371

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARL+PV +GG  +TNATLHNED ++            +D+ +GD V+V+RAG+VIP+VV
Sbjct: 372 VARLQPVFVGGVTVTNATLHNEDEVRR-----------KDVHIGDTVIVRRAGDVIPEVV 420

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
            +++  R  DA+ F  P+ CP+C S + R  +       A  RCTGGL C+AQ+ + L H
Sbjct: 421 AVVLERRPDDARAFVMPTACPVCGSHIERLEDE------AIARCTGGLICAAQRKQALLH 474

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
           F  R A +IEGLG + ++           +R PAD++ L         K+  +    D S
Sbjct: 475 FAQRRAMDIEGLGDKVVEQLVDQ----GIVRTPADLYKL------GVAKLAALDRMADKS 524

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             NL  +I   R+ +  RFIFSLGIRHVG   A+ LA+++                   D
Sbjct: 525 AGNLVAAIEASRSTTFNRFIFSLGIRHVGEATAKDLARHFGKLDGLMVA----------D 574

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLV 653
             +L+ V  VG ++AQ+IV F+  P N+  +E L                 + +  K  V
Sbjct: 575 EAALLEVNDVGPVVAQSIVNFFGEPHNVEVIEQLRAAGVHWPESEPVARAPAPLAGKTFV 634

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
            TGTL  + R  A+E +   GA V+  +S+KTD ++ G   GSKL+KA+ LGV +++E  
Sbjct: 635 LTGTLPSLSREAAKEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLDKAEALGVPVLDEAG 694

Query: 714 FLFLLQ 719
            L LL+
Sbjct: 695 MLALLE 700


>gi|332092973|gb|EGI98039.1| DNA ligase, NAD-dependent [Shigella boydii 3594-74]
          Length = 671

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGVPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|332162521|ref|YP_004299098.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606605|emb|CBY28103.1| DNA ligase [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666751|gb|ADZ43395.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860741|emb|CBX71032.1| DNA ligase [Yersinia enterocolitica W22703]
          Length = 672

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 246/712 (34%), Positives = 403/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELITN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++   ++ D   + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRLKRAD--PLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGELVRAATRGDGTTGENITANVRTIRAIPLRLQGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPLAGFEQLNNEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + R  G PV++ V+       ++++Y +++  R  L +DIDG+V KVD   
Sbjct: 236 PRSHIQRLMQFRAWGLPVSDRVKLCTGSEQVIAFYRQVEQDRGGLGFDIDGVVIKVDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++++R  DA+  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMDQRPQDAKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PEHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIVALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ + +N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNLENLRAA----------DIEALKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            +V F     N   +EAL K ++    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVVNFLGEEHNQKVIEALEKVITWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLAALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLGE 670


>gi|330912204|gb|EGH40714.1| DNA ligase [Escherichia coli AA86]
          Length = 671

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIIINVEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|319782858|ref|YP_004142334.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168746|gb|ADV12284.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 734

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 296/737 (40%), Positives = 440/737 (59%), Gaps = 32/737 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P+I D+EYDAL RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELKRLAEEIAEHDRRYHTEDAPVITDAEYDALARRNLAIEERFPALVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  ++G        KV H++P LSL K +  +D+  FI R  RF+ +  +  I 
Sbjct: 65  E---DSPSLRVGAAPAEGFTKVRHAVPMLSLAKAYTDDDVTDFIERGRRFFDRDKELDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           FT EPKIDG   ++RYE G FV  A RG+G  GED++A ++ I  IP  L  +  PE IE
Sbjct: 122 FTAEPKIDGLSASLRYENGVFVQGATRGNGAVGEDITANLKTIADIPAKLKGSGWPETIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     AVG + Y NPRN A+G LR+ +P+   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKQRSAAVGGQDYVNPRNTAAGSLRQKDPSVTASRNLKFFAYAWGY 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+   A  QY+ +QK    GF ++  + +A +   ++++Y+ ++  RS L YDIDG+VYK
Sbjct: 242 TTADPAPTQYDSVQKFAEWGFKISPLMVRAKSAEELIAHYHRIEEQRSALGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW I+HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAIAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKGLD++G+ +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGLDSTGQPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CPIC S   R++N KTGK  +  RCTG L C AQ +E L+HFVSR A +IEG
Sbjct: 422 VPYEFPHTCPICGSPATREINEKTGKEDSRRRCTGELICPAQAVEGLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ----------------------TSTTK 523
           LG + +D FF     A  IR  ADIFTL+ R+                        +   
Sbjct: 482 LGAENIDTFFN----AGLIRTAADIFTLRDRRPAVTRALAERREEQARQREAASGKTRKN 537

Query: 524 IENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           + ++       +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LA+ + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAAVLARTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       V  +GD +  A+ +F+ N RN   ++ALL++V P       + 
Sbjct: 597 VGKETAAAEDPHSVFPSVNGIGDTVIDALRDFFGNERNDDVLDALLRQVKPKPYIVNVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTG+L+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTVVFTGSLEKMTRSEAKAMAERLGAKVAGSVSAKTDLVVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFLFLLQQ 720
           LG+++++E+ +L  + +
Sbjct: 717 LGIEVIDEDAWLARIGK 733


>gi|300940348|ref|ZP_07154941.1| DNA ligase, NAD-dependent [Escherichia coli MS 21-1]
 gi|300454839|gb|EFK18332.1| DNA ligase, NAD-dependent [Escherichia coli MS 21-1]
          Length = 671

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   + ALL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISALLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLRLL 669


>gi|15802944|ref|NP_288973.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 EDL933]
 gi|12516784|gb|AAG57530.1|AE005471_7 DNA ligase [Escherichia coli O157:H7 str. EDL933]
          Length = 671

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 390/711 (54%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y   +  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYXXXEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P++CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTYCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWXAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|82544871|ref|YP_408818.1| NAD-dependent DNA ligase LigA [Shigella boydii Sb227]
 gi|123741957|sp|Q31Y68|DNLJ_SHIBS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81246282|gb|ABB66990.1| DNA ligase [Shigella boydii Sb227]
          Length = 671

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGVPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G     N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKLAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|296104078|ref|YP_003614224.1| NAD-dependent DNA ligase LigA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058537|gb|ADF63275.1| NAD-dependent DNA ligase LigA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 671

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 242/713 (33%), Positives = 394/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   ++++ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MDSIEQQITELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRDLEAQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E   +  +V H +P LSL+ +++ E    F  R+      K  +++ +  E K
Sbjct: 58  PTQRVGAEPLGAFSQVRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSSDALTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVRAATRGDGTTGEDITTNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV+N V+  ++   ++++Y +++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSNRVQLCDSPEAVLAFYRKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  D +   F
Sbjct: 356 ATLHNADEIDRL-----------GLRIGDKVVIRRAGDVIPQVVNVVQSERPDDTRAIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++   +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLDRMGPKSAQNVVNALEAAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ +     +               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLDALEKA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL++          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGKLLEQGIKWPAPVVVNAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|319404500|emb|CBI78105.1| DNA ligase [Bartonella rochalimae ATCC BAA-1498]
          Length = 725

 Score =  592 bits (1525), Expect = e-166,   Method: Composition-based stats.
 Identities = 329/720 (45%), Positives = 465/720 (64%), Gaps = 16/720 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL RR + I   FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P +KIG  ++    K  H+ P LSL+  +N ED+ +FI RI RF +  +  +I  
Sbjct: 66  ---DSPSSKIGAPISEKFEKSIHAQPMLSLDNAFNFEDVSEFIERIRRFLRLPETQTIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G  GE+V+   R I  IP +L  N P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVRAITRGNGSIGENVTTNARTIADIPEILQGNFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNINQQKEGKLVFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q  M++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIGMMKKLKEYGFIINPLTKVFEKVEDLISYYHSIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  ARSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVARSPRWAIAHKFPAEKAIAFLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ITNA+LHNEDYIKG+   G+++R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 ITNASLHNEDYIKGIGHKGELIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRSKDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+            RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPHVCPVCGSHAVREEGET------VRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    IR P DIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDKTLCIRSPVDIFTLQRRQENSLRRLENMEGFGVVSVRKLYNAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F       I      +  N+ W  L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVKAQRLARAYQNYIAFETAAMTAIMPPDKNSEGNEIWKELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  + +AI++FYQ   N   + ALLKEV+P          S I  K +VFTGTL+ +
Sbjct: 597 EGIGSRVGEAIIDFYQEVHNRDVLSALLKEVTPLHEAPIAIDYSPIVEKIIVFTGTLEHM 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+ ++
Sbjct: 657 SRDEAKSLAERLGAKTSNSISKKTDLLVAGFGAGSKLVKAQQLGIEVLDEKNWLKLIDEH 716


>gi|320180401|gb|EFW55332.1| DNA ligase [Shigella boydii ATCC 9905]
          Length = 671

 Score =  592 bits (1525), Expect = e-166,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWSAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|24113756|ref|NP_708266.1| NAD-dependent DNA ligase LigA [Shigella flexneri 2a str. 301]
 gi|30063805|ref|NP_837976.1| NAD-dependent DNA ligase LigA [Shigella flexneri 2a str. 2457T]
 gi|110806352|ref|YP_689872.1| NAD-dependent DNA ligase LigA [Shigella flexneri 5 str. 8401]
 gi|81723177|sp|Q83K81|DNLJ_SHIFL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|122366427|sp|Q0T298|DNLJ_SHIF8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24052834|gb|AAN43973.1| DNA ligase [Shigella flexneri 2a str. 301]
 gi|30042060|gb|AAP17786.1| DNA ligase [Shigella flexneri 2a str. 2457T]
 gi|110615900|gb|ABF04567.1| DNA ligase [Shigella flexneri 5 str. 8401]
 gi|281601828|gb|ADA74812.1| DNA ligase, NAD-dependent [Shigella flexneri 2002017]
 gi|313650866|gb|EFS15266.1| DNA ligase, NAD-dependent [Shigella flexneri 2a str. 2457T]
 gi|332755453|gb|EGJ85817.1| DNA ligase, NAD-dependent [Shigella flexneri K-671]
 gi|332756263|gb|EGJ86614.1| DNA ligase, NAD-dependent [Shigella flexneri 2747-71]
 gi|333002064|gb|EGK21630.1| DNA ligase, NAD-dependent [Shigella flexneri K-218]
          Length = 671

 Score =  591 bits (1524), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLCHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGVPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G     N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKLAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|333001543|gb|EGK21111.1| DNA ligase, NAD-dependent [Shigella flexneri VA-6]
 gi|333002206|gb|EGK21770.1| DNA ligase, NAD-dependent [Shigella flexneri K-272]
 gi|333016032|gb|EGK35364.1| DNA ligase, NAD-dependent [Shigella flexneri K-227]
          Length = 671

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLCHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G     N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKLAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|218705919|ref|YP_002413438.1| NAD-dependent DNA ligase LigA [Escherichia coli UMN026]
 gi|293405854|ref|ZP_06649846.1| DNA ligase [Escherichia coli FVEC1412]
 gi|298381604|ref|ZP_06991203.1| DNA ligase [Escherichia coli FVEC1302]
 gi|254781326|sp|B7N602|DNLJ_ECOLU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218433016|emb|CAR13911.1| DNA ligase, NAD(+)-dependent [Escherichia coli UMN026]
 gi|284922366|emb|CBG35453.1| DNA ligase [Escherichia coli 042]
 gi|291428062|gb|EFF01089.1| DNA ligase [Escherichia coli FVEC1412]
 gi|298279046|gb|EFI20560.1| DNA ligase [Escherichia coli FVEC1302]
          Length = 671

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQERLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|110642595|ref|YP_670325.1| NAD-dependent DNA ligase LigA [Escherichia coli 536]
 gi|191174600|ref|ZP_03036093.1| DNA ligase, NAD-dependent [Escherichia coli F11]
 gi|300997757|ref|ZP_07181842.1| DNA ligase, NAD-dependent [Escherichia coli MS 200-1]
 gi|306814500|ref|ZP_07448662.1| NAD-dependent DNA ligase LigA [Escherichia coli NC101]
 gi|122958158|sp|Q0TF55|DNLJ_ECOL5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110344187|gb|ABG70424.1| DNA ligase [Escherichia coli 536]
 gi|190905126|gb|EDV64772.1| DNA ligase, NAD-dependent [Escherichia coli F11]
 gi|222034142|emb|CAP76883.1| DNA ligase [Escherichia coli LF82]
 gi|300304141|gb|EFJ58661.1| DNA ligase, NAD-dependent [Escherichia coli MS 200-1]
 gi|305851894|gb|EFM52346.1| NAD-dependent DNA ligase LigA [Escherichia coli NC101]
 gi|312947007|gb|ADR27834.1| NAD-dependent DNA ligase LigA [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324011127|gb|EGB80346.1| DNA ligase, NAD-dependent [Escherichia coli MS 60-1]
          Length = 671

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E          + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDETEMLHLL 669


>gi|114319842|ref|YP_741525.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312282|sp|Q0AAV2|DNLJ_ALHEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114226236|gb|ABI56035.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
          Length = 673

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 257/715 (35%), Positives = 391/715 (54%), Gaps = 47/715 (6%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           A +    +  + +L +EI  HD  YY    P+I D+EYDAL     A+    P+L     
Sbjct: 2   AQTGTDPQARIEALRREIREHDHRYYVLDAPVIADAEYDALMAELQALEAEHPELI---T 58

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+ P  ++ G       +VTH+ P LSL+  +   DL +F  R+ +       + + +  
Sbjct: 59  PDSPSQRVAGRPAEGFGEVTHAEPMLSLDNAFEEADLAEFDRRVRQALGL---DPVVYVA 115

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPK+DG  ++IRYE G+ V A  RGDG  GE ++  +R I ++P  L     P ++EVRG
Sbjct: 116 EPKLDGLSVSIRYEDGRLVRAGTRGDGRVGEAITENVRTIRSVPLRLRGEGWPPVMEVRG 175

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EV I + DF  LN++ +A G +P+ANPRNAA+G LR+L+P     R L FF  G+     
Sbjct: 176 EVVIRRADFERLNEQRLADGERPFANPRNAAAGSLRQLDPRITARRRLTFFTFGVAAAGR 235

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
           + A    E+L K+   GF VN  V +     G   YY  + + R  L ++IDG+VYKVD+
Sbjct: 236 LAASHH-EVLDKLAGWGFRVNERVERVRGLDGCREYYQRLLADRDELSFEIDGVVYKVDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              +++LG  AR+PRW I+ K   ++A+T +  I   +GRTG +TPVA LEPV +GG  +
Sbjct: 295 LDAREELGFTARAPRWAIAWKLPAQEATTVVRRILPSVGRTGAITPVAELEPVGVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           + ATLHN D ++            +D+R GD V+V+RAG+VIP++  ++  +R   A+P+
Sbjct: 355 SRATLHNLDEVRR-----------KDVRKGDTVMVRRAGDVIPEITAVVTEKRPEGAEPW 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
           + P+ CP+C S V+R  +       A HRC GGL C AQ+   L HF SR A +I+GLG+
Sbjct: 404 AMPAECPVCGSEVLRLDDE------AVHRCMGGLYCPAQREGALLHFASRKALDIDGLGE 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + +    +       +R PAD+FTL+  Q         +   GD S  NL  +++K R  
Sbjct: 458 KVVSQLVER----GMVRSPADLFTLEHCQLAG------LERMGDKSADNLVAALDKARRT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF+++LGI+HVG   AR LA+++ S +               D  +L   P VG ++
Sbjct: 508 TLPRFLYALGIQHVGEVTARRLAEHFGSLEAIMNA----------DESALAETPDVGPVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           AQAI  F+  P N   V+AL             +     +  +  V TGTL  + R +A+
Sbjct: 558 AQAIAHFFAEPHNREVVQALRAAGVTWEEVDPAERGEQPLAGRTFVLTGTLSGMTRDEAK 617

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
             +  LGA VS  +S+KTD ++ G+  GSKL KA+ LGV++++E+    LLQ++ 
Sbjct: 618 AALEALGARVSGSVSKKTDYLVAGEKAGSKLAKAESLGVEVLDEQALQALLQEHG 672


>gi|324112923|gb|EGC06899.1| DNA ligase [Escherichia fergusonii B253]
          Length = 671

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRSGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HAHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|331663971|ref|ZP_08364881.1| DNA ligase, NAD-dependent [Escherichia coli TA143]
 gi|331059770|gb|EGI31747.1| DNA ligase, NAD-dependent [Escherichia coli TA143]
          Length = 671

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQERLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPVVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|156933031|ref|YP_001436947.1| NAD-dependent DNA ligase LigA [Cronobacter sakazakii ATCC BAA-894]
 gi|166215403|sp|A7MKW4|DNLJ_ENTS8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|156531285|gb|ABU76111.1| hypothetical protein ESA_00834 [Cronobacter sakazakii ATCC BAA-894]
          Length = 672

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 251/714 (35%), Positives = 398/714 (55%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R   A+  A P+L     P+ 
Sbjct: 1   MESIEEKLTQLRTTLRHHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G        +V H +P LSL+ +++      F  R+      K  +++ +  E K
Sbjct: 58  PTQRVGAAPLTEFSQVRHEVPMLSLDNVFDEASFLAFNKRVQDRL--KSTDALVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GED++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGLLVRAATRGDGTTGEDITLNVRTIRAIPLKLRGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRVTAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   E LQ+ +  G PV++ +R   T   ++++Y+++++ R TL +DIDG+V KVD   
Sbjct: 236 PRSHMERLQQFKAWGLPVSDRIRLVKTPEEVLAFYHQVEADRPTLGFDIDGVVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTTVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PAQCPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  NL +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNLVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALINA----------SIDDLQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F++   N   +  L +EV            + + S    K +V TGTL ++ R  A
Sbjct: 559 HVFNFFEEESNRAVIRDLTEEVGIHWPAPQVVKAEEIDSPFAGKTVVLTGTLSQMSRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL +
Sbjct: 619 KARLAALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMLRLLGE 672


>gi|238792031|ref|ZP_04635667.1| DNA ligase [Yersinia intermedia ATCC 29909]
 gi|238728662|gb|EEQ20180.1| DNA ligase [Yersinia intermedia ATCC 29909]
          Length = 670

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/712 (34%), Positives = 397/712 (55%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++  ++    P+L      + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHLYHVLDAPEIPDAEYDRLMQQLRSLEAQHPELI---THDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ +    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVRHEVPMLSLDNVFDEDSYLAFDKRVHDRL--KSAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L     P+ +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITANVRTIRAIPLRLHGENIPQRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF- 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKIFANPRNAAAGSLRQLDPRITAKRPLMFFCYGVGLLDGGDL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+N V+       ++++Y +++  R++L +DIDG+V KVD   
Sbjct: 236 PRSHIQRLMQFKAWGLPVSNRVKLCTGSDEVIAFYRQVEQDRTSLGFDIDGVVIKVDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFQAQEQITQVRDVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            IR+GD V+++RAG+VIP+VV +++ +R  D +   F
Sbjct: 356 ATLHNADEIERL-----------GIRIGDTVIIRRAGDVIPQVVGVVMEQRPQDTKEIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PQHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFELTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFCNLDNLRAA----------DIDALKSVPDVGEVVAR 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            +  F     N   + AL K +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVRNFLSEEHNQKVIAALEKVISWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLAALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLGE 670


>gi|123441550|ref|YP_001005536.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166216254|sp|A1JLA4|DNLJ_YERE8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|122088511|emb|CAL11304.1| DNA ligase [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 672

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 246/712 (34%), Positives = 402/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELITN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++   ++ D   + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRLKRAD--PLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGELVRAATRGDGTTGENITANVRTIRAIPLRLQGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F  LNDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPLAGFEQLNDEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+  V+       ++++Y +++  R  L +DIDG+V KVD   
Sbjct: 236 PRSHIQRLMQFKAWGLPVSERVKLCTGSEQVIAFYRQVEQDRGGLGFDIDGVVIKVDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++++R  DA+  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMDQRPQDAKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PEHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIVALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ + +N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNLENLRAA----------DIEALKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            +V F     N   +EAL K ++    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVVNFLGEEHNQKVIEALEKVITWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLAALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLLGE 670


>gi|22125389|ref|NP_668812.1| NAD-dependent DNA ligase LigA [Yersinia pestis KIM 10]
 gi|45442391|ref|NP_993930.1| NAD-dependent DNA ligase LigA [Yersinia pestis biovar Microtus str.
           91001]
 gi|108808172|ref|YP_652088.1| NAD-dependent DNA ligase LigA [Yersinia pestis Antiqua]
 gi|108811556|ref|YP_647323.1| NAD-dependent DNA ligase LigA [Yersinia pestis Nepal516]
 gi|145599373|ref|YP_001163449.1| NAD-dependent DNA ligase LigA [Yersinia pestis Pestoides F]
 gi|149365146|ref|ZP_01887181.1| DNA ligase [Yersinia pestis CA88-4125]
 gi|162420672|ref|YP_001607138.1| NAD-dependent DNA ligase LigA [Yersinia pestis Angola]
 gi|165926903|ref|ZP_02222735.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940356|ref|ZP_02228875.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011271|ref|ZP_02232169.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212520|ref|ZP_02238555.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398917|ref|ZP_02304441.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421338|ref|ZP_02313091.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424444|ref|ZP_02316197.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470665|ref|ZP_02335369.1| DNA ligase, NAD-dependent [Yersinia pestis FV-1]
 gi|218930038|ref|YP_002347913.1| NAD-dependent DNA ligase LigA [Yersinia pestis CO92]
 gi|229838581|ref|ZP_04458740.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895648|ref|ZP_04510819.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Pestoides A]
 gi|229899147|ref|ZP_04514290.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901826|ref|ZP_04516947.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Nepal516]
 gi|270490015|ref|ZP_06207089.1| DNA ligase (NAD(+)) [Yersinia pestis KIM D27]
 gi|122980211|sp|Q1CJV7|DNLJ_YERPN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123372308|sp|Q1C5X9|DNLJ_YERPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123776939|sp|Q7CJF3|DNLJ_YERPE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166216255|sp|A4TMG4|DNLJ_YERPP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781914|sp|A9QZH0|DNLJ_YERPG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|21958274|gb|AAM85063.1|AE013752_4 DNA ligase [Yersinia pestis KIM 10]
 gi|45437255|gb|AAS62807.1| DNA ligase [Yersinia pestis biovar Microtus str. 91001]
 gi|108775204|gb|ABG17723.1| DNA ligase [Yersinia pestis Nepal516]
 gi|108780085|gb|ABG14143.1| DNA ligase [Yersinia pestis Antiqua]
 gi|115348649|emb|CAL21593.1| DNA ligase [Yersinia pestis CO92]
 gi|145211069|gb|ABP40476.1| DNA ligase [Yersinia pestis Pestoides F]
 gi|149291559|gb|EDM41633.1| DNA ligase [Yersinia pestis CA88-4125]
 gi|162353487|gb|ABX87435.1| DNA ligase, NAD-dependent [Yersinia pestis Angola]
 gi|165911711|gb|EDR30369.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921254|gb|EDR38478.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989949|gb|EDR42250.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206451|gb|EDR50931.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960827|gb|EDR56848.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051421|gb|EDR62829.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056326|gb|EDR66095.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229680722|gb|EEO76817.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Nepal516]
 gi|229687549|gb|EEO79622.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694947|gb|EEO84994.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701454|gb|EEO89482.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Pestoides A]
 gi|270338519|gb|EFA49296.1| DNA ligase (NAD(+)) [Yersinia pestis KIM D27]
          Length = 670

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 244/712 (34%), Positives = 400/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD + ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNVPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+  V+       ++++Y +++  R+ L +DIDG+V KVD+ +
Sbjct: 236 PRSHIQCLMQFKAWGLPVSERVKLCTGSDQVIAFYRQIEQDRAGLGFDIDGVVIKVDDLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  D +  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPDDTKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSQCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFQLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLDNLRAA----------DIETLKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +E L K VS    +    +   S    K +V TG+L  + R +A++
Sbjct: 559 HVMNFLSEEHNQKVIEELEKVVSWPEPQQIVVEESDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KT ++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTHLVIAGEAAGSKLAKAQELGIKVIDEAEMIRLLGE 670


>gi|312114833|ref|YP_004012429.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
 gi|311219962|gb|ADP71330.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
          Length = 777

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 299/739 (40%), Positives = 437/739 (59%), Gaps = 51/739 (6%)

Query: 10  EALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           E LS E A+ E  +L  EI+ HD  Y Q + P I D+EYD L+ R +A+  AFP L    
Sbjct: 57  EHLSAEDAKDEHDALAAEIARHDLLY-QDAAPEISDAEYDRLRLRLNALEAAFPSLI--- 112

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P  P   +G   +    KV H++  LSL  +++ ED+  F  R+ RF +   D ++  T
Sbjct: 113 TPESPSQTVGATPSEKFAKVRHTVRMLSLGNVFSDEDVADFAGRVRRFLKFAPDEALDVT 172

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS-LNIPEIIEVR 188
            E KIDG  +++RYE G+   AA RGDG  GEDV+A +R I  IP+V+   ++P + EVR
Sbjct: 173 AEMKIDGLSVSLRYENGRLAVAATRGDGSEGEDVTANVRTIADIPQVIRANDVPAVFEVR 232

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+S  DF ALN+  +  G + +ANPRNAA+G LR+L+P     R L FF  G G+  
Sbjct: 233 GEVYMSHADFQALNERQVGKGGRMFANPRNAAAGSLRQLDPAITAARPLRFFAWGWGEVR 292

Query: 248 EI------FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
                    A   + +LQ +   GFP+   V    +   +++ Y  ++  R++L YDIDG
Sbjct: 293 GWGEASALPADTNFGVLQAIHGWGFPLPP-VEICRSVEEMLAVYRAIEMKRASLGYDIDG 351

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKV+   LQ++LG  +R+PRW  +HKF+ ++A+T L  IDIQ+GRTG LTPVA+L PV
Sbjct: 352 VVYKVNRLDLQERLGFISRTPRWATAHKFSAEKATTVLNGIDIQVGRTGALTPVAKLAPV 411

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG ++ NATLHNED I+            +D+R+GD V+V+RAG+VIP+++  ++ +R
Sbjct: 412 TVGGVVVQNATLHNEDEIRR-----------KDVRIGDTVIVQRAGDVIPQILGPVLEQR 460

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
             DA  F FP+ CP+C S  VR+ +PKTGK+ A  RCTGGL C+AQ +ERL+HFVSR AF
Sbjct: 461 PADAVEFVFPTLCPVCGSHAVRETHPKTGKVDAVRRCTGGLICAAQAVERLRHFVSRHAF 520

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +IEGLG++ +  FF        I+ PADIFT+  R      K+    G+G  S  NL+ +
Sbjct: 521 DIEGLGEKNIQAFFDE----GRIKAPADIFTMAARDGVDLPKLSEKEGWGAQSAANLFAA 576

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI-- 599
           I  RR ISLERFIF+LGIRHVG   A+ LAK + S       +    A        L+  
Sbjct: 577 IEARRTISLERFIFALGIRHVGETTAKLLAKTFGSLDALRAAMAEPDAAELRPGDELLLE 636

Query: 600 --------------------RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRH 639
                                +  +GD++AQ+IV+F+  P N  AV+AL +E++    + 
Sbjct: 637 SASGEDKRSLHRAIILAKLNEIDGIGDVVAQSIVDFFDEPHNREAVDALRRELTIEAYKP 696

Query: 640 EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLE 699
           ++ VSS +    +VFTG L++  R +A+    + GA V+  +S+ T  ++ G   GSKL+
Sbjct: 697 DQ-VSSLLAGATVVFTGKLERFTRDEAKAQAERFGAKVAGSVSKATTYLVAGPGAGSKLK 755

Query: 700 KAQQLGVKIMNEEQFLFLL 718
           KA+ LGVK+M E+++L ++
Sbjct: 756 KAEDLGVKVMTEDEWLEMI 774


>gi|333016518|gb|EGK35849.1| DNA ligase, NAD-dependent [Shigella flexneri K-304]
          Length = 671

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLCHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARCTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGVPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G     N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKLAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|322831833|ref|YP_004211860.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
 gi|321167034|gb|ADW72733.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
          Length = 673

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 252/715 (35%), Positives = 403/715 (56%), Gaps = 50/715 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +    +++S L  ++ +H+  Y+    P + D+EYD L R    +  A P+L  +   + 
Sbjct: 1   MATIEEQISQLRTQLRHHEYQYHVLDAPEVPDAEYDRLMRELRELETAHPELVTA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R+      K   ++ F  E K
Sbjct: 58  PTQRVGAAPLSAFEQVRHRVPMLSLDNVFDEESYLAFYKRVQDRL--KTAEALTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  PE +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVQAATRGDGTTGENITANVRTIRAIPLRLHGDNIPERLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F A+NDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEAMNDEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +  +  LQ+ +  G PV++ VR       ++++Y ++++ R +L +DIDG+V K+D   
Sbjct: 236 PRSHFARLQQFKAWGLPVSDRVRLCTGSEEVLAFYRQVEADRPSLGFDIDGVVVKIDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q+ LG  AR+PRW  + KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 IQETLGFVARAPRWATAFKFPAQEQITLVKDVEFQVGRTGAITPVARLEPVLVAGVMVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV ++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVLDERPEDAREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCT GL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCHSDVERVEGE------AVARCTAGLICGAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L         K+  +   G  S  N+  ++ K +  +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRLTA------GKLTGLDRMGPKSAQNVVRALEKAKETTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA +Y S +               D  SL  V  VGD++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHYGSVEALKAA----------DIESLKGVQDVGDVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLK-EVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHK 665
            +V F     N   ++ LL  E++      +    + + S    K +V TG+L  + R  
Sbjct: 559 HVVNFLSEEHNQQVIDELLSPEINIHWPEVQVIVPEEIDSPFAGKTVVLTGSLSILSRDD 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 AKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMIRLLGE 673


>gi|163794455|ref|ZP_02188426.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
 gi|159180179|gb|EDP64702.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
          Length = 696

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 282/714 (39%), Positives = 414/714 (57%), Gaps = 29/714 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E LS  +A+ EL  L   IS  D  Y+    P++ D+EYDAL+RR  AI   FPDL  
Sbjct: 11  PVEELSDAEAKAELRRLSDAISEADRQYHVEDAPVLTDAEYDALRRRNQAIEERFPDLKL 70

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
           +   + P  ++    +    KV H+ P LSL   +N ED+ +F  R+ RF    +++ + 
Sbjct: 71  A---DSPSERVAPGPSEGFSKVRHARPMLSLANAFNDEDVHEFARRVRRFLSLGEEDELA 127

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEV 187
              EPKIDG    +RY  G+    A RGDG  GE+++  +  +  +P  L   +P I+EV
Sbjct: 128 LVAEPKIDGLSAALRYVDGRLEVGATRGDGTEGENITRNLETLDDVPTTLPAGVPGILEV 187

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY++K+DF+ALND     G K +ANPRNAA+G LR+L+PT    R L FF +  G+ 
Sbjct: 188 RGEVYMTKDDFVALNDRQAKAGGKIFANPRNAAAGSLRQLDPTITAARPLRFFAYSWGEI 247

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           SE  A   +E L+K+   GF  N   ++  +    ++ Y ++   R+TLPYDIDG+VYKV
Sbjct: 248 SENIADTHWEFLKKLEAWGFTTNPLSQRCESVESALAVYADIGERRTTLPYDIDGVVYKV 307

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG  +R+PRW I+HKF  +QA T L  I+IQ+GRTG LTPVARLEPV + G 
Sbjct: 308 DRLDWQQRLGMVSRAPRWAIAHKFKAEQAETVLKAIEIQVGRTGALTPVARLEPVKVAGV 367

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHNE  I+            +D+RVGD V+++RAG+VIP+VV +I+ +R  D+ 
Sbjct: 368 TVSNATLHNEGEIRR-----------KDVRVGDTVVIQRAGDVIPQVVRVILEKRPADSV 416

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            + FP  CP C S   +          A  RCTGGL C AQ +ERLKHFVSRDAF+IEGL
Sbjct: 417 EYVFPETCPECGSDAEQPEGE------AIRRCTGGLICPAQAVERLKHFVSRDAFDIEGL 470

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G +Q+D F+ +      I+ P DIF L++ +      +    G   +S  NL  +I  RR
Sbjct: 471 GSKQIDGFYSN----GLIKRPGDIFRLKQHRD----VLIGEKGTKTISTDNLLAAIEDRR 522

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +I  +RFI+SLGIR VG   AR LA  Y + +     +       ++    L+ +  +G 
Sbjct: 523 SIGFDRFIYSLGIRQVGQATARLLAINYGTLEALRTAMAAAHDPESEAHADLLNIDQIGS 582

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +A+ + +F+    N   ++ L  E++ +         S I  K +VFTGTL +I R++A
Sbjct: 583 SVAKDLADFFAEDHNAEVLDDLAAELTIAPFAAPAASDSPIAGKTVVFTGTLTRIGRNEA 642

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +     LGA V+  +S+KTD +I+G + GSK  KA+ LGV  ++E+++  L+ +
Sbjct: 643 KAKAESLGAKVAGSVSKKTDYVIIGADAGSKAAKAEALGVPTLSEDEWFTLIGE 696


>gi|212638096|ref|YP_002314616.1| NAD-dependent DNA ligase LigA [Anoxybacillus flavithermus WK1]
 gi|254781544|sp|B7GFV1|DNLJ_ANOFW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212559576|gb|ACJ32631.1| NAD-dependent DNA ligase [Anoxybacillus flavithermus WK1]
          Length = 672

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 254/711 (35%), Positives = 394/711 (55%), Gaps = 52/711 (7%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
              K+++ L ++I  H+  YY   +P I D+EYD L R+   +   +P       P+ P 
Sbjct: 8   DVEKQIAELREQIEKHNYAYYVLDQPSISDAEYDELMRKLMELEEQYPQYK---TPDSPS 64

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++GG    +  KVTH +P LSL   +N  DLR F  R+      ++   + +  E KID
Sbjct: 65  QRVGGAPLEAFRKVTHRVPMLSLSNAFNEGDLRDFDRRVR-----QEVGDVRYVCELKID 119

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G  +++RYE G FV  A RGDG +GED++  ++ I ++P  L   +   IEVRGE Y+ +
Sbjct: 120 GLAVSLRYEDGYFVQGATRGDGTTGEDITENLKTIRSLPLRLRQQV--TIEVRGEAYMPR 177

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIFAKGQ 254
             F  LN++    G + +ANPRNAA+G LR+L+P    +R L+ F + +    E+     
Sbjct: 178 KSFEKLNEKRKMNGEELFANPRNAAAGSLRQLDPKVAASRQLDIFAYHVVNAEELGILSH 237

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
              L  +  LGF  N   +   T   ++SY  +    R++LPYDIDG+V KVD F+ QKQ
Sbjct: 238 SAALNYLDELGFKTNPARQVCETIDDVLSYIEQWHERRASLPYDIDGIVIKVDAFAQQKQ 297

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  A+SPRW I++KF  ++  T+L+DI++ +GRTG++TP A L+PV + G ++  A+LH
Sbjct: 298 LGATAKSPRWAIAYKFPAEEVVTQLVDIELSVGRTGVVTPTAILQPVRVAGTIVQRASLH 357

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NEDYI+            +DIR+GD V++K+AG++IP+VV  +   R    +PF  P+ C
Sbjct: 358 NEDYIR-----------EKDIRLGDYVVIKKAGDIIPEVVCSLPERRTGKEEPFDMPTHC 406

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P C S +VR  +        A RC     C AQ  E L HFVSR A NI+GLG++ +   
Sbjct: 407 PACASELVRLDDE------VALRCVNPQ-CPAQIREGLIHFVSRQAMNIDGLGEKVIAQL 459

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
           F+       +R  AD++TL + +  +      +   G+ S TNL  +I   +  SLER +
Sbjct: 460 FEHR----LVRSVADLYTLTKDELVA------LERMGEKSATNLLQAIEASKQNSLERLL 509

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F LGIRHVGA+ A++LA+++ + +   Q               L+ +  +G+ +A +IV 
Sbjct: 510 FGLGIRHVGAKAAKTLAEHFETMERLQQATK----------EELMAIHEIGEKMADSIVT 559

Query: 615 FYQNPRNICAVEALLKEVSPSI---GRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           ++        +E L            +   ++SS    K  V TGTLQ + R +A+E + 
Sbjct: 560 YFSKEEVKQLLERLRAYGVNMTYKGAKQTIDISSTFAGKTFVLTGTLQSMSRSEAKEKIE 619

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
            LG  V+  +S+KTD+++VG++ GSKLEKA+QLG+ I +E +FL  +QQ  
Sbjct: 620 TLGGKVTGSVSKKTDVVVVGEDAGSKLEKAKQLGITIWDEARFLQEIQQSK 670


>gi|238895883|ref|YP_002920619.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae NTUH-K2044]
 gi|238548201|dbj|BAH64552.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 671

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 247/713 (34%), Positives = 395/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  D   + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDH--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  +
Sbjct: 236 PASHSARLLQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALEQAT----------IEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E            + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           E +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ERLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|262042032|ref|ZP_06015211.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040623|gb|EEW41715.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 671

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 246/713 (34%), Positives = 394/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  D   + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDH--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  +
Sbjct: 236 PASHSARLLQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALEQA----------SIEELQKVPDVGIVVAA 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E            + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|51597030|ref|YP_071221.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis IP
           32953]
 gi|186896113|ref|YP_001873225.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis PB1/+]
 gi|81638946|sp|Q668M6|DNLJ_YERPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781913|sp|B2K917|DNLJ_YERPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|51590312|emb|CAH21949.1| DNA ligase [Yersinia pseudotuberculosis IP 32953]
 gi|186699139|gb|ACC89768.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis PB1/+]
          Length = 670

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 244/712 (34%), Positives = 400/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD + ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNVPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+  V+       ++++Y +++  R+ L +DIDG+V KVD+  
Sbjct: 236 PRSHIQCLMQFKAWGLPVSERVKLCTGSDQVIAFYRQIEQDRAGLGFDIDGVVIKVDDLV 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  D +  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPDDTKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSQCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFQLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLDNLRAA----------DIETLKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +E L K VS    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVMNFLSEEHNQKVIEELEKVVSWPEPQQIVVEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KT ++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTHLVIAGEAAGSKLAKAQELGIKVIDEAEMIRLLGE 670


>gi|220935192|ref|YP_002514091.1| DNA ligase (NAD(+)) [Thioalkalivibrio sp. HL-EbGR7]
 gi|254781444|sp|B8GTL0|DNLJ_THISH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219996502|gb|ACL73104.1| DNA ligase (NAD(+)) [Thioalkalivibrio sp. HL-EbGR7]
          Length = 675

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 257/717 (35%), Positives = 385/717 (53%), Gaps = 50/717 (6%)

Query: 12  LSI--EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           +S   E+ RK ++SL  E+ YH+  YY    P I D+ YDAL R    +   +P+L    
Sbjct: 1   MSEIPEKVRKRVASLRDELDYHNHRYYVLDDPEIPDAAYDALMRELQDLEAKYPELV--- 57

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
            P+ P  ++GG    +  +  H +P LSL+  +   D+  F  RI     ++  + I F 
Sbjct: 58  TPDSPTQRVGGAPLKAFEEARHLLPMLSLDNAFEEADVLAFEKRIRDRLGEE--SEIEFA 115

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVR 188
           +EPK+DG  I++ YE G  V  A RGDG +GEDV+A +R I  IP  L     P+++EVR
Sbjct: 116 VEPKLDGLAISLLYEDGHLVRGATRGDGATGEDVTANVRTIRAIPLRLQGRGWPKLLEVR 175

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GEVY+ +  F A N E  + G K + NPRNAA+G LR+L+      R L FF +G G   
Sbjct: 176 GEVYMDRAGFEAFNREAASRGEKVFVNPRNAAAGSLRQLDSRITAKRPLTFFAYGAGHVE 235

Query: 248 E-IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
                     +L  +   G  V           G + YY  +   R  LPYDIDG+VYKV
Sbjct: 236 GGELPDTHAAVLDALAEWGQRVCPERDVVTGAAGCLEYYRRIGERRDGLPYDIDGVVYKV 295

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           + F LQ++LG  +R+PRW I+HK+  ++  T L D++ Q+GRTG LTPVARLEPV +GG 
Sbjct: 296 NRFELQQRLGFVSRAPRWAIAHKYPAQEQMTLLRDVEFQVGRTGALTPVARLEPVFVGGV 355

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHN D ++            +D+R+GD V+V+RAG+VIP+V  ++++ R  +A+
Sbjct: 356 TVSNATLHNMDEVER-----------KDVRIGDTVIVRRAGDVIPEVAAVVLSRRPHNAR 404

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
               P+ CP+C S +VR          A  RC+GGL C+AQ+ E +KHF SR A +IEGL
Sbjct: 405 HVVMPTHCPVCGSEIVRSEGE------AVARCSGGLYCAAQRREAIKHFASRRAMDIEGL 458

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + ++        A  +     ++ L   Q         +   G+ S  NL D++ K +
Sbjct: 459 GDKLVEQLVD----AGLVDHVDGLYRLTAEQLAG------LERMGEKSAHNLVDALEKSK 508

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           +  L RFIF+LGIR VG   AR+LA ++                   D  +L++VP VG 
Sbjct: 509 HTQLARFIFALGIREVGEATARALAIHFGGLDALMAA----------DEEALMQVPDVGP 558

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE---KNVSSEIENKKLVFTGTLQKIQR 663
           ++A  +  F+Q P N   ++AL +             +     +     V TG L+ + R
Sbjct: 559 VVAHHVATFFQQPHNREVIDALREAGVHWEESEPAALQAEDLPLSGNTYVLTGALESMTR 618

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +A + +  LGA VS  +S+KT  +I G+  GSKL KA++LGV +++E +FL L+ +
Sbjct: 619 EEAGDRLMALGAKVSGSVSKKTTAVIAGEAAGSKLAKAEKLGVPVLSEAEFLELIGE 675


>gi|296445905|ref|ZP_06887856.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
 gi|296256573|gb|EFH03649.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
          Length = 713

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 287/714 (40%), Positives = 445/714 (62%), Gaps = 23/714 (3%)

Query: 3   KRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAF 62
           +R+  P+  LS  +A+ E S L +EI+ +D  YYQ   P I D+EYDAL++R +A+  AF
Sbjct: 15  ERERPPVAELSPRRAKLEHSRLAEEIAEYDRRYYQEDDPAISDAEYDALRQRYEALEKAF 74

Query: 63  PDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKD 122
           P+L            +G        K+ H +  LSL  ++  E++ +F+ R+ RF    D
Sbjct: 75  PELGGDA---SLTKTVGAAPAEKFAKIRHVVRMLSLGNVFADEEVHEFVARVRRFLNFSD 131

Query: 123 DNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-I 181
              + FT EPKIDG   ++RYEKG+ V AA RGDG  GED++A IR +  IP+ L  + I
Sbjct: 132 AAPLLFTAEPKIDGLSCSLRYEKGELVSAATRGDGEEGEDITANIRTLEEIPQRLRGDVI 191

Query: 182 PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFV 240
           PE++E+RGEVY+ + DF ALN      G+  +ANPRN+A+G LR+L+P    +R L FF 
Sbjct: 192 PEVLEIRGEVYMRREDFFALNQRQAEAGKPLFANPRNSAAGSLRQLDPNVTASRPLRFFA 251

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           +G G+ S + A  Q  M+Q     G   N   +   +   ++++Y  ++++R+TL YDID
Sbjct: 252 YGWGEVSVMPADTQLGMVQAFASFGLATNPLTQLCGSAEELLAHYRNIEALRATLGYDID 311

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKVD+  LQ +LG  +R+PRW ++HKF  +QA T + DI+I +GRTG LTP+ARLEP
Sbjct: 312 GVVYKVDDIGLQIRLGFVSRAPRWAVAHKFPAEQAKTIVRDIEINVGRTGALTPIARLEP 371

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG +++NATLHNED I             +DIR+GD V+V+RAG+VIP++V++++++
Sbjct: 372 VTVGGVVVSNATLHNEDEIAR-----------KDIRIGDTVVVQRAGDVIPQIVEVVLDK 420

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R   A P+ FP  CP C S  +R+++ K  +     RCTG L C AQ +ERLKHF SR+A
Sbjct: 421 RPEGATPYVFPHECPACGSAALREIDEKGVE-DVVRRCTGSLVCPAQAIERLKHFASRNA 479

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +IEGLG +Q+++FF        +R  ++IFTL  R + S TK+EN  G+G+ SV NL+ 
Sbjct: 480 MDIEGLGDKQIEYFFTD----GLVRTASEIFTLAERDRASLTKLENKEGYGETSVRNLFA 535

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +I+ RR + + RF+++LGIRHVG   AR LA+++  + +         A  ++    +  
Sbjct: 536 AIDARRTVPINRFLYALGIRHVGETNARRLARHFPDFASLRDTAREA-APGSEARERIES 594

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           +  +G ++A+A+ +F+  P N   ++ALL  VS       +N  S +  K +VFTG L++
Sbjct: 595 IEGIGGVVAEALHDFFAEPHNEREIDALLAHVSLEPMPTIENA-SPVAGKTVVFTGALER 653

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           + R +A+    + GA +S  +S+KTD+++ G   GSKL KA++LGV++++EE++
Sbjct: 654 LTREEAKAQAERFGAKISGSVSKKTDLVVAGPGAGSKLAKAKELGVEVISEEEW 707


>gi|152971289|ref|YP_001336398.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166215815|sp|A6TC47|DNLJ_KLEP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150956138|gb|ABR78168.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 671

 Score =  589 bits (1518), Expect = e-166,   Method: Composition-based stats.
 Identities = 246/713 (34%), Positives = 394/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  D   + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDH--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  +
Sbjct: 236 PASHSARLLQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALEQA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E            + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|113868039|ref|YP_726528.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
 gi|123133949|sp|Q0KA11|DNLJ_RALEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|113526815|emb|CAJ93160.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
          Length = 709

 Score =  589 bits (1518), Expect = e-166,   Method: Composition-based stats.
 Identities = 256/721 (35%), Positives = 384/721 (53%), Gaps = 54/721 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P   L  E A K ++ L  E+  H+  YY    P I D+EYDAL     A+    P+L  
Sbjct: 15  PAGPLPPEAAAKRVAWLRDELDRHNYQYYVLDAPTIPDAEYDALFSELQALELEHPEL-- 72

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
            + P+ P  ++GGE   +   V H +P LSL   +  +D+  F  R  +   +       
Sbjct: 73  -QTPDSPTQRVGGEPLSAFDSVRHRVPMLSLNNGFADDDVLNFDRRCAQGLGRTAPAAGE 131

Query: 124 -------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV 176
                  +++ +  E K DG  +++RYE G+ V AA RGDG +GEDV+  +R I  IP  
Sbjct: 132 QDLFSAADAVEYACELKFDGLAMSLRYEDGRLVQAATRGDGETGEDVTVNVRTIKAIPLK 191

Query: 177 LSLNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRY 235
           L    P ++EVRGEV++ + DF  LN+     G K + NPRNAA+G LR+L+P     R 
Sbjct: 192 LRGQAPAVLEVRGEVFMYRGDFDKLNERQAEAGEKTFVNPRNAAAGSLRQLDPRITAKRP 251

Query: 236 LNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRST 294
           L+FF +GLG+            ML     LG PV           G++ +Y ++   R  
Sbjct: 252 LSFFAYGLGELQGVDRPPTHSAMLDGFAALGLPVCKDRAVVKGAQGLLDFYRDIGQRRDA 311

Query: 295 LPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           LPYDIDG+VYKV+  + Q++LG  +R+PR+ ++HKF  ++ +T + DI++Q+GRTG +TP
Sbjct: 312 LPYDIDGVVYKVNALAEQERLGFVSRAPRFALAHKFPAQEMTTIVEDIEVQVGRTGAITP 371

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVV 414
           VARL+PV +GG  +TNATLHNED I+            +D+ +GD V+V+RAG+VIP+VV
Sbjct: 372 VARLKPVFVGGVTVTNATLHNEDEIRR-----------KDVHIGDTVIVRRAGDVIPEVV 420

Query: 415 DIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKH 474
            ++   R  DA+ F  P+ CP+C S + +  +       A  RCTGGL C+AQ+ + L H
Sbjct: 421 AVVTERRPDDARAFVMPTACPVCGSHIEKLEDE------AIARCTGGLICAAQRKQALLH 474

Query: 475 FVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVS 534
           F  R A +IEGLG + ++           +R PAD+F L         K+  +    D S
Sbjct: 475 FAQRRAMDIEGLGDKLVEQLVDQ----GIVRTPADLFKL------GVAKLAALERMADKS 524

Query: 535 VTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDD 594
             NL  +I+  R  ++ RFIF+LGIRHVG   A+ LA+++                   D
Sbjct: 525 AANLVAAIDASRETTMNRFIFALGIRHVGEATAKDLARHFGKLDALMAA----------D 574

Query: 595 WLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLV 653
             +L+ V  VG ++AQ+I  F+  P N+  +E L       +         + +  K  V
Sbjct: 575 EAALLEVNDVGPVVAQSIAHFFAEPHNVEVIEQLRAAGVHWTESEPVAKAPAPLSGKTFV 634

Query: 654 FTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQ 713
            TGTL  + R  A+E +   GA V+  +S+KTD ++ G   GSKL+KA+ LGV +++E  
Sbjct: 635 LTGTLPTMSREDAKELLEAAGAKVAGSVSKKTDYVVAGAEAGSKLDKAEALGVPVLDEAG 694

Query: 714 F 714
            
Sbjct: 695 M 695


>gi|253988889|ref|YP_003040245.1| NAD-dependent DNA ligase LigA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780339|emb|CAQ83500.1| DNA ligase [Photorhabdus asymbiotica]
          Length = 672

 Score =  589 bits (1518), Expect = e-166,   Method: Composition-based stats.
 Identities = 241/714 (33%), Positives = 391/714 (54%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   +++ +L + + +H+  Y+    P I D+EYD L +    +    P+L  S   + 
Sbjct: 1   MKSTAQQIENLRKTLRHHEYLYHVMDAPEISDAEYDRLMQELKTLEGQHPELITS---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H IP LSL+ +++ E    F  R+      KD   +    E K
Sbjct: 58  PTQRVGAAPLAAFEQVRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KDTQDLVVCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE++++ +R I  +P  L     P  IEVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITSNVRTINAVPLRLIGENIPARIEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +N F  LN+E    G K +ANPRNAA+G LR+L+P     R L F  +G+G       
Sbjct: 176 MPQNGFEKLNEEARRTGAKVFANPRNAAAGSLRQLDPRITAKRPLAFLCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               YE L + +  G PV++ VR     + ++ +Y  +++ RSTL +DIDG+V KV+   
Sbjct: 236 PASHYERLMQFKKWGLPVSDKVRVCTDSNQVIDFYRNIENQRSTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW  + KF  ++  T + DI+ Q+GRTG +TPVARLEPV + G  ++N
Sbjct: 296 LQETLGFVARAPRWATAFKFPAQEQMTIVRDIEFQVGRTGAITPVARLEPVQVSGVTVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+++RAG+VIP+VV ++ + R  D+    F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIIRRAGDVIPQVVGVVEDRRPQDSDEVIF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P +CP+C + + +          A  RCTGGL C AQ+ E L+HFVSR A +++G+G++ 
Sbjct: 405 PEYCPVCGADIEKIEGE------AVARCTGGLVCGAQRKEALRHFVSRRAMDVDGMGEKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D     E     +  PAD+F L         K+  +   G  S  N+ D++ K +  + 
Sbjct: 459 IDQLVDKE----YVETPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKKTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA Y+                   D  +L  V  VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAYFGDLNKLRAA----------DEEALKEVQDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +V F+  P N   ++ L+  +  +         + + S    K +V TG+L ++ R +A
Sbjct: 559 HVVHFFNEPHNQKVIDDLIDNIGINWEPIAVTKAEKIDSPFAGKTIVLTGSLHQLSRDEA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           ++ +  LGA V+  +S+KTD++I G+  GSKL KA +L + +++EE+ + LL +
Sbjct: 619 KDKLIALGAKVTGSVSKKTDLVIAGEAAGSKLAKANELNIAVIDEEEMIRLLGE 672


>gi|153948204|ref|YP_001400300.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis IP
           31758]
 gi|170023674|ref|YP_001720179.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis YPIII]
 gi|190359300|sp|A7FGC2|DNLJ_YERP3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781915|sp|B1JFZ0|DNLJ_YERPY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|152959699|gb|ABS47160.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis IP 31758]
 gi|169750208|gb|ACA67726.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis YPIII]
          Length = 670

 Score =  589 bits (1518), Expect = e-166,   Method: Composition-based stats.
 Identities = 244/712 (34%), Positives = 400/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD + ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVEHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNVPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+  V+       ++++Y +++  R+ L +DIDG+V KVD+  
Sbjct: 236 PRSHIQCLMQFKAWGLPVSERVKLCTGSDQVIAFYRQIEQDRAGLGFDIDGVVIKVDDLV 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  D +  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPDDTKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSQCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFQLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLDNLRAA----------DIETLKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +E L K VS    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVMNFLSEEHNQKVIEELEKVVSWPEPQQIVVEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KT ++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTHLVIAGEAAGSKLAKAQELGIKVIDEAEMIRLLGE 670


>gi|320014458|gb|ADV98029.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 670

 Score =  589 bits (1517), Expect = e-166,   Method: Composition-based stats.
 Identities = 244/712 (34%), Positives = 400/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD + ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNVPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+  V+       ++++Y +++  R+ L +DIDG+V KVD+ +
Sbjct: 236 PRSHIQCLMQFKAWGLPVSERVKLCTGSDQVIAFYRQIEQDRAGLGFDIDGVVIKVDDLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  D +  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPDDTKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSQCPVCSSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFQLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLDNLRAA----------DIETLKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +E L K VS    +    +   S    K +V TG+L  + R +A++
Sbjct: 559 HVMNFLSEEHNQKVIEELEKVVSWPEPQQIVVEESDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KT ++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTHLVIAGEAAGSKLAKAQELGIKVIDEAEMIRLLGE 670


>gi|262276434|ref|ZP_06054243.1| DNA ligase [Grimontia hollisae CIP 101886]
 gi|262220242|gb|EEY71558.1| DNA ligase [Grimontia hollisae CIP 101886]
          Length = 670

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 261/713 (36%), Positives = 412/713 (57%), Gaps = 47/713 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++ +  +++L SL+ +++YH   YY   KP + D+EYD + +   AI    P+L  +   
Sbjct: 1   MTTD-IQQKLQSLKTQLNYHGHLYYVEDKPELPDAEYDRMMQELLAIEAKHPELVTA--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG    +  +V H IP LSL+  ++  +L  F  R+       +     F+ E
Sbjct: 57  DSPSQRVGGAPLGAFEQVRHEIPMLSLDNAFDDGELEAFEKRLRDRLNTTER--FVFSCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG  GE+++  +R I  +P +L     P  +EVRGE
Sbjct: 115 PKLDGLAVSLMYENGVLVQAATRGDGTVGENITHNVRTIRNVPLLLQGEGWPVRLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
           V++ K+ F ALN++ I  G K +ANPRNAA+G LR+L+P    TR L F+ + +G  SE 
Sbjct: 175 VFMPKDGFEALNEKNIKKGEKTFANPRNAAAGSLRQLDPKITATRPLRFYAYSVGVMSEA 234

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
           F       L++++  G P++  V++ +    + +YY ++ + R+ LPY+IDG+V KVD  
Sbjct: 235 FGDSHVGRLEQLKQWGIPLSPEVKKVDGLENVKAYYQDIAARRNDLPYEIDGVVIKVDNI 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  ++
Sbjct: 295 DTQERLGFVARAPRWAIAYKFPAQEEITVLQDVEFQVGRTGAITPVAKLEPVFVGGVTVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +++GD V+++RAG+VIP++V ++ + R  DA+   
Sbjct: 355 NATLHNADEIARL-----------GVKIGDTVIIRRAGDVIPQIVSVVESRRPDDAKEVV 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP+CQS+V R          A  RCTGGL C AQ+ E +KHF SR A +I+GLG +
Sbjct: 404 FPHECPVCQSQVERVEGE------AVARCTGGLICRAQRKEAIKHFSSRKALDIDGLGDK 457

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++   + E     I+ PAD+F L   Q         +   G  S  NL D+++K +  +
Sbjct: 458 IVEQLIEKE----LIKTPADLFKLTAGQV------TMLDRMGPKSAQNLVDALSKAKETT 507

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+SLGIR VG   A +LA ++ +++   +               LI V  VG I+A
Sbjct: 508 LPRFIYSLGIREVGEATAANLANHFFTFEAIREATE----------EQLIEVQDVGVIVA 557

Query: 610 QAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           + +V F+    N   ++ALL      P+I + ++N    +  K +V TGTL ++ R+ A+
Sbjct: 558 KHVVNFFNEEHNKTVIDALLACGITWPAIEQPDENKPQPLAGKTVVLTGTLSQMSRNDAK 617

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S KTD++I G+  GSKL KAQQLG++I++E+  + LL +
Sbjct: 618 AALQALGAKVTGSVSAKTDLLIAGEAAGSKLTKAQQLGIEIVDEDGMMRLLSR 670


>gi|292491548|ref|YP_003526987.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
 gi|291580143|gb|ADE14600.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
          Length = 675

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 257/714 (35%), Positives = 394/714 (55%), Gaps = 48/714 (6%)

Query: 12  LSI-EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ++   QAR+ + +L + I+ ++  YY    P++ DSEYD L R    +   +P+L     
Sbjct: 1   MTATAQARERVETLRKLINDYNYNYYVLDSPVVPDSEYDRLMRELQNLEAQYPELVV--- 57

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+ P  ++G E   +L +V H IP LSL   ++ E+L  F  R+      +    + +  
Sbjct: 58  PDSPTQRVGAEPLKALGEVKHEIPMLSLNNAFSEEELADFHRRVKERLGIE---QVEYAA 114

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPK+DG  +++ Y++G  V  A RGDG +GEDV+  +R IPT+   L  + IP ++EVRG
Sbjct: 115 EPKLDGLAVSLLYQEGILVQGATRGDGVTGEDVTHNVRTIPTVSLHLRGDKIPSLLEVRG 174

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLGKTSE 248
           EVY+ K  F  LN E +A G K + NPRNAA+G LR+L+P          F +G+GK  +
Sbjct: 175 EVYMPKEGFERLNREHLAKGEKTFVNPRNAAAGSLRQLDPRIAASRPLAIFCYGVGKVEQ 234

Query: 249 IF-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
               +   E+L +++  G      V       G   YY  +   R  LPY+IDG+V+KVD
Sbjct: 235 GTLPQRHSEVLARLKQWGLRTPPHVEVVAGLAGCQEYYQRLLERRDGLPYEIDGVVFKVD 294

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
            F  ++ LG  AR+PRW I++KF  ++  T++LDI++Q+GRTG LTPVARL+PV +GG  
Sbjct: 295 RFDQRQALGFVARAPRWAIAYKFPAQEELTQILDIEVQVGRTGALTPVARLQPVFVGGVT 354

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHNED I+            +D+R+GD V V+RAG+VIP+VV +I++ R PDA+ 
Sbjct: 355 VSNATLHNEDEIRR-----------KDVRIGDTVYVRRAGDVIPEVVKVILDHRPPDARF 403

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P+ CPIC S V++D         A  RC+GGL C AQ+ E +KHF SR A +I GLG
Sbjct: 404 FQMPTQCPICGSEVIKDEG------GAIARCSGGLYCPAQRKEAIKHFASRRAMDINGLG 457

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + +D   + E     +   AD++ L   Q         +   G  S  NL  +I   ++
Sbjct: 458 DKLVDQLIERE----LVEDVADLYHLTAEQLAG------LERMGQKSAANLMHAIEASKH 507

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF+++LGIR VG   A++LA+ + S +                   L  V  +G +
Sbjct: 508 TTLPRFLYALGIREVGEATAQALAEEFNSLEALEGASE----------ERLQEVTDIGPV 557

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +A  I  F++ P N   ++ L +          +K +   +  K  V TGTL+ + R +A
Sbjct: 558 VATHIAAFFRQPHNRQVIQRLREAGVCWPEKEGKKPIPQPLSGKTFVLTGTLESMTREQA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +E +  LG  V++ +S  TD ++VG NPGSKL KA+ L + +++E  F  LL +
Sbjct: 618 KERLQALGGKVTSSVSSNTDYLVVGTNPGSKLTKAKDLHITLLDEGNFRNLLDE 671


>gi|330013648|ref|ZP_08307732.1| DNA ligase [Klebsiella sp. MS 92-3]
 gi|328533421|gb|EGF60158.1| DNA ligase [Klebsiella sp. MS 92-3]
          Length = 671

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 245/713 (34%), Positives = 393/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R+   +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  D   + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDH--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVQAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD   
Sbjct: 236 PASHSARLLQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEERPHLGFDIDGVVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         ++  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GELTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALEQA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E            + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVRWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|121533514|ref|ZP_01665342.1| DNA ligase, NAD-dependent [Thermosinus carboxydivorans Nor1]
 gi|121308073|gb|EAX48987.1| DNA ligase, NAD-dependent [Thermosinus carboxydivorans Nor1]
          Length = 673

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 256/709 (36%), Positives = 381/709 (53%), Gaps = 46/709 (6%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           ++EQA +E   L ++I YH+  YY    P I D+E+DAL RR  AI  A+P L     P+
Sbjct: 8   TLEQAAREAEQLRRQIHYHNHRYYVLDAPEISDAEFDALMRRLIAIEEAYPSLI---TPD 64

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            P  ++GG       +  H  P LSL   ++ EDLR F  R+         +   + +E 
Sbjct: 65  SPTQRVGGAPAEGFDRTLHLTPMLSLANAFSAEDLRAFDNRVRSGLGV---DKAEYVVEL 121

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV-LSLNIPEIIEVRGEV 191
           KIDG  + + YE G+ V  A RGDG  GEDV+A +R I ++P V    + P ++EVRGEV
Sbjct: 122 KIDGLAVNLVYEAGRLVRGATRGDGQYGEDVTANVRTIRSVPLVLPVNDPPALLEVRGEV 181

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF 250
           Y+ + +F  LN+E  A G   +ANPRNAA+G LR+L+P     R L+ FV+  G+   + 
Sbjct: 182 YMPRREFDRLNEERQAAGEALFANPRNAAAGSLRQLDPRVTAQRALDIFVYATGRREGLN 241

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L+ +  LGF VN   R   +   ++ Y       R  LPYDIDGLV K++  +
Sbjct: 242 METHAQTLETLAALGFKVNPHYRVFGSIEEVIDYCYSWNERRVDLPYDIDGLVIKLNSLA 301

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q +LG  A+ PRW I+ KF  +QA+T + DI +++GRTG+LTP A+L PV + G+ ++ 
Sbjct: 302 GQARLGATAKDPRWAIAFKFPAEQATTIVEDIFVRVGRTGVLTPTAQLRPVRLAGSTVSR 361

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNEDYI+            +DIR+GD V++ +AGEVIP+VV ++ + R+   +PF  
Sbjct: 362 ATLHNEDYIR-----------DKDIRIGDTVIIHKAGEVIPEVVAVVASRRNGSERPFVM 410

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP C S VVR+         AAH+C    AC A   E L HFVSRDA NIEGLG   
Sbjct: 411 PDRCPECGSPVVREPGE------AAHKCVNS-ACPAMLREGLIHFVSRDAMNIEGLGPAV 463

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +         A  +R  AD++ L+    T       +   G  S  NL  +I   +   L
Sbjct: 464 IGSLLD----AGLVRDAADLYALRFDDLTK------LDRMGPKSAQNLLQAIEASKEAGL 513

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            R +F+LGIR VGA+ A +LA+++ S     +               L+ +  +G  IA+
Sbjct: 514 ARLLFALGIRFVGAKAAGTLARHFGSIHALERAT----------VEELMALEEIGPKIAE 563

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           ++  ++ +P+NI  V  L                  +     V TGTL  + R +A E +
Sbjct: 564 SVANYFADPQNIALVRKLEAAGVKVTEERPAAKRQTLAGITFVLTGTLATMTRAEATELI 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
              G  VS+ +S+KT+ ++ G+  GSKL+KA++LG+ ++ E +F  LL+
Sbjct: 624 ESRGGKVSSSVSKKTNYVVAGEEAGSKLDKARELGIPVLTEGEFKKLLE 672


>gi|284006788|emb|CBA72055.1| DNA ligase [Arsenophonus nasoniae]
          Length = 670

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 249/712 (34%), Positives = 402/712 (56%), Gaps = 46/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +++ +  L+ L+Q++ +H+  Y+    P I D+EYD L +    +    P+   +   + 
Sbjct: 1   MKEQQNYLARLKQQLRHHEYLYHVLDTPEIPDAEYDRLMQELKKLEAEHPEWITA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H IP LSL+ +++ E    F  R++     K+++ + F  E K
Sbjct: 58  PTQRVGAAPLTAFEQVRHEIPMLSLDNVFDEESYLAFDKRVHDRL--KNNSQLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++A IR I  IP  L+ +  PE IE+RGEV+
Sbjct: 116 LDGLAVSLLYEQGELVQAATRGDGTTGENITANIRTIRAIPLRLTGDNIPERIEIRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF- 250
           ++   F  LN+E      K +ANPRNAA+G LR+L+P     R L FF +G G  +    
Sbjct: 176 MTHRGFEKLNEEARRNDGKIFANPRNAAAGSLRQLDPRITAKRPLAFFCYGFGLLAGGQL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               Y+ L + +  G PV++ +        +++YY++++  R  L +DIDG+V KVD   
Sbjct: 236 PASHYQCLMQFKKWGLPVSDKIALCQNSQQVLAYYHQIEHARLGLGFDIDGVVIKVDPLQ 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  AR+PRW  + KF  ++  T L D++ Q+GRTG +TPVARL PV + G +++N
Sbjct: 296 LQEELGFVARAPRWATAFKFPAQEQITLLHDVEFQVGRTGAITPVARLAPVLVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+++RAG+VIP++V+++ + R  D++   F
Sbjct: 356 ATLHNADEIERL-----------GVRIGDTVVIRRAGDVIPQIVNVLTDRRPIDSREIRF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+   LKHFVSR A +I+G+G + 
Sbjct: 405 PIHCPVCGSAIERIEGE------AVIRCTGGLICAAQRKGALKHFVSRRAMDIDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D     E     +   AD++ L      +   +  +   G  S  NL ++++K +  +L
Sbjct: 459 IDQLVAKE----YVTTAADLYRL------NLDILARLERMGPKSAQNLINALDKSKQTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RFI++LGIR VG   A +LA +Y +  +              D  SL +V  VG+I+A+
Sbjct: 509 ARFIYALGIREVGEATASNLAAHYTTLTSLMAA----------DIESLKKVQDVGEIVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIG-RHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
            IV F+    N   V  L+ E+  S      K   S    K +V TGTL ++ R + ++ 
Sbjct: 559 HIVNFFHEQHNRDVVNQLVNEIGISWPRMPAKKTDSPFTGKTIVLTGTLNRLTRDELKDK 618

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           +  LGA V+  +S+KTD++I G+  GSKL KA +LG+KI+NE++ + LL+ +
Sbjct: 619 LILLGAKVTGSVSKKTDLVIAGEAAGSKLTKANELGIKIINEDELIALLEDH 670


>gi|300897228|ref|ZP_07115672.1| DNA ligase, NAD-dependent [Escherichia coli MS 198-1]
 gi|300358986|gb|EFJ74856.1| DNA ligase, NAD-dependent [Escherichia coli MS 198-1]
          Length = 671

 Score =  588 bits (1516), Expect = e-165,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D EYD L R    +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K +  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKQWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q++LG  AR+PRW ++ KF  ++  T + D++ ++GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQERLGFVARAPRWAVAFKFPAQEQMTFVRDVEFKVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|260598800|ref|YP_003211371.1| NAD-dependent DNA ligase LigA [Cronobacter turicensis z3032]
 gi|260217977|emb|CBA32625.1| DNA ligase [Cronobacter turicensis z3032]
          Length = 672

 Score =  588 bits (1515), Expect = e-165,   Method: Composition-based stats.
 Identities = 249/714 (34%), Positives = 397/714 (55%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R   A+  A P+L     P+ 
Sbjct: 1   MESIEEKLTQLRTTLRHHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++      F  R+      K+ +++ +  E K
Sbjct: 58  PTQRVGAAPLTAFSQVRHEVPMLSLDNVFDEASFLAFNKRVQDRL--KNTDALVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GED++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVRAATRGDGTTGEDITLNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQTGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRVTAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     LQ+ +  G PV++ +R   T   ++++Y ++++ R TL +DIDG+V KVD   
Sbjct: 236 PRSHMARLQQFKAWGLPVSDRIRLVKTPEDVLAFYRQVEADRPTLGFDIDGVVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQLTTVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTQCPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNLVTALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALINA----------SIDDLQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F++   N   +  L +EV            + + S    K +V TG+L ++ R  A
Sbjct: 559 HVFNFFEEESNRAVIRDLTEEVGIHWPAPQVVKAEEIDSPFAGKTVVLTGSLSQMSRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL +
Sbjct: 619 KARLAALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMLRLLGE 672


>gi|320173862|gb|EFW49042.1| DNA ligase [Shigella dysenteriae CDC 74-1112]
          Length = 671

 Score =  588 bits (1515), Expect = e-165,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +     +L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHLELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K++  + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KNNEKVTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V    +   ++++Y++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFKLTA------GKLTGLERMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLKALEAA----------SIEELQKVPDVGIVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMLRLL 669


>gi|238790828|ref|ZP_04634584.1| DNA ligase [Yersinia frederiksenii ATCC 33641]
 gi|238721075|gb|EEQ12759.1| DNA ligase [Yersinia frederiksenii ATCC 33641]
          Length = 670

 Score =  588 bits (1515), Expect = e-165,   Method: Composition-based stats.
 Identities = 245/712 (34%), Positives = 403/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFDQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEEGELVRAATRGDGTTGENITVNVRTIRAIPLRLHGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+N V+       ++++Y +++  R++L +DIDG+V KVD   
Sbjct: 236 PRSHIQRLMQFKAWGLPVSNRVKLCTGSDQVIAFYRQVEQDRASLGFDIDGVVIKVDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++++R  DA+  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMDQRPQDAKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PDHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIVALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLDNLRAA----------DIEALKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +E L K +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLSEEHNQKVIETLEKVISWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLLGE 670


>gi|328542977|ref|YP_004303086.1| DNA ligase, NAD(+)-dependent [polymorphum gilvum SL003B-26A1]
 gi|326412723|gb|ADZ69786.1| DNA ligase, NAD(+)-dependent [Polymorphum gilvum SL003B-26A1]
          Length = 721

 Score =  588 bits (1515), Expect = e-165,   Method: Composition-based stats.
 Identities = 321/722 (44%), Positives = 464/722 (64%), Gaps = 18/722 (2%)

Query: 12  LSIEQARKELSSLEQE------------ISYHDDCYYQYSKPIILDSEYDALKRRCDAIA 59
           ++ + A   + SL ++            I+ HD  Y+    P + D+EYDAL+RR  AI 
Sbjct: 1   MNEKSAAAAVESLSRQEAEAELARLAAEIAAHDQRYFAEDAPTVSDAEYDALRRRNAAIE 60

Query: 60  HAFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQ 119
             FPDL R    + P  +IG   +    KVTH+IP LSL+  ++ +D+R F+ R+ RF +
Sbjct: 61  ERFPDLVRE---DSPSARIGAAPSEGFGKVTHAIPMLSLDNAFSDDDVRDFVARVRRFLR 117

Query: 120 KKDD-NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLS 178
                 ++  T EPKIDG  +++RYE G+ V AA RGDG  GE+V+A  R I  IP  L 
Sbjct: 118 LDPLMGALGVTAEPKIDGLSLSLRYEGGRLVSAATRGDGTVGENVTANARTIADIPHRLP 177

Query: 179 LNIPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLN 237
             +PE++EVRGEVY++  DF ALN  M A G K +ANPRNAA+G LR+LNP     R L 
Sbjct: 178 AGVPEVVEVRGEVYMAHADFAALNARMAANGGKVFANPRNAAAGSLRQLNPDITAARPLK 237

Query: 238 FFVHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
           FF +  G+ SE+    Q EM+  +   GFPVN  +    +   ++  Y+ ++  R+TL Y
Sbjct: 238 FFAYAWGEMSEVPRATQMEMVSLIGAWGFPVNPRMVLCRSVEELIDVYHAIEEERATLGY 297

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKVD   LQ +LG  +RSPRW I+HKF  ++A T L DI+IQ+GRTG LTPVA+
Sbjct: 298 DIDGVVYKVDRLDLQARLGFVSRSPRWAIAHKFPAEKAFTILRDIEIQVGRTGALTPVAK 357

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           LEPV +GG +++NATLHNEDYI+G+   G+ +RGG+D+R+GD V ++RAG+VIP+V+D+ 
Sbjct: 358 LEPVTVGGVVVSNATLHNEDYIRGIGQDGEPIRGGKDLRIGDTVQIQRAGDVIPQVIDVD 417

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
           + +R  DA PF+FP+ CP+C S  VR++N KTG+  A  RCTGGL C+AQ  E+LKHFVS
Sbjct: 418 LAKRPADAVPFAFPTVCPVCGSHAVREINAKTGRPDAVRRCTGGLVCAAQAKEKLKHFVS 477

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVT 536
           R+AF+IEGLG +Q++FF+        IR PADIFTL+ R   S   K++N  G+G+ S  
Sbjct: 478 RNAFDIEGLGDKQVEFFYDLPPEEGGIRTPADIFTLEARDAASPIRKLKNRDGWGETSAR 537

Query: 537 NLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWL 596
           NL+ +I+ RR + L RFIF+LGIRHVG   A+ LA+ Y S+  FA  +     H +D W 
Sbjct: 538 NLFAAIDARRRVDLNRFIFALGIRHVGEGNAKLLARAYGSWDAFAAAMRAAADHGSDAWA 597

Query: 597 SLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTG 656
            L  +  VG+++A+A+V+F+  P N  A++ALL EV+P          S +  K +VFTG
Sbjct: 598 ELNAIDGVGEVVAEAVVQFFAEPHNREALDALLAEVTPLDAEKVAAEGSPVAGKTVVFTG 657

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
            L+++ R +A+    +LGA V+  +S+KT +++ G   GSKL+ AQ+L ++++ E+ +  
Sbjct: 658 ALERMTRDEAKAMAERLGAKVAGSVSKKTSLVVAGPGAGSKLKTAQELDIEVITEDDWFD 717

Query: 717 LL 718
           L+
Sbjct: 718 LV 719


>gi|239825842|ref|YP_002948466.1| NAD-dependent DNA ligase LigA [Geobacillus sp. WCH70]
 gi|239806135|gb|ACS23200.1| DNA ligase, NAD-dependent [Geobacillus sp. WCH70]
          Length = 670

 Score =  588 bits (1515), Expect = e-165,   Method: Composition-based stats.
 Identities = 250/717 (34%), Positives = 389/717 (54%), Gaps = 53/717 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A K +  L + ++ ++  YY   +P + D+EYD L +   A+   +PDL      
Sbjct: 1   MDRQAAMKRIEELRELLNKYNYEYYVLDRPSVPDAEYDRLMQELIALEEQYPDLK---TK 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+   +  KV H  P LSL   +N  DLR F  R+     ++  + + +  E
Sbjct: 58  DSPSQRVGGQALDAFQKVEHRTPMLSLANAFNEGDLRDFDRRVR----QEVGDDVAYVCE 113

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            KIDG  +++RYE G FV  A RGDG +GED++  ++ I ++P  L+  +   +E RGE 
Sbjct: 114 LKIDGLAVSVRYEDGYFVQGATRGDGVTGEDITENLKTIRSLPLRLNEPV--TLEARGEA 171

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF 250
           Y+ K  F  LN++    G + +ANPRNAA+G LR+L+P    +R+L+ FV+ L    E+ 
Sbjct: 172 YMPKASFERLNEQRRNRGEELFANPRNAAAGSLRQLDPKIAASRHLDLFVYSLANAEELG 231

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L  ++ LGF  N   R+      ++ + NE    RS LPY+IDG+V KVD F 
Sbjct: 232 IDSHSAALDYLQQLGFKTNPERRRCANIDEVIQFVNEWHEKRSHLPYEIDGIVVKVDSFE 291

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            QKQLG  A+SPRW +++KF  ++  T+L+ I++ +GRTG++TP A LEPV + G  +  
Sbjct: 292 QQKQLGATAKSPRWAVAYKFPAEEVVTKLIGIELSVGRTGVVTPTAILEPVRVAGTTVQR 351

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED+I+            +DIR+GD V++K+AG++IP+VV+++ + R  +  PF  
Sbjct: 352 ATLHNEDFIR-----------QKDIRIGDSVIIKKAGDIIPEVVNVVPDRRTGEEVPFVM 400

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP C S +VR           A RC     C AQ  E L HFVSR A NIEGLG++ 
Sbjct: 401 PTHCPECASELVRFDGE------VALRCINPK-CPAQIREGLIHFVSRQAMNIEGLGEKV 453

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +   F+       I   AD++ L + Q         +   G+ S TNL  +I   +  SL
Sbjct: 454 ISQLFRE----GLIHDVADLYRLTKEQLI------RLERMGEKSATNLLRAIEASKQNSL 503

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           ER +F LGIRHVGA+ A+ LA+++ +                     L+ +  +G+ +A 
Sbjct: 504 ERLLFGLGIRHVGAKAAKVLAEHFGTMDRLQTATK----------EELMAIHEIGEKMAD 553

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKN-----VSSEIENKKLVFTGTLQKIQRHK 665
           +IV ++  P     +  L         +  K      V S    K +V TG L+ + R++
Sbjct: 554 SIVTYFAKPEVKELLNELRAYGVNMEYKGPKTPKPGDVHSYFAGKTVVLTGKLESLSRNE 613

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           A+E + QLG  V+  +S+ TD++I G + GSKL KAQQL ++I +EE+FL  ++Q  
Sbjct: 614 AKEKIEQLGGKVTGSVSKNTDLVIAGADAGSKLAKAQQLNIEIWDEERFLQEIEQNK 670


>gi|319407493|emb|CBI81141.1| DNA ligase [Bartonella sp. 1-1C]
          Length = 725

 Score =  587 bits (1513), Expect = e-165,   Method: Composition-based stats.
 Identities = 327/720 (45%), Positives = 463/720 (64%), Gaps = 16/720 (2%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           I+ L+  +A  EL  L +EI+ HD  Y++  +P I D+EYDAL RR + I   FP+L R+
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              + P +KIG  ++    K  H+ P LSL+  +N ED+ +FI RI RF +  +   I  
Sbjct: 66  ---DSPSSKIGAPISEKFEKSIHAQPMLSLDNAFNFEDVSEFIERIRRFLRLPETQIIEM 122

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
           T EPKIDG  +++RYE GK V A  RG+G  GE+V+   R I  IP++L  N P+IIEVR
Sbjct: 123 TAEPKIDGLSLSLRYEAGKLVRAITRGNGSIGENVTTNARTIADIPQILQANFPDIIEVR 182

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTS 247
           GEVY+ + DF  LN      G+  +ANPRNAA+G LR+L+     +R L FF +  G+ S
Sbjct: 183 GEVYMGQKDFQLLNINQQKEGKLVFANPRNAAAGSLRQLDSRITASRNLKFFAYAWGEVS 242

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
           E+ A+ Q  M++K++  GF +N   +       ++SYY+ ++  R +L YDIDG+VYKV+
Sbjct: 243 EMPAESQIGMMKKLKEYGFIINPLTKVFEKVEDLISYYHSIEECRQSLDYDIDGIVYKVN 302

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +  LQ +LG  ARSPRW I+HKF  ++A   L DIDIQ+GRTG LTPVARL P+ +GG +
Sbjct: 303 DLMLQTRLGFVARSPRWAIAHKFPAEKAIAFLEDIDIQVGRTGALTPVARLTPITVGGVV 362

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNA+LHNEDYIKG+   G+ +R GRDIRVGD V+++RAG+VIP++VD++V +R  D   
Sbjct: 363 VTNASLHNEDYIKGIGHKGEPIREGRDIRVGDTVIIQRAGDVIPQIVDVLVEKRPKDTPA 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F FP  CP+C S  VR+            RCTGGL CSAQ +ER+ HFVSR+AF+IEG G
Sbjct: 423 FIFPHVCPVCGSHAVREEGET------VRRCTGGLICSAQAIERICHFVSRNAFDIEGFG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++Q++FFF ++D    IR P DIFTLQRRQ+ S  ++EN+ GFG VSV  LY++IN RR 
Sbjct: 477 RKQVEFFFHAQDKMLCIRSPVDIFTLQRRQENSLKRLENMEGFGVVSVRKLYNAINARRE 536

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNII------AHNNDDWLSLIRV 601
           ISL RF+F+LGIRH+G   A+ LA+ Y +Y  F     + I         N+ W+ L  +
Sbjct: 537 ISLSRFLFALGIRHIGEVKAQRLARAYQNYTAFETAAMSAIMPPDKNNEGNEIWVELTNI 596

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G  + +AI++FYQ   N   + ALLKEV+P          S I  K + FTGTL+ +
Sbjct: 597 EGIGFRVGKAIIDFYQEVHNRDILSALLKEVTPLHEAPVTIDYSPIVGKIITFTGTLEHM 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
            R +A+    +LGA  S  +S+KTD+++ G   GSKL KAQQLG+++++E+ +L L+  +
Sbjct: 657 SRDEAKSLAERLGAKTSNSISKKTDLLVAGFGAGSKLTKAQQLGIEVLDEKNWLKLIDGH 716


>gi|268593162|ref|ZP_06127383.1| DNA ligase, NAD-dependent [Providencia rettgeri DSM 1131]
 gi|291311208|gb|EFE51661.1| DNA ligase, NAD-dependent [Providencia rettgeri DSM 1131]
          Length = 671

 Score =  587 bits (1513), Expect = e-165,   Method: Composition-based stats.
 Identities = 244/709 (34%), Positives = 400/709 (56%), Gaps = 49/709 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++E+  L++++ +H+  Y+    P I D EYD L +R   I    P+L  S   + P  +
Sbjct: 4   KQEIDELKKQLRHHEYQYHVLDAPEIPDVEYDKLMQRLKEIEAQHPELVTS---DSPTQR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G     +   V H IP LSL+ +++ E    F  R+      K+   + F  E K+DG 
Sbjct: 61  VGAAPLAAFDTVRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KNHQELTFCCELKLDGL 118

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKN 196
            +++ YE G+ V AA RGDG  GE+++A +R I  IP  L  +  P+ +E+RGEV++ + 
Sbjct: 119 AVSLLYENGELVQAATRGDGTVGENITANVRTIRAIPLRLRGSNIPDRVEIRGEVFMPQK 178

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF-AKGQ 254
            F ALN++      K +ANPRNAA+G LR+L+P     R L F+ +G+G           
Sbjct: 179 GFEALNEQARKTDGKVFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGLVEGGSLPDTH 238

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           Y+ L + +  G PV++ V+       ++ +Y+E++ +R  L +DIDG+V KV+  ++Q++
Sbjct: 239 YDRLMQFKAWGLPVSDYVQLRVGHQAVLDFYHEIEQVRPDLGFDIDGVVIKVNSIAIQEE 298

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +R+PRW  + KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++NATLH
Sbjct: 299 LGFVSRAPRWATAFKFPAQEQVTLLKDVEFQVGRTGAITPVARLEPVQVAGVVVSNATLH 358

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            + +GD V+++RAG+VIP++V ++V++R  D++   FP+ C
Sbjct: 359 NADEIERL-----------GVHIGDTVIIRRAGDVIPQIVSVVVDKRPTDSREIVFPTHC 407

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S + R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + +D  
Sbjct: 408 PVCGSDIERVEGE------AVARCTGGLICGAQRKEALKHFVSRRAMDVDGMGDKIIDQL 461

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     ++ PAD++ L      S   +  +   G  S  NL D++NK +  +L RFI
Sbjct: 462 VEKE----YVKTPADLYQL------SAGILTGLDRMGPKSAQNLVDALNKSKQTTLARFI 511

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           ++LGIR VG   A +LA +Y + +               D  SL  V  +G ++A+ +V 
Sbjct: 512 YALGIREVGEATAANLAAHYTTLEAVMTA----------DEESLKTVQDIGHVVAKHVVN 561

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           F++ P N   +E LL + +      +      + S    K +V TG++  + R +A++ +
Sbjct: 562 FFREPHNQAVIEDLLTKANIHWPEVKVVNSAEIDSPFAGKTVVLTGSMSVLTRDEAKDKL 621

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             LGA VS  +S+KTD++I G+  GSKL KA +LG+++++E + + LL 
Sbjct: 622 VALGAKVSGSVSKKTDLVIAGEAAGSKLAKANELGIRVIDENELVRLLN 670


>gi|302390293|ref|YP_003826114.1| DNA ligase, NAD-dependent [Thermosediminibacter oceani DSM 16646]
 gi|302200921|gb|ADL08491.1| DNA ligase, NAD-dependent [Thermosediminibacter oceani DSM 16646]
          Length = 672

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 250/716 (34%), Positives = 384/716 (53%), Gaps = 48/716 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +   +A   +  L + I+YH+  YY Y  P+I D+EYD L R+ + +   FP+L     P
Sbjct: 1   MDRSEAEARIKELRELINYHNRQYYVYDNPVISDAEYDKLMRQLEKLEKQFPELI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE      +V H +P +SL   ++  +L+ F  R+           + + +E
Sbjct: 58  DSPSQRVGGEPLPYFTQVVHRVPMMSLANAFDSGELKDFHRRVTEAVGS----EVQYVVE 113

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP---RVLSLNIPEIIEVR 188
           PKIDG  ++I YE G F  AA RGDG  GEDV+  ++ I ++P          P ++EVR
Sbjct: 114 PKIDGLAVSITYENGIFKTAATRGDGEVGEDVTQNVKTIKSVPLSLDFPPDKRPAVLEVR 173

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+ K DF  LN+E    G   +ANPRNAA+G LR+L+P     R L  +++GLG   
Sbjct: 174 GEVYLPKEDFRKLNEEREEQGLPLFANPRNAAAGSLRQLDPKVTAKRPLAVYIYGLGYAE 233

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
            I  +  YE+LQ  + +G  VN  V   + F  ++ Y       R  LPY+IDG+V KV+
Sbjct: 234 GIEFETHYEVLQFFKRIGLRVNPHVVLFDRFQDVIDYCMSWNEKRHDLPYEIDGMVIKVN 293

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               Q  LG  A+SPRW I++KF  +Q  T + DI +++GRTG+LTP A LEPV + G+ 
Sbjct: 294 SLKQQGILGATAKSPRWAIAYKFPAEQKKTVIKDIIVRVGRTGVLTPTAILEPVRVAGST 353

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHNEDYI+            +DI++GD V++ +AG+VIP+VV+++  +R    + 
Sbjct: 354 VSKATLHNEDYIR-----------EKDIKIGDTVIIHKAGDVIPEVVEVVKEKRTGKERD 402

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P  CP C S  VR          AA+RCT    C AQ    ++HF SRDA +I GLG
Sbjct: 403 FEMPHRCPECGSEAVRLPGE------AAYRCTNSTGCPAQIRRSIEHFASRDAMDIRGLG 456

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
              +            I+  AD++ L+R           +   G+ S  NL  +I + + 
Sbjct: 457 SAIVSLLISQ----GLIKDAADLYYLKREDLV------PLERMGEKSAANLLAAIEESKK 506

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
             L+R I++LGI  VG+  A  LA+ + S  +  +            +  LI+VP +GD 
Sbjct: 507 RPLDRLIYALGIPFVGSRTASLLAEAFSSIDDLQKA----------KYEDLIKVPEIGDK 556

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           IAQ+I+ F++  +    +  L         + +      ++    V TGTL+K  R +A 
Sbjct: 557 IAQSILAFFRQEQTNDLISRLRAAGVNMEAQKKAEGPRPLDGLTFVLTGTLEKYTRQQAT 616

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
           E + +LG  V+  +S+KTD ++VG +PGSK E A +LG+KI+NE +F  L++++  
Sbjct: 617 ELIEKLGGRVTGSVSKKTDYVVVGKDPGSKYENALKLGIKILNEGEFEELIEKWKA 672


>gi|209963935|ref|YP_002296850.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
 gi|254781401|sp|B6IRF1|DNLJ_RHOCS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209957401|gb|ACI98037.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
          Length = 719

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 302/738 (40%), Positives = 433/738 (58%), Gaps = 40/738 (5%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           +   + IP+E L+++QA  E ++L +EI++H   YY    P I DS YDAL+ R   +  
Sbjct: 4   LSDTRHIPVETLTLDQAAAEHAALVREIAHHRALYYGKDAPEIADSAYDALEHRLAGLEA 63

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L     P+ P   +G   +    KV H +P LSL+  +  ED+  F+ +I RF   
Sbjct: 64  RFPELV---TPDSPTQTVGAAPSAGFGKVRHRVPMLSLDNAFTAEDVDGFVEQIARFLNL 120

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
           K+ + + F  EPKIDG  +++RYE G    AA RGDG  GEDV+A +R I  IP  L   
Sbjct: 121 KEVDGLEFVAEPKIDGLSLSLRYENGALAQAATRGDGAEGEDVTANVRTIREIPDRLPAG 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
            P ++EVRGEVY+ + +F ALN      G K +ANPRNAA+G LR+L+P+    R L FF
Sbjct: 181 APSVLEVRGEVYMVREEFFALNRRQAEAGEKVFANPRNAAAGSLRQLDPSVTAKRPLCFF 240

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G  SE     Q+E LQ+++ LGF V    R   +   ++ YY  + + R+ LP+DI
Sbjct: 241 AYSWGDLSEPLGATQWEALQRLKALGFRVPAQSRLCRSKAELLDYYAGIGAGRAALPFDI 300

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKV+   LQ++LG R R+PRW  +HKF  ++A T L  I IQ+GRTG LTPVA LE
Sbjct: 301 DGVVYKVNRLDLQERLGFRTRTPRWATAHKFPAERAQTLLRAITIQVGRTGALTPVAELE 360

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG +++ ATLHN D I             +DIRVGD V+V+RAG+VIP+VV+++  
Sbjct: 361 PVTVGGVVVSRATLHNADEIAR-----------KDIRVGDTVVVQRAGDVIPQVVEVVTE 409

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
            R  D+ PF FP  CP C S  VR+ +       A  RCTGGL C AQ +ERL+HFVSR+
Sbjct: 410 RRPADSAPFVFPDHCPECGSAAVREED------GAVSRCTGGLVCPAQAVERLRHFVSRN 463

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+IEGLG +++  F+  +     IR PADIFTL+RR+     ++  + GFG  SV NL+
Sbjct: 464 AFDIEGLGIERIQLFYDQDR----IRSPADIFTLERREAQRLDRLVAMTGFGRKSVENLF 519

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNN------- 592
            +I+ RR I L+RFIF+LGIR VG   A+ LA+ Y S   + + +    A  +       
Sbjct: 520 RAIDARRRIPLDRFIFALGIRQVGEATAKLLARTYRSVGPWTERMAAAAAERSANPDEAK 579

Query: 593 ------DDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIG--RHEKNVS 644
                 + +  L  +  +G  +A  I  F+  P N  A++ALLKE+          +   
Sbjct: 580 KPELVGEAYAELCAIEQIGMSVADDICAFFAEPHNRDALDALLKELEAVEDHVPPPRADG 639

Query: 645 SEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQL 704
           S +  K +VFTGTL+ + R +A+     LGA V+  +S KTD ++VG + GSK  KA++L
Sbjct: 640 SPVAGKTVVFTGTLETMGRSEAKARAEALGAKVAGSVSGKTDYVVVGADAGSKAAKAREL 699

Query: 705 GVKIMNEEQFLFLLQQYN 722
           G+ I+ E+++L L+ Q  
Sbjct: 700 GLTILTEQEWLDLISQPG 717


>gi|13471538|ref|NP_103104.1| DNA ligase [Mesorhizobium loti MAFF303099]
 gi|75543387|sp|Q98KC4|DNLJ_RHILO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|14022280|dbj|BAB48890.1| DNA ligase [Mesorhizobium loti MAFF303099]
          Length = 734

 Score =  586 bits (1511), Expect = e-165,   Method: Composition-based stats.
 Identities = 298/737 (40%), Positives = 438/737 (59%), Gaps = 32/737 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+++LS  +A  EL  L +EI+ HD  Y+    P I D+EYDAL+RR  AI   FP L R
Sbjct: 5   PVDSLSESEAEAELKRLAEEIAGHDRRYHAEDAPTITDAEYDALRRRNLAIEERFPGLVR 64

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  ++G        KV H++P LSL K +  ED+  FI R  RF+ +  D  I 
Sbjct: 65  E---DSPSRRVGAPPAEGFAKVRHAVPMLSLAKAYTDEDVTDFIERGRRFFDRDKDLDIA 121

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           FT EPKIDG   ++RYE G FV  A RGDG  GED++A +R I  IP  L  +  P++IE
Sbjct: 122 FTAEPKIDGLSASLRYENGVFVQGATRGDGAVGEDITANLRTIADIPAKLKGSGWPDVIE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++  +F AL     A G + Y NPRN A+G LR+ + +   +R L FF +  G 
Sbjct: 182 IRGEVYMTYAEFEALKARSAAAGGQDYVNPRNTAAGSLRQKDASVTASRNLKFFAYAWGF 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
           T+   A  QYE +QK    GF ++  + +A +   +V+ Y+ ++  RS+L YDIDG+VYK
Sbjct: 242 TTADPAPTQYESVQKFADWGFKISPLMVRAKSVEELVAQYHLIEEQRSSLGYDIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+  LQ++ G     PRW ++HKF  +QA T +  IDIQ+GRTG L PVARL PV +GG
Sbjct: 302 VDQLELQRRWGFVTGEPRWAVAHKFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ N TLHNEDYIKG D++G  +R G D+R+GD V+++RAG+VIP++V +++++R  DA
Sbjct: 362 VVVENVTLHNEDYIKGFDSNGLPIRDGIDVRIGDTVVIQRAGDVIPQIVSVVIDKRPADA 421

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP+C S   R++N KTGK  +  RCTG L C+AQ +ERL+HFVSR A +IEG
Sbjct: 422 VPYEFPHTCPVCGSPATREINEKTGKEDSRRRCTGELICAAQAVERLRHFVSRGALDIEG 481

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQ----------------------TSTTK 523
           LG + +D FF     A  I+  ADIFTL+ R+                        +   
Sbjct: 482 LGAENIDTFFN----AGLIKTAADIFTLRDRRPAVTKALAERREEQARQREAASGKTRKN 537

Query: 524 IENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQE 583
           + ++       +  L+ +I+ RR   L+RFIF+LGIRH+G   A  LAK + + +   + 
Sbjct: 538 VRSVEDRNYEGLDKLFAAIDSRREPELDRFIFALGIRHIGETTAAVLAKTFSTIEELIR- 596

Query: 584 INNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV 643
           +    A   D       V  +GD +  A+ +F+ N RN   ++ LL++V P       + 
Sbjct: 597 VGKETAAAEDPHTVFPSVNGIGDTVIDALCDFFGNERNDDVLDKLLEQVKPKPYIVTVSA 656

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQ 703
            SE+  K +VFTGTL+K+ R +A+    +LGA V+  +S KTD+++ G   GSKL+ A +
Sbjct: 657 DSEVAGKTIVFTGTLEKMTRSEAKAMAERLGAKVAGSVSAKTDLLVAGPGAGSKLKLASE 716

Query: 704 LGVKIMNEEQFLFLLQQ 720
           LGV++++E+ +L  + +
Sbjct: 717 LGVEVIDEDTWLQRVGK 733


>gi|134300185|ref|YP_001113681.1| NAD-dependent DNA ligase [Desulfotomaculum reducens MI-1]
 gi|190359251|sp|A4J703|DNLJ_DESRM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|134052885|gb|ABO50856.1| DNA ligase, NAD-dependent [Desulfotomaculum reducens MI-1]
          Length = 670

 Score =  586 bits (1511), Expect = e-165,   Method: Composition-based stats.
 Identities = 248/716 (34%), Positives = 385/716 (53%), Gaps = 49/716 (6%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +  LS +Q++  + +L +EI++H+  YY   +P I D++YD L +    +    P+L   
Sbjct: 1   MADLS-QQSKARVEALRREINHHNYQYYVLDQPTITDAQYDQLMQELLRLEERHPELV-- 57

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
             P+ P  ++GG++      V H IP LSL   +   DLR+F  R+  +        + +
Sbjct: 58  -TPDSPTQRVGGQVQRGFSSVPHKIPMLSLGNAFGEGDLREFDRRVRSYL---PGEEVKY 113

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
            +E KIDG  I++ YEKG  V  A RGDG  GED++  ++ I  IP  L+  +P  +EVR
Sbjct: 114 VVELKIDGLAISLWYEKGLLVRGATRGDGELGEDITINLKTIRAIPLRLTQEVP-FLEVR 172

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE Y+ K+ F+ LN+     G   +ANPRNAA+G LR+L+P     R L+ F++ +G   
Sbjct: 173 GEAYMPKDSFVRLNEAREEAGEPLFANPRNAAAGSLRQLDPKITAARNLSVFMYAIGYIE 232

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
                   E L  ++ LG  +N   +   +   ++ + ++ ++ R  LPY IDG+V KV+
Sbjct: 233 GAKPPSHAESLAWLKELGIRINPDHQVCGSIDEVIDFISQWQAKRYQLPYAIDGMVIKVN 292

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               Q++LG   +SPRW I++KF  +QA + + DI I++GRTG+LTP A LEPV + G  
Sbjct: 293 SLEQQQRLGTTMKSPRWAIAYKFPAEQAVSTIKDIIIRVGRTGVLTPTAILEPVQLAGTT 352

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHNED I+            +DIR+GD+ LV++AG++IP++V +   +R  +  P
Sbjct: 353 VSKATLHNEDIIR-----------QKDIRIGDKALVQKAGDIIPEIVQVYPEKRTGNEVP 401

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P  CP C + VVR          AAHRCT    CSA+  E + HFVSR A +I GLG
Sbjct: 402 FILPVTCPECGAEVVRVAGE------AAHRCTN-ENCSAKSREGIIHFVSRSAMDIMGLG 454

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           +  ++   K       ++ PAD++ L+                G  S   L  +I   +N
Sbjct: 455 EGIVNQLIK----GGLVKDPADLYDLKYEDLIRQ------ERMGARSSQKLLAAIEASKN 504

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            SL + +F LGIRHVG   A+ LA+ + S Q   Q               L  +  +G  
Sbjct: 505 NSLGQLLFGLGIRHVGERAAKILARQFGSMQALMQAT----------AEDLTGISEIGPR 554

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHK 665
           IA++I+E++    N   +E L K     +   E  ++    +  K  V TGTL+   R +
Sbjct: 555 IAESIMEYFSRQENQGLIERLSKAGVNMLEEVEQTESTDQTLSGKTFVVTGTLEGFSRQE 614

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           AQ  + + G  VS  +S+KT+ ++VG+NPGSK +KA+QLG+ I+ E+ F+ LLQQ 
Sbjct: 615 AQRAIEERGGKVSGSVSKKTNYVVVGENPGSKHDKARQLGITILTEQDFVKLLQQQ 670


>gi|83858905|ref|ZP_00952427.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
 gi|83853728|gb|EAP91580.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
          Length = 695

 Score =  586 bits (1510), Expect = e-165,   Method: Composition-based stats.
 Identities = 299/716 (41%), Positives = 448/716 (62%), Gaps = 30/716 (4%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           L  + AL+ ++A  EL  L +EIS HD  YY+   P I D+ YDAL+ R  AI   FP+L
Sbjct: 5   LKDVNALTSDEAASELERLAREISRHDKAYYEKDAPKISDAAYDALRARNSAIEARFPEL 64

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R    + P +++G + +    +V H++P LSL   +  +D+R F  RI RF   K D  
Sbjct: 65  KRK---DSPSDRVGAKPSEQFGEVVHAVPMLSLGNAFEDQDVRDFADRIRRFLNLK-DEK 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEII 185
           + FT EPKIDG    +RYE+G+ V  A RGDG +GE+V+A ++ I  IP  L  ++P+++
Sbjct: 121 LVFTAEPKIDGLSANLRYEQGELVIGATRGDGRTGENVTANLKTIADIPHRLEGDVPDVL 180

Query: 186 EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG 244
           EVRGEVY+S  DF  LN      G+  Y NPRNAA+G LR+++P     R L FF +  G
Sbjct: 181 EVRGEVYMSHADFAQLNAMQEERGKPAYKNPRNAAAGSLRQIDPNVTAERPLRFFAYAWG 240

Query: 245 KTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVY 304
           + SE  A+ QY+ ++++  LGF +N+ + +  +   ++++Y  +++ R+ L YDIDG+VY
Sbjct: 241 ELSEPLAETQYDAVKRLGQLGFVINDDMVRVESVEDVLAHYRALEAKRADLGYDIDGVVY 300

Query: 305 KVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIG 364
           KVD    Q++LG  AR+PRW I+HKF+ ++A TRL  I+IQ+GRTG LTPVA+LEPV +G
Sbjct: 301 KVDRLDWQERLGFVARAPRWAIAHKFSPEKAVTRLNAIEIQVGRTGALTPVAKLEPVTVG 360

Query: 365 GALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPD 424
           G +++NATLHN+D I+            +D+RVGD V+++RAG+VIP+VV++++++R   
Sbjct: 361 GVVVSNATLHNQDEIER-----------KDVRVGDTVIIQRAGDVIPQVVEVVLDKRPEA 409

Query: 425 AQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIE 484
           A+PF+FP+ CP+C S  VR+            RCTGGL C AQ +ERLKHFVSR AF+IE
Sbjct: 410 AEPFAFPTLCPVCGSHAVREEGE------VVRRCTGGLICDAQAVERLKHFVSRKAFDIE 463

Query: 485 GLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKI--ENILGFGDVSVTNLYDSI 542
           GLG +Q++ FF        ++ PADIFTL+ R +        +   G+G+ S  NL+ SI
Sbjct: 464 GLGAKQIEAFFHE----GLVKQPADIFTLRARNEAGEINPPIQTREGWGERSAANLFGSI 519

Query: 543 NKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVP 602
           ++RRNI L RF+F+LGIRHVG E AR +A+ + S+Q   +          + + + + + 
Sbjct: 520 DQRRNIGLARFLFALGIRHVGEETARLIARSFTSWQVVRE-TAEAANEPGEAFAAFMDID 578

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
            +G+   +A+ EF+    N  A+ ALL  V+      +    S +  K +VFTG+L++  
Sbjct: 579 GIGETAVKALAEFFAESHNQDALNALLAHVTVEDAE-QVAAESPVAGKTVVFTGSLERFT 637

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A+     LGA VS  +S KTDI++ G   GSKL+KAQ+LGV+ M E+++L L+
Sbjct: 638 RDEAKAKAQSLGAKVSGSVSGKTDILVAGPGAGSKLKKAQELGVQTMTEDEWLALI 693


>gi|94499335|ref|ZP_01305873.1| DNA ligase, NAD-dependent [Oceanobacter sp. RED65]
 gi|94428967|gb|EAT13939.1| DNA ligase, NAD-dependent [Oceanobacter sp. RED65]
          Length = 694

 Score =  586 bits (1510), Expect = e-165,   Method: Composition-based stats.
 Identities = 251/711 (35%), Positives = 378/711 (53%), Gaps = 46/711 (6%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
            ++ L  E++  +  YY    P I D+EYD L      +    P+L      + P  ++G
Sbjct: 25  RVAELRDELNRANHAYYVLDDPSIPDAEYDRLFHELKGLESKHPELL---TKDSPTQRVG 81

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
                    V H +P LSL+  ++ +D+R F  RI      K  +SI F  EPK+DG  +
Sbjct: 82  ATPLSEFETVAHEVPMLSLDNAFDDQDMRDFNRRISERLTTK--SSIRFACEPKLDGIAV 139

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVYISKNDF 198
           ++ YE GK V AA RGDG  GE+++  IR + ++P  L  N  P ++EVRGEVY+ K  F
Sbjct: 140 SLLYENGKLVRAATRGDGAVGENITQNIRTVYSVPLTLMGNDHPPVLEVRGEVYMPKKGF 199

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSE-IFAKGQYE 256
            A N +    G K + NPRNAA+G LR+L+     +R L F  + +G+           E
Sbjct: 200 EAFNVKARERGEKTFVNPRNAAAGSLRQLDSRITASRPLEFCCYSMGRVDGAELPTVHSE 259

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
           +L+K    GF +N  +       G + YY  + + R+ LPY+IDG+VYKVD+  LQ++LG
Sbjct: 260 ILKKFSEWGFKINPEMAVVEGVEGCLDYYENLAAKRNDLPYEIDGIVYKVDDLKLQQRLG 319

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             +R+PRW I+ KF  ++  T L  I+ Q+GRTG +TPVARLEPV +GG  ++NATLHN 
Sbjct: 320 FVSRAPRWAIARKFPAQEEMTLLKGIEFQVGRTGAITPVARLEPVFVGGVTVSNATLHNM 379

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D ++ L           D R+GD V+++RAG+VIP+V  ++  +R  ++Q    P  CP+
Sbjct: 380 DEVERL-----------DARIGDTVVIRRAGDVIPQVASVVKEKRPDNSQKIQLPDACPV 428

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S V R          A  RCTGGL C+AQ+ E +KHF SR A +I+GLG + ++    
Sbjct: 429 CDSHVERVEGE------AVARCTGGLVCAAQRKEAIKHFASRKAMDIDGLGDKIVEQLVD 482

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
                  I+   D++ L+     S      +   GD S  NL  +I   +N S  +F+++
Sbjct: 483 E----GKIKSFVDLYKLKHEDIAS------LERMGDKSAQNLLKAIEASKNTSFPKFLYA 532

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR VG   A +L +++L+ +   +            +  LI V  VG I+A+ I+ F+
Sbjct: 533 LGIREVGVATANNLVQHFLTIRALVKA----------SFDELIEVDDVGPIVAEHILNFF 582

Query: 617 QNPRNICAVEALLKEVSPSIGRHEK-NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGA 675
             P N   ++ LL             N    +  +  V TGTL  + R  A+ Y+ QLGA
Sbjct: 583 AEPHNQTIIDGLLNIGITWPEVKSVSNSELPLSGETYVVTGTLSAMGRENAKAYLQQLGA 642

Query: 676 VVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTTLR 726
            V+  +S+KT  ++ G+  GSKL KAQ L V +++EEQFL LL ++     
Sbjct: 643 KVAGSVSKKTSALVAGEKAGSKLTKAQDLEVPVLDEEQFLSLLAEHGIEPE 693


>gi|238752012|ref|ZP_04613496.1| DNA ligase [Yersinia rohdei ATCC 43380]
 gi|238709712|gb|EEQ01946.1| DNA ligase [Yersinia rohdei ATCC 43380]
          Length = 670

 Score =  585 bits (1509), Expect = e-165,   Method: Composition-based stats.
 Identities = 246/712 (34%), Positives = 405/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L+  + +H+  YY    P I D+EYD + ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLKTSLRHHEHQYYVLDAPEIPDAEYDRMMQQLRELEAQHPELITN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++GG    +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGGAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++  +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITVNVRTIRAIPLRLHGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNEEARRKGGKIFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLVDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV++ V+       ++++Y +++  R+ L +DIDG+V KVD  +
Sbjct: 236 PRSHIQRLMQFKDWGLPVSDRVKLCTGSDQVIAFYRQVEQDRAELGFDIDGVVIKVDSLN 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R PDA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPPDAKEILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PDHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIVALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRTLANLRAA----------DIDALKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +EAL + ++    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLNEEHNQKVIEALEQVITWPEPQRIITEEIDSPFAGKTVVLTGSLTVLSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLIKAQELGIKVIDEAEMILLLGE 670


>gi|84686905|ref|ZP_01014789.1| DNA ligase, NAD-dependent [Maritimibacter alkaliphilus HTCC2654]
 gi|84665102|gb|EAQ11582.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium HTCC2654]
          Length = 710

 Score =  585 bits (1509), Expect = e-165,   Method: Composition-based stats.
 Identities = 292/720 (40%), Positives = 426/720 (59%), Gaps = 13/720 (1%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M       +E L    AR EL+ L   ++  +  Y+    P + D+ YDA KRR   I  
Sbjct: 1   MTGHSETAVEKLDEAGARAELARLADLLASANTAYHTEDAPEMSDAAYDAAKRRNAEIEA 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
            FP+L R    + P +++G        KV H +  LSL   ++ + +  F  ++  F   
Sbjct: 61  RFPELKRD---DSPTDQVGAAPAEGFSKVRHRVRMLSLANAFDDDHVIDFDRQVRAFLGF 117

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
             +  + FT EPKIDG  +++RYE G+ + AA RGDG  GE+V+A  R I  IP+ LS  
Sbjct: 118 SAEEPLAFTAEPKIDGLSLSLRYENGELMQAATRGDGGEGENVTANARTIDDIPQRLSGA 177

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFF 239
            P+++EVRGEVY+S +DF  LN+   A G K +ANPRNAA+G LR+L+          F+
Sbjct: 178 -PDVLEVRGEVYMSHDDFARLNESQSAKGGKTFANPRNAAAGSLRQLDSRITEARPLRFY 236

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +  G+ S+  A  Q   ++K+  LGF  N   +   T   +  +Y+ ++  R+TL YDI
Sbjct: 237 AYAWGELSDPLADTQMGAIEKLADLGFSTNPLTKIVETPEAMFDHYHAIEEQRATLGYDI 296

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+VYKV++ +LQK+LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL 
Sbjct: 297 DGVVYKVNDLALQKRLGFRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLS 356

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV +GG +++NATLHNEDYI G D+ G  +RGG+DIRVGD V V RAG+VIPKV D+ + 
Sbjct: 357 PVTVGGVVVSNATLHNEDYIAGRDSKGGDIRGGKDIRVGDWVQVYRAGDVIPKVADVDLT 416

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
           +R  DA+P+ FP  CP C S  +R+         A  RCTGG+ C AQ +E+LKHFVSR 
Sbjct: 417 KRPDDAEPYVFPDTCPECGSEAIREEG------DAVRRCTGGMICPAQAVEKLKHFVSRS 470

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           AF+IEGLG +Q++ F+   D    IR PADIFT  RR   +  K++N  G+G+ S   L+
Sbjct: 471 AFDIEGLGAKQVEAFYF--DEGLPIREPADIFTFARRDGAALAKLKNRDGWGEKSAAKLF 528

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
           ++I +RR I L R IF+LGIRHVG   A  LA++Y  +  F   +          W  L+
Sbjct: 529 EAIEERRRIPLNRVIFALGIRHVGENSANLLARHYGDWPTFEAAMTGASPEGGAAWEELL 588

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQ 659
            +  VG+ +A ++V  +       +++ L+ E+        +   S +  K +VFTGTL+
Sbjct: 589 SIDGVGETMATSLVTTFHQEAERASIDRLVAELDIEPVEAPQTEGSPVAGKTVVFTGTLE 648

Query: 660 KIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           K+ R +A+     LGA VS  +S KTD+++ G   GSK +KA +LG++ ++E+ +L L+ 
Sbjct: 649 KMTRAEAKARAEALGAKVSGSVSAKTDLLVAGPGAGSKAKKAAELGIETIDEDGWLDLIN 708


>gi|83592275|ref|YP_426027.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
 gi|123753272|sp|Q2RVV5|DNLJ_RHORT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83575189|gb|ABC21740.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
          Length = 698

 Score =  585 bits (1509), Expect = e-165,   Method: Composition-based stats.
 Identities = 282/719 (39%), Positives = 421/719 (58%), Gaps = 31/719 (4%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           +IP+  L+  +A +EL  L  EI+ HD  Y+Q   P I D EYDAL RR + I  AFP+L
Sbjct: 1   MIPVADLTEAEAARELERLAAEIARHDRLYHQQDAPEITDGEYDALVRRNNEIEAAFPEL 60

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
            R    + P   +G        KVTH++P LSL  +++ ++ R+F  RI RF     + +
Sbjct: 61  VRG---DSPSAHVGAAPAEGFAKVTHALPMLSLGNVFSDDEAREFDQRIRRFLSLDGETT 117

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV--LSLNIPE 183
           I +  EPKIDG   + RYE G +  AA RGDG +GED++A +  +  +P+       +PE
Sbjct: 118 ISYVAEPKIDGLSFSARYENGVYRRAATRGDGTTGEDITANLATLTDLPQRLTGDGPVPE 177

Query: 184 IIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHG 242
           ++EVRGEV+++K DF ALN   I  G KP+ANPRNAA+G LR+L+P    +R L+ F + 
Sbjct: 178 VLEVRGEVFMTKADFRALNQRQIDAGAKPFANPRNAAAGSLRQLDPEITRSRSLSLFAYA 237

Query: 243 LGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGL 302
            G+   +  +  +  L++++  GFPVN   R       ++   + +   R+ L YDIDG+
Sbjct: 238 SGEVKGLEVESHHAFLERLKTWGFPVNPQTRPCQGVEDLIEATHALALQRAALDYDIDGV 297

Query: 303 VYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVN 362
           VYKVD    QK+LG  +R+PRW I+ KF  ++A T +  I IQ+GRTG LTPVA LEPV 
Sbjct: 298 VYKVDRVDWQKRLGFVSRAPRWAIARKFPAERAQTTVKAIQIQVGRTGTLTPVAILEPVT 357

Query: 363 IGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERH 422
           +GG ++  ATLHNED I             +D+R+GD V ++RAG+VIP+VV++++++R 
Sbjct: 358 VGGVVVGRATLHNEDEIAR-----------KDVRIGDMVTIQRAGDVIPQVVEVLLDQRP 406

Query: 423 PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFN 482
            D+ PF FP  CP+C S  VR           A RC GGL CSAQ +ERLKHFVSRDAF+
Sbjct: 407 ADSAPFVFPETCPVCGSHAVRQEGE------VARRCAGGLICSAQAVERLKHFVSRDAFD 460

Query: 483 IEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQT--STTKIENILGFGDVSVTNLYD 540
           IEGLG + ++ F         I  PADIF L+ +     +   + +  G+G  S  NL+ 
Sbjct: 461 IEGLGGKHIETFHNE----GLITQPADIFALEAKDNEPGALQHLRSREGWGPKSAENLFK 516

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           +I  R+ I L+RFI++LGIR VG   AR LA +Y S+  + + ++      ++ +  L  
Sbjct: 517 AITARKTIPLDRFIYALGIRQVGQATARLLAGHYASFAAWRKAMDEAQTEGSEAFADLQN 576

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTL 658
           +  +G  +A+ +V F+    N  A++AL+          R +    S +  K +VFTGTL
Sbjct: 577 IESIGPSVARDLVAFFGEEHNRAALDALIDAGVEVLDFARPQAAGDSPLAGKTVVFTGTL 636

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
             + R +A+     LGA V+  +S KTD ++VG + GSK +KA++LG+ +++E +F  +
Sbjct: 637 DTMSRGEAKARALALGAKVTGSVSAKTDYVVVGADAGSKEKKARELGLTVLSEAEFRAM 695


>gi|311278661|ref|YP_003940892.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
 gi|308747856|gb|ADO47608.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
          Length = 671

 Score =  585 bits (1509), Expect = e-165,   Method: Composition-based stats.
 Identities = 255/713 (35%), Positives = 393/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L++L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MEPIEQQLTALRATLRHHEYLYHVMDAPELPDAEYDRLMRELRELEAKHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E   +  +V H IP LSL+ +++ E    F  R+      K  + + +  E K
Sbjct: 58  PTQRVGAEPLGAFSQVRHEIPMLSLDNVFDEESFLAFNKRVQDRL--KSSDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGLLVRAATRGDGTTGEDITANVRTIRAIPLKLRGDDVPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +NDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINDEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L++ +  G PV++ V   N+   +++YY +++  R TL +DIDG+V KVD   
Sbjct: 236 PASHLGRLRQFKSWGLPVSSRVTLCNSPEEVLAYYRKVEEDRPTLGFDIDGVVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPDDTREIEF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PAHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  S 
Sbjct: 459 IDQLVEKE----YVLTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKETSF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA +Y S +                   L  VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHYGSLEALIAA----------SIDDLQTVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   ++ LL E       +    + + S    K +V TG+L  + R  A+
Sbjct: 559 HVFNFFAEESNREVIQQLLAEGIHWPAPVVVKAEEIDSPFAGKTVVLTGSLSLMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L LL +
Sbjct: 619 ARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIAVIDEAEMLRLLGE 671


>gi|238765534|ref|ZP_04626449.1| DNA ligase [Yersinia kristensenii ATCC 33638]
 gi|238696249|gb|EEP89051.1| DNA ligase [Yersinia kristensenii ATCC 33638]
          Length = 670

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 250/712 (35%), Positives = 403/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KSAEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEEGELVRAATRGDGTTGENITANVRTIRAIPLRLQGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  LNDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNDEARRKGGKIFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+N V+       ++++Y +++  R+ L +DIDG+V KVD   
Sbjct: 236 PRSHIQRLMQFKHWGLPVSNRVKLCTGSEQVITFYRQVEQDRAGLGFDIDGVVIKVDSLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  DA+  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPQDAKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PEHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+I+A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNLTNLRAA----------DIEALKSVPDVGEIVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +EAL K +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLGEEHNQKVIEALEKVISWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLLGE 670


>gi|153872826|ref|ZP_02001606.1| NAD-dependent DNA ligase [Beggiatoa sp. PS]
 gi|152070708|gb|EDN68394.1| NAD-dependent DNA ligase [Beggiatoa sp. PS]
          Length = 670

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 252/712 (35%), Positives = 391/712 (54%), Gaps = 48/712 (6%)

Query: 12  LSIE-QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ++I  Q +++ + L   ++  +  YY   +P I DSEYD L R   A+   +P L  +  
Sbjct: 1   MTISIQIQQQATQLRDTLNKQNYYYYVLDEPRIPDSEYDKLMRELHALEENYPALITA-- 58

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
            + P  ++G +   +  +V H+IP LSL   ++ ++++ F  R+           + +  
Sbjct: 59  -DSPTQRVGAKPLTAFSEVIHTIPMLSLNNAFDDKEVQDFDKRVRERLG---GEPVEYVA 114

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPK+DG  I++RYE G  V AA RGDGH GEDV+  ++ I TIP  L  +  P ++EVRG
Sbjct: 115 EPKLDGLAISLRYENGLLVKAATRGDGHQGEDVTQNVKTIKTIPLRLLGDDYPRVLEVRG 174

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           EV++SK DF  LN +    G+K +ANPRNAA+G LR+L+     TR L F  + +G    
Sbjct: 175 EVFMSKADFEKLNQQQTLQGQKTFANPRNAAAGSLRQLDSRVTATRSLTFLAYTIGVVEG 234

Query: 249 -IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
                   ++L  ++  G P++  +   +   G + YY      R  LP++IDG+VYKV+
Sbjct: 235 GELPHRHNKILYTLQKWGIPISIYIEMVHDIQGCLKYYQNTLLYREKLPFEIDGVVYKVN 294

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               Q+ LG  +R+PRW I+HK   ++  T +L ID+Q+GRTG LTPVARL PV +GG  
Sbjct: 295 SLEQQEILGFVSRAPRWAIAHKLPAQEVLTEVLAIDVQVGRTGALTPVARLAPVTVGGVT 354

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNATLHN+D I             ++IRVGD V+V+RAG+VIP++V ++  +R  + QP
Sbjct: 355 VTNATLHNQDEIDR-----------KNIRVGDTVIVRRAGDVIPEIVGVLPEKRPNNTQP 403

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P  CPIC S V R          A  RCTGGL C+AQ+ + ++HF SR A +I+GLG
Sbjct: 404 FVLPKKCPICDSDVTRVEGE------AVARCTGGLYCAAQRKQAIQHFASRRAMDIDGLG 457

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
           ++ ++    +E     ++  ADI+TL   Q        N+   G  S  N+  ++ K ++
Sbjct: 458 EKLVEQLINNE----LVKNIADIYTLNHEQW------ANLERMGPKSAENIIKALEKSQS 507

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +  +F+++LGIR VG   A +LA+ +   +                   L ++  +G I
Sbjct: 508 TTFAKFLYALGIREVGESTAHTLAQSFGRLEKLIPATEA----------DLEQIQDIGPI 557

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS-SEIENKKLVFTGTLQKIQRHKA 666
           +A+ IV F+Q   N   ++ L +           + +   +  +  V TGTL  I RH+A
Sbjct: 558 VAKHIVTFFQQSHNREIIQRLQQIGIHWPENEPTSTNTQPLSGQTFVLTGTLTNITRHEA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +  LGA VS  +S+KT  ++ G+  GSKLEKA+ LG+KI++E  FL LL
Sbjct: 618 KARLEALGAKVSGSVSKKTACVVAGEKAGSKLEKARTLGIKIIDENAFLALL 669


>gi|238799224|ref|ZP_04642672.1| DNA ligase [Yersinia mollaretii ATCC 43969]
 gi|238716921|gb|EEQ08789.1| DNA ligase [Yersinia mollaretii ATCC 43969]
          Length = 670

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 248/712 (34%), Positives = 406/712 (57%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  S   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITS---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++   ++ +   + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRLKRAE--PLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEEGELVRAATRGDGTTGENITANVRTIRAIPLRLQGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LNDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNDEARRKGGKVFANPRNAAAGSLRQLDPRITAKRRLAFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV++ V+       ++++Y +++  R++L +DIDG+V KVD+  
Sbjct: 236 PRSHIQRLMQFKAWGLPVSHRVKLCTGSEQVIAFYRQVEQDRASLGFDIDGVVIKVDDLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  DAQ   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPQDAQEILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PEHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  +++K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFELTA------GKLTGLDRMGPKSAQNLIVALDKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNMANLRAA----------DIDALKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +EAL K +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLSEEHNQKVIEALEKVISWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLLGE 670


>gi|78223924|ref|YP_385671.1| NAD-dependent DNA ligase C4-type [Geobacter metallireducens GS-15]
 gi|123756373|sp|Q39S28|DNLJ_GEOMG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78195179|gb|ABB32946.1| NAD-dependent DNA ligase C4-type [Geobacter metallireducens GS-15]
          Length = 671

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 250/710 (35%), Positives = 375/710 (52%), Gaps = 44/710 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +    A + ++ L  EI  HD  YY   +P + D+EYDAL R    +    P+L     P
Sbjct: 1   MDRNAAERRIAELRAEIRRHDHLYYVLDRPELTDAEYDALYRELLKLEEEHPELV---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG       +VTH IP LSLE  +   D+ +F  R+ R         I +  E
Sbjct: 58  DSPSRRVGGAPLEKFKQVTHRIPMLSLENAFTDGDIAEFDARVKRALALPAGEEIAYVCE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGE 190
           PK+DG  + + YE G     + RGDG  GE+V+  ++ + +IP  L   N PE++EVRGE
Sbjct: 118 PKLDGLAVELVYEYGTLTVGSTRGDGVVGENVTQNLKTVKSIPLRLEGENPPELLEVRGE 177

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++    F  LN +    G  P+ANPRNAA+G LR+L+      R L  F +  G+    
Sbjct: 178 VFLPLAAFQRLNAQREEEGEPPFANPRNAAAGSLRQLDSRITARRPLTMFCYAPGEIRGA 237

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
               Q E L  +R  G PV +  RQ     G+++YY EM   R TLPY+IDG+V KVD F
Sbjct: 238 DFGSQGEFLSALRQRGLPVTSLARQVTGVAGVLAYYREMTEKRDTLPYEIDGVVVKVDSF 297

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ++LGE++RSPRW ++ KF  +QA T + DI   +GRTG++TP A L PV + G  ++
Sbjct: 298 PLQRELGEKSRSPRWAVAVKFPPRQAVTVIEDIVPSVGRTGVITPTANLRPVEVSGVTVS 357

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
            ATLHN + ++            +DIR+GD V+++RAG+VIP VV ++  +R    +   
Sbjct: 358 RATLHNWEEMER-----------KDIRIGDTVVIERAGDVIPAVVKVLTEKRSGSERFLP 406

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP C S VV+  +    +         GL+C AQ  E + HF SR+A ++EGLG++
Sbjct: 407 IPAACPECGSEVVKIPDEVAVR-------CMGLSCPAQIRESIIHFASRNAMDMEGLGEK 459

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++   +       +   AD++TL R               G+    NL ++I   +   
Sbjct: 460 YIEQLLR----LGLVGNVADLYTLTRDDFMKF------DRMGEKLAENLLNAIEASKKRE 509

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFIF+LGIRHVG   A+ LA  + S  N A+               L+ +  +G  +A
Sbjct: 510 LSRFIFALGIRHVGEHTAKLLATAFGSIDNLARATEA----------ELLSIREIGPQVA 559

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           Q+I  F+ N  N   +  +++         EK V  +   K  VFTGTL +  R +AQ+ 
Sbjct: 560 QSITTFFHNEGNRETIRRMVEAGV-EPTVEEKKVGGKFTGKTFVFTGTLIRFSRSEAQKM 618

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           V   G   +  +S+KTD ++ GD  GSKL+KA+QLGV ++ E++FL +L+
Sbjct: 619 VESEGGHAAGSVSKKTDYVVAGDEAGSKLDKARQLGVTVLAEDEFLQMLE 668


>gi|212218835|ref|YP_002305622.1| NAD-dependent DNA ligase [Coxiella burnetii CbuK_Q154]
 gi|254781301|sp|B6J878|DNLJ_COXB1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212013097|gb|ACJ20477.1| NAD-dependent DNA ligase [Coxiella burnetii CbuK_Q154]
          Length = 673

 Score =  585 bits (1507), Expect = e-164,   Method: Composition-based stats.
 Identities = 246/709 (34%), Positives = 388/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L +EI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 7   PAKIQKRIERLREEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 63

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 64  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 121

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 122 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 181

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 182 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 241

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 242 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 301

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 302 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 361

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 362 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 410

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 411 PSRCPVCHAEVIKPEGE------AVARCMGGLYCRAQLRESIKHFASRRALDIEGLGDKL 464

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 465 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 514

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G ++A+
Sbjct: 515 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVVAE 564

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 565 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 624 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 672


>gi|153207803|ref|ZP_01946403.1| DNA ligase, NAD-dependent [Coxiella burnetii 'MSU Goat Q177']
 gi|120576355|gb|EAX32979.1| DNA ligase, NAD-dependent [Coxiella burnetii 'MSU Goat Q177']
          Length = 670

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 246/709 (34%), Positives = 388/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L +EI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 4   PAKIQKRIERLREEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 60

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 61  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 118

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 119 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 178

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 179 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 238

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 239 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 298

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 299 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 358

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 359 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 407

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 408 PSRCPVCHAEVIKPEGE------AVARCMGGLYCRAQLRESIKHFASRRALDIEGLGDKL 461

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 462 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 511

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G ++A+
Sbjct: 512 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVVAE 561

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 562 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 620

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 621 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 669


>gi|183599716|ref|ZP_02961209.1| hypothetical protein PROSTU_03219 [Providencia stuartii ATCC 25827]
 gi|188021975|gb|EDU60015.1| hypothetical protein PROSTU_03219 [Providencia stuartii ATCC 25827]
          Length = 671

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 246/709 (34%), Positives = 395/709 (55%), Gaps = 49/709 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++ L +L+Q++ +H+  Y+    P I D+EYD L     AI    P+   S   + P  +
Sbjct: 4   KQHLDTLKQQLRHHEYQYHVLDAPEIPDAEYDKLMEELKAIEAEHPEWITS---DSPTQR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G     +   V H IP LSL+ +++ E    F  R+      KD     F  E K+DG 
Sbjct: 61  VGAAPLAAFDTVRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KDQQEQTFCCELKLDGL 118

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKN 196
            +++ YE G+ V AA RGDG  GE++++ +R I  IP  L+    P  +E+RGEV++ + 
Sbjct: 119 AVSLLYENGELVQAATRGDGTVGENITSNVRTIRAIPLRLTGENIPARVEIRGEVFMPQK 178

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF-AKGQ 254
            F ALN+E    G K +ANPRNAA+G LR+L+P     R L F+ +G+G           
Sbjct: 179 GFEALNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGLVEGETLPDTH 238

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           YE L + +  G PV+  V+       ++ +Y+E++  R TL +DIDG+V K+++ + Q++
Sbjct: 239 YERLMQFKKWGLPVSEYVQLRTGAQAVLDFYHEIEKARPTLGFDIDGVVIKINDIATQEE 298

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +R+PRW  + KF  ++  T L D++ Q+GRTG +TPVARLEPV + G  ++NATLH
Sbjct: 299 LGFVSRAPRWATAFKFPAQEQMTLLKDVEFQVGRTGAITPVARLEPVQVAGVTVSNATLH 358

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L            + +GD V+++RAG+VIP++V ++ +ER  D++   FP+ C
Sbjct: 359 NADEIERL-----------GVHIGDTVVIRRAGDVIPQIVSVVESERPADSREIVFPTHC 407

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + +D  
Sbjct: 408 PVCGSDVERVEGE------AVARCTGGLICGAQRKEALKHFVSRRAMDVDGMGDKIIDQL 461

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            + E     ++ PAD++ L      S   +  +   G  S  NL +++NK ++ +L RFI
Sbjct: 462 VEKE----YVKNPADLYQL------SAGILTGLDRMGPKSAQNLVEALNKSKSTTLARFI 511

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           ++LGIR VG   A +LA +Y + +               D  SL  V  VG ++A+ +V 
Sbjct: 512 YALGIREVGEATAANLAAHYGTLEALMAA----------DEESLKTVQDVGHVVAKHVVN 561

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEK----NVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           F++   N   ++AL+ + +             + S    K +V TG+L ++ R +A++ +
Sbjct: 562 FFREEHNQTVIQALIDKANIHWPEAVAVDVSTIDSPFAGKTVVLTGSLSQLTRDEAKDKL 621

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             LGA VS  +S+KT ++I G+  GSKL KA +LG+ +++E + + LL+
Sbjct: 622 VALGAKVSGSVSKKTHLVIAGEAAGSKLAKANELGIPVIDENELIRLLE 670


>gi|165923886|ref|ZP_02219718.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 334]
 gi|165916671|gb|EDR35275.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 334]
          Length = 670

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 247/709 (34%), Positives = 388/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L QEI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 4   PAKIQKRIERLRQEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 60

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 61  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 118

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 119 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 178

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 179 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 238

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 239 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 298

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 299 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 358

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 359 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 407

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 408 PSRCPVCHAEVIKPEGE------AVARCMGGLYCRAQLRESIKHFASRRALDIEGLGDKL 461

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 462 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 511

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G ++A+
Sbjct: 512 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVVAE 561

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 562 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 620

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 621 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 669


>gi|270262950|ref|ZP_06191221.1| DNA ligase, NAD-dependent [Serratia odorifera 4Rx13]
 gi|270043634|gb|EFA16727.1| DNA ligase, NAD-dependent [Serratia odorifera 4Rx13]
          Length = 673

 Score =  584 bits (1505), Expect = e-164,   Method: Composition-based stats.
 Identities = 239/713 (33%), Positives = 396/713 (55%), Gaps = 50/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P + D+EYD L      + +A P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEYQYHVLDAPEVPDAEYDRLMNELRELENAHPELITA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R+      K    + F  E K
Sbjct: 58  PTQRVGAAPLAAFDQVRHEVPMLSLDNVFDEESFLAFYKRVQDRL--KSSEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE++++ +R I  IP  LS +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGELVRAATRGDGTTGENITSNVRTIRAIPLRLSGDNIPRRLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E      K +ANPRNAA+G +R+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQMNEEARRKDGKIFANPRNAAAGSIRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +  ++ L + +  G PV++  +       ++++Y +++  R+ L +DIDG+V K+D+  
Sbjct: 236 PRSHWQRLMQFKNWGLPVSDRAKCCTGSDEVLAFYRQVEQDRAQLGFDIDGVVVKIDDID 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW  + KF  ++  T + +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQETLGFVARAPRWATAFKFPAQEQITVVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIPKVV +I + R  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPKVVGVIEDRRPQDAREIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S V R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PLHCPVCGSDVERVEGE------AVTRCTGGLICAAQRKEALKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + E     ++ PAD+F L      S   +  +   G  S  NL +++ K +  + 
Sbjct: 459 IEQLVEKE----YVKNPADLFRL------SAGILTGLDRMGPKSAQNLVNALEKSKRTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++                   D  +L +VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFGELPKLYAA----------DIDALKQVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALL-KEVSPSIGRH----EKNVSSEIENKKLVFTGTLQKIQRHK 665
            +  F     N   ++ L+  E+  +         + + S    K +V TG+L ++ R +
Sbjct: 559 HVRHFLDEELNQKVIDELIGAEIGINWPEVVVVAAEEIDSPFAGKTVVLTGSLSQLSRDE 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 AKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGIAVIDEAEMIRLL 671


>gi|219850499|ref|YP_002464932.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
 gi|254781282|sp|B8GAC1|DNLJ_CHLAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219544758|gb|ACL26496.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
          Length = 681

 Score =  584 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 263/722 (36%), Positives = 385/722 (53%), Gaps = 55/722 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++     + ++ L   I  +D  YY    PI+ D+EYDAL     A+  A P+L     P
Sbjct: 1   MNHIDVTQRINELRTLIRRYDYHYYVLDDPIVSDAEYDALMNELRALEAAHPELI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++ G       KV H  P LSL   +   DL  +  R+ R   +  D ++ + +E
Sbjct: 58  DSPTQRVSGTPASQFAKVQHPQPMLSLGNAFTTTDLLAWRDRVLRLLGQ--DTAVAYVVE 115

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI------- 184
           PKIDG  + + Y  G+FV  A RGDG  GEDV+A +R I +IP +L              
Sbjct: 116 PKIDGLAVALTYHDGQFVQGATRGDGEVGEDVTANLRTISSIPLLLHPPDGGHDRDVPTA 175

Query: 185 ----IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
               IEVRGEVY+   DF ALND + A G K +ANPRNAA+G LR+ +P     R L FF
Sbjct: 176 LPSLIEVRGEVYMRTADFEALNDRLAAAGEKIFANPRNAAAGSLRQKDPAITAARPLRFF 235

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +G+G    +   GQ++ L+ +R LGFPVN  VR+   F  +++Y  +  + R  L Y+ 
Sbjct: 236 AYGVGPVEGVELTGQWQTLRYLRMLGFPVNQDVRRFTDFDEVLAYCEQWMARRDELTYEA 295

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+V K+D+F+ Q++LG   R PRW I+ KF  ++A TRLL+I + +GRTG++TP A LE
Sbjct: 296 DGMVIKIDDFAQQRELGVVGRDPRWAIAFKFPPREAITRLLNITVNVGRTGVVTPNAELE 355

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV IGG ++ NA+LHN DYI             RDIR+GD V+VKRAG+VIP VV  +V 
Sbjct: 356 PVQIGGVIVRNASLHNADYI-----------AQRDIRIGDYVIVKRAGDVIPYVVGPVVA 404

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
            R    +P+ FP+ CP C S + R+         AA RC     C AQ + RL+HF SR 
Sbjct: 405 RRDGSERPWQFPTHCPACGSPLEREPGE------AAWRCNNFGICPAQLVRRLEHFASRA 458

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           A +I GLG++Q + F +       +R  AD+F L+            + GFG   + NL 
Sbjct: 459 ALDIVGLGERQAELFVQR----GLVRDVADLFYLKAEDFAG------LEGFGPKRIANLL 508

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
           ++I+  R   L+R I  LGIR+VG+  A++L     S                     L 
Sbjct: 509 NAIDAARQRPLDRLIVGLGIRYVGSVAAQALVNSLGSLDAIMNARQ----------EELE 558

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPS-IGRHEKNVSSEIENKKLVFTGTL 658
           ++P +G ++A +IV+F+ +P N   +E L         G   +  S  +  +  V TGTL
Sbjct: 559 QIPGIGPVVAASIVDFFAHPENRQLIEKLRAAGVQMNAGPQRERKSDVLAGQTFVLTGTL 618

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + R +A   +   G  V+  +S+KT+ ++ G N GSKL KAQQLG+ +++E   L L+
Sbjct: 619 PSLTREQASALIIAHGGKVTDSVSKKTNYVVAGVNAGSKLAKAQQLGIPVLDEAALLALI 678

Query: 719 QQ 720
            +
Sbjct: 679 GE 680


>gi|295401729|ref|ZP_06811695.1| DNA ligase, NAD-dependent [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976216|gb|EFG51828.1| DNA ligase, NAD-dependent [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 670

 Score =  584 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 252/717 (35%), Positives = 391/717 (54%), Gaps = 53/717 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A K +  L + ++ ++  YY   +P + DSEYD L +   A+   +PDL      
Sbjct: 1   MERQAAIKRIEELRELLNQYNYEYYVLDRPSVPDSEYDRLMQELIALEEQYPDLK---TK 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+   +  KV H  P LSL   +N  DLR F  R+     ++  + + +  E
Sbjct: 58  DSPSQRVGGQALDAFQKVEHRTPMLSLANAFNEGDLRDFDRRVR----QEVGDDVAYVCE 113

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            KIDG  +++RYE G FV  A RGDG +GED++  ++ I ++P  L+  +   +E RGE 
Sbjct: 114 LKIDGLAVSVRYEDGYFVQGATRGDGVTGEDITENLKTIRSLPLRLNEPV--TLEARGEA 171

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF 250
           Y+ K  F  LN++    G + +ANPRNAA+G LR+L+P    +R+L+ FV+GL    E+ 
Sbjct: 172 YMPKASFERLNEQRRQRGEELFANPRNAAAGSLRQLDPKIAASRHLDLFVYGLANAEELG 231

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L  ++ LGF  N   R+      ++ + NE +  R  LPY+IDG+V KVD F+
Sbjct: 232 IASHSAALDYLQQLGFKTNPERRRCANMDEVMQFVNEWQEKRPQLPYEIDGIVIKVDSFA 291

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  A+SPRW I++KF  ++  T+L+DI++ +GRTG++TP A LEPV + G  +  
Sbjct: 292 QQEQLGATAKSPRWAIAYKFPAEEVVTKLIDIELNVGRTGVVTPTAILEPVRVAGTTVQR 351

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED+I+            +DIR+GD V++K+AG++IP+VV+++ + R  +  PF  
Sbjct: 352 ATLHNEDFIR-----------EKDIRIGDSVIIKKAGDIIPEVVNVVPDRRTGEEVPFVM 400

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP C S +VR           A RC     C AQ  E L HFVSR A NIEGLG++ 
Sbjct: 401 PTHCPECASELVRIEGE------VALRCINPK-CPAQIREGLIHFVSRQAMNIEGLGEKV 453

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +   F+       I   ADI+ L + Q         +   G+ S TNL  +I   +  SL
Sbjct: 454 ISQLFRE----GLIHDVADIYRLTKDQLID------LERMGEKSATNLLHAIEASKQNSL 503

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           ER +F LGIRHVGA+ A+ LA+++ +                     L+ +  +G+ +A 
Sbjct: 504 ERLLFGLGIRHVGAKAAKVLAEHFETMDRLQNATK----------EELMAIHEIGEKMAD 553

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKN-----VSSEIENKKLVFTGTLQKIQRHK 665
           +IV ++  P     +  L         +  K      V S    K +V TG L+ + R++
Sbjct: 554 SIVTYFAKPEVKELLNELRAYGVNMEYKGPKTPKPGDVHSYFAGKTVVLTGKLESLSRNE 613

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           A+E + QLG  V+  +S+ TD++I G + GSKL KAQQL ++I +E +FL  ++Q  
Sbjct: 614 AKEKIEQLGGKVTGSVSKNTDLVIAGADAGSKLAKAQQLHIEIWDETRFLEEIEQSK 670


>gi|290476106|ref|YP_003469005.1| DNA ligase [Xenorhabdus bovienii SS-2004]
 gi|289175438|emb|CBJ82241.1| DNA ligase [Xenorhabdus bovienii SS-2004]
          Length = 672

 Score =  584 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 247/714 (34%), Positives = 397/714 (55%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L R    +    P+L  +   + 
Sbjct: 1   MESIIEKINKLRATLRHHEYLYHVMDAPEIPDAEYDRLLRELKVLEEQHPELITA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H IP LSL+ +++ E    F  R+      KD   + F  E K
Sbjct: 58  PTQRVGAAPLTAFGQVRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KDSRDLVFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++  +R I  IP  L  N  P  +E+RGEV+
Sbjct: 116 LDGLAVSLLYEDGELVQAATRGDGTTGENITVNVRTIHAIPLRLKGNNIPARVEIRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  LNDE    G K +ANPRNAA+G LR+L+P     R L F+ +G+G       
Sbjct: 176 MKQGGFEKLNDEARRKGNKVFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               YE L + +  G PV++ V+       ++ +Y+ ++  R  L +DIDG+V KVD   
Sbjct: 236 PASHYERLMQFKQWGLPVSDNVKLCQGTQQVIDFYHNIEQQRPILGFDIDGIVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  A++PRW  + KFA ++  T + D++ Q+GRTG +TPVARL+PV + G +++N
Sbjct: 296 LQETLGFVAKAPRWATAFKFAAQEQMTIVRDVEFQVGRTGAITPVARLKPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+++RAG+VIPKVV ++ ++R  ++Q   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVVIRRAGDVIPKVVGVVQDKRPAESQEVIF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P +CP+C+S + R          +  RCTGGL C AQ+ E LKHFVSR A +++G+G++ 
Sbjct: 405 PEYCPVCRSDIERVEGE------SVARCTGGLFCGAQRKEALKHFVSRRAMDVDGMGEKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++     E     ++ PAD+F L      S  K+  +   G  S  N  D++ K +  + 
Sbjct: 459 IEQLVDKE----YVKTPADLFRL------SAGKLTGLERMGPKSAQNTIDALEKSKKTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RFI+SLGIR VG   A +L  ++++ +               D  +LI V  VG ++A 
Sbjct: 509 ARFIYSLGIREVGEATAANLVAHFVTLEKLRAA----------DTEALIAVQDVGGVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEK----NVSSEIENKKLVFTGTLQKIQRHKA 666
            +V F+  P N   ++ L+  +       E      V +    K +V TG+L ++ R +A
Sbjct: 559 HVVNFFNEPHNQTVIDDLIDNIGIYWESVETLQSDTVGNSFAGKTVVLTGSLNRLSRDEA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           ++ +T LGA V+  +S+KTD++I G+  GSKL KA +LG+++++EE+ L LL +
Sbjct: 619 KDKLTALGAKVTGSVSKKTDLVIAGEAAGSKLAKATELGIEVIDEEEMLRLLGE 672


>gi|209364099|ref|YP_001424866.2| NAD-dependent DNA ligase [Coxiella burnetii Dugway 5J108-111]
 gi|207082032|gb|ABS76887.2| NAD-dependent DNA ligase [Coxiella burnetii Dugway 5J108-111]
          Length = 673

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 248/709 (34%), Positives = 390/709 (55%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L QEI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 7   PAKIQKRIERLRQEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 63

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 64  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 121

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 122 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 181

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 182 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 241

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 242 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 301

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG++TPVARLEPV++ G  ++N
Sbjct: 302 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGVVTPVARLEPVSVSGVTVSN 361

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 362 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 410

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 411 PSRCPVCHAEVIKPEGE------AVARCVGGLYCRAQLRESIKHFASRRALDIEGLGDKL 464

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 465 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 514

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG  IAR+LA+++       +              +L  +  +G ++A+
Sbjct: 515 PRFLYALGIRGVGDTIARTLARHFHELDLLMKA----------SIETLQEIRDIGPVVAE 564

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 565 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 624 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 672


>gi|312112463|ref|YP_003990779.1| DNA ligase, NAD-dependent [Geobacillus sp. Y4.1MC1]
 gi|311217564|gb|ADP76168.1| DNA ligase, NAD-dependent [Geobacillus sp. Y4.1MC1]
          Length = 670

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 252/717 (35%), Positives = 391/717 (54%), Gaps = 53/717 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A K +  L + ++ ++  YY   +P + DSEYD L +   A+   +PDL      
Sbjct: 1   MERQAAIKRIEELRELLNQYNYEYYVLDRPSVPDSEYDRLMQELIALEEQYPDLK---TK 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+   +  KV H  P LSL   +N  DLR F  R+     ++  + + +  E
Sbjct: 58  DSPSQRVGGQALDAFQKVEHRTPMLSLANAFNEGDLRDFDRRVR----QEVGDDVAYVCE 113

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            KIDG  +++RYE G FV  A RGDG +GED++  ++ I ++P  L+  +   +E RGE 
Sbjct: 114 LKIDGLAVSVRYEDGYFVQGATRGDGVTGEDITENLKTIRSLPLRLNEPV--TLEARGEA 171

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF 250
           Y+ K  F  LN++    G + +ANPRNAA+G LR+L+P    +R+L+ FV+GL    E+ 
Sbjct: 172 YMPKASFERLNEQRRQRGEELFANPRNAAAGSLRQLDPKIAASRHLDLFVYGLANAEELG 231

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L  ++ LGF  N   R+      ++ + NE +  R  LPY+IDG+V KVD F+
Sbjct: 232 IASHSAALDYLQQLGFKTNPERRRCANMDEVIQFVNEWQEKRPQLPYEIDGIVIKVDSFA 291

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  A+SPRW I++KF  ++  T+L+DI++ +GRTG++TP A LEPV + G  +  
Sbjct: 292 QQEQLGATAKSPRWAIAYKFPAEEVVTKLIDIELNVGRTGVVTPTAILEPVRVAGTTVQR 351

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED+I+            +DIR+GD V++K+AG++IP+VV+++ + R  +  PF  
Sbjct: 352 ATLHNEDFIR-----------EKDIRIGDSVIIKKAGDIIPEVVNVVPDRRTGEEVPFVM 400

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP C S +VR           A RC     C AQ  E L HFVSR A NIEGLG++ 
Sbjct: 401 PTHCPECASELVRIEGE------VALRCINPK-CPAQIREGLIHFVSRQAMNIEGLGEKV 453

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +   F+       I   ADI+ L + Q         +   G+ S TNL  +I   +  SL
Sbjct: 454 ISQLFRE----GLIHDVADIYRLTKDQLID------LERMGEKSATNLLHAIEASKQNSL 503

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           ER +F LGIRHVGA+ A+ LA+++ +                     L+ +  +G+ +A 
Sbjct: 504 ERLLFGLGIRHVGAKAAKVLAEHFETMDRLQNATK----------EELMAIHEIGEKMAD 553

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKN-----VSSEIENKKLVFTGTLQKIQRHK 665
           +IV ++  P     +  L         +  K      V S    K +V TG L+ + R++
Sbjct: 554 SIVTYFAKPEVKELLNELRAYGVNMEYKGPKTPKPGDVHSYFAGKTVVLTGKLESLSRNE 613

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           A+E + QLG  V+  +S+ TD++I G + GSKL KAQQL ++I +E +FL  ++Q  
Sbjct: 614 AKEKIEQLGGKVTGSVSKNTDLVIAGADAGSKLAKAQQLHIEIWDETRFLEEIEQSK 670


>gi|39995996|ref|NP_951947.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens PCA]
 gi|81702997|sp|Q74ER9|DNLJ_GEOSL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|39982761|gb|AAR34220.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens PCA]
 gi|298505011|gb|ADI83734.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens KN400]
          Length = 670

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 249/711 (35%), Positives = 380/711 (53%), Gaps = 44/711 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A   +++L  E+  H+  YY   +P I D+EYD L R    +   FPDLA    P
Sbjct: 1   MDKQTAADRVAALRTELERHNRLYYAEDRPEITDAEYDLLFRELVDLETRFPDLAA---P 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG       +VTH IP LSLE  +   ++  F  R+ RF     D  I +  E
Sbjct: 58  DSPTQRVGGAPLDKFEQVTHRIPMLSLENAFTDVEIADFDDRVKRFLGLHGDVEIDYVCE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV-LSLNIPEIIEVRGE 190
           PK+DG  + + YE+G     + RGDG  GE+V+  ++ +  IP        PE++EVRGE
Sbjct: 118 PKMDGLAVELVYERGILTVGSTRGDGVVGENVTHNLKTVRGIPLRLRCEQPPELLEVRGE 177

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           VY+    F  LN +    G  P+ANPRNAA+G +R+L+      R L  F +  G+    
Sbjct: 178 VYLPLAAFQRLNAQREEEGEPPFANPRNAAAGSIRQLDSRITARRPLAIFCYAPGEVRGA 237

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
               Q E L ++   G PVN  +R       I++YY EM   R +LPY+IDG+V KVD F
Sbjct: 238 SFAAQTEFLDRIGEWGLPVNPLIRPVKGVAEILAYYREMTERRDSLPYEIDGVVVKVDSF 297

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LGE++RSPRW ++ KF  +QA T + DI   +GRTG++TP A L PV + G  ++
Sbjct: 298 ALQRELGEKSRSPRWAVAVKFPPRQAVTVVEDIVPSVGRTGVITPTANLRPVEVSGVTVS 357

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
            ATLHN + ++            +DIR+GD V+++RAG+VIP VV ++  +R    +P  
Sbjct: 358 RATLHNWEEMER-----------KDIRIGDTVVIERAGDVIPAVVKVLTEKRSGSERPLP 406

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP C S VV+  +    +         GL+C AQ  E + HF SRDA ++EGLG++
Sbjct: 407 IPAVCPECGSEVVKIPDEVAVR-------CMGLSCPAQIRESIIHFASRDAMDMEGLGEK 459

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++   +       ++  AD++TL + Q             GD    NL ++I   +   
Sbjct: 460 YIEQLLR----LGLVKNVADLYTLTKDQFMQF------DRMGDKLAENLLNAIEASKQRE 509

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFIF+LGIRHVG   A+ LA  + S +N  +               L+ +  VG  +A
Sbjct: 510 LSRFIFALGIRHVGEHTAKLLAGAFGSIENLERATE----------EELLSIREVGPQVA 559

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           ++I+ F++N  N   +  + K         EK V      K  VFTG L +  R +AQ+ 
Sbjct: 560 RSIITFFRNEGNRETIRRMFKAGVRPTAE-EKKVGGRFTGKTFVFTGALTRFSRPEAQKM 618

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           V + G   +  +S+KTD ++ G   GSKL+KA+QLGV+++ E++FL +L++
Sbjct: 619 VEKEGGHAAGSVSKKTDYVVAGAEAGSKLDKARQLGVRVLTEDEFLAMLEE 669


>gi|206895761|ref|YP_002246502.1| DNA ligase, NAD-dependent [Coprothermobacter proteolyticus DSM
           5265]
 gi|254781298|sp|B5Y6V5|DNLJ_COPPD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206738378|gb|ACI17456.1| DNA ligase, NAD-dependent [Coprothermobacter proteolyticus DSM
           5265]
          Length = 666

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 219/714 (30%), Positives = 368/714 (51%), Gaps = 52/714 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++ E+A+K +  L + I YH+  YY    P I D EYD L R    +   FP+      P
Sbjct: 1   MTREEAKKRIERLRELIEYHNYRYYVLDSPEISDEEYDKLYRELVTLEKQFPEFI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++G         VTH +P LSL+  +  ++++ F  R+     +     + +  E
Sbjct: 58  DSPTQRVGAPPAKEFATVTHEVPMLSLDNAFTEDEIKAFDQRVRSALNQ---QHVEYFCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGE 190
            K+DG  +++ YE G FV  + RG+G+ GEDV+A ++ I TIP  L     P ++E+RGE
Sbjct: 115 HKLDGLAVSLLYENGLFVRGSTRGNGYVGEDVTANLKTIKTIPLRLKGENIPPVVEIRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
            ++   DF ALN++  A+G+  +ANPRNAA+G +R+L+ +    R L F  +G G    +
Sbjct: 175 AFMMLRDFEALNEQRQALGQPLFANPRNAAAGSIRQLDSSITAQRKLYFMPYGFGLVQGM 234

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
             + Q   L++ +  GF +N   R+A++    + +       R  LP+  DG+V KV+  
Sbjct: 235 DFETQERFLKQCQEWGFRINEHNRKASSIEEALEFIRYWTEHRVELPFPADGVVIKVNNL 294

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
                LG  A +PR+ I++KF  ++  T+L D+  Q+GRTGI+TPVA LEPV + GA ++
Sbjct: 295 RYWDILGTTAHAPRYAIAYKFPAEEKETKLKDVVFQVGRTGIITPVAMLEPVVLDGATVS 354

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
            ATLHN D ++ L           D+R GD V +KRAG VIP+++ +   +R    +   
Sbjct: 355 RATLHNFDIVRQL-----------DVRKGDVVKLKRAGMVIPEIIGVAAEKRTGKEEQIE 403

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C      D          A+     + C AQ    L H+ SRDA +I+GLG+ 
Sbjct: 404 PPTTCPVCGGPTEWDG---------AYLKCVNITCPAQLKGHLLHWASRDAMDIDGLGES 454

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++           ++  AD++ L      S   +  +      S T LY++I + ++  
Sbjct: 455 IIENLVD----MGLVKNIADLYKL------SVQDLLTLPRLAQRSATKLYENIQRSKDRP 504

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             R ++ LGI  VG + A+ LA+++ S                     L  +  +G   A
Sbjct: 505 FFRVLYGLGIPRVGLKTAQMLAEHFGSINALLNAT----------MDELTSIEGIGTDTA 554

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           + I++  Q+P+    ++ L           ++++   ++    VFTGTL  + R  A + 
Sbjct: 555 ETILKALQSPQVHELIDQLKTLGLKM---EQESIEGPLKGLTFVFTGTLTSMSRGDAAKL 611

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ-QYN 722
           V  LG  V++ +S+  D ++VG++PGSKL+KAQ+LG+ I++EE FL +++ ++N
Sbjct: 612 VQSLGGKVASSVSKNVDYVVVGEDPGSKLDKAQKLGLTIIDEEAFLKMVKREHN 665


>gi|190359248|sp|A9KCS0|DNLJ_COXBN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 670

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 248/709 (34%), Positives = 390/709 (55%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L QEI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 4   PAKIQKRIERLRQEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 60

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 61  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 118

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 119 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 178

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 179 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 238

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 239 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 298

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG++TPVARLEPV++ G  ++N
Sbjct: 299 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGVVTPVARLEPVSVSGVTVSN 358

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 359 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 407

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 408 PSRCPVCHAEVIKPEGE------AVARCVGGLYCRAQLRESIKHFASRRALDIEGLGDKL 461

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 462 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 511

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG  IAR+LA+++       +              +L  +  +G ++A+
Sbjct: 512 PRFLYALGIRGVGDTIARTLARHFHELDLLMKA----------SIETLQEIRDIGPVVAE 561

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 562 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 620

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 621 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 669


>gi|212212963|ref|YP_002303899.1| NAD-dependent DNA ligase [Coxiella burnetii CbuG_Q212]
 gi|254781302|sp|B6J1C6|DNLJ_COXB2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212011373|gb|ACJ18754.1| NAD-dependent DNA ligase [Coxiella burnetii CbuG_Q212]
          Length = 677

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 247/709 (34%), Positives = 387/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L QEI+ H+  YY  S+P I DS YD L      +   +P+   +  P+ 
Sbjct: 7   PAKIQKRIERLRQEINDHNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPE---TITPSS 63

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 64  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 121

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 122 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 181

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 182 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 241

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 242 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 301

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 302 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 361

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 362 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 410

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 411 PSRCPVCHAEVIKPEGE------AVARCVGGLYCRAQLRESIKHFASRRALDIEGLGDKL 464

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 465 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 514

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G + A+
Sbjct: 515 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVAAE 564

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 565 NIHAFFHQKHNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 624 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 672


>gi|304392246|ref|ZP_07374188.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
 gi|303296475|gb|EFL90833.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
          Length = 716

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 309/718 (43%), Positives = 454/718 (63%), Gaps = 12/718 (1%)

Query: 4   RQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFP 63
           R+++P   L+ EQA +EL++L  EI+ HD  Y+    P I D  YD L++R  AI   FP
Sbjct: 7   REIVP-RKLTDEQAAEELAALASEIAEHDARYHNDDAPTISDGAYDTLRKRNTAIEERFP 65

Query: 64  DLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD 123
           DL R    + P N +G  +     K+TH +P LSL+  ++  D+  F   + RF   K+ 
Sbjct: 66  DLVRE---DSPSNNVGSPVQSKFDKITHKVPMLSLDNAFDDGDVADFSASVRRFLNWKEG 122

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV-LSLNIP 182
           + + FT EPKIDG  + +RYE+G+ V AA RGDG  GE+V+A  R +  IPR     N+P
Sbjct: 123 DPLTFTAEPKIDGLSLALRYERGELVSAATRGDGQVGENVTANARTVKDIPRKLSGGNVP 182

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVH 241
           +I+E+RGEVYI K DF ALN EM A G++ Y NPRN A+G LR+L+     +R L FF +
Sbjct: 183 DIVEIRGEVYIGKADFAALNVEMEAAGKQLYVNPRNTAAGSLRQLDSRITASRPLKFFAY 242

Query: 242 GLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDG 301
             G+ S++ A  Q+ M+++M   GF  N    +  +   +V++Y  ++  R+ L YDIDG
Sbjct: 243 AWGEMSKLPADTQFAMIEQMAAWGFSTNPLTARLESVEALVAHYRTIEESRAGLDYDIDG 302

Query: 302 LVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPV 361
           +VYKVD+  LQ +LG  +R PRW I+HKF  + A+T L +I+IQIGRTG L+PVARL+PV
Sbjct: 303 VVYKVDDLGLQGRLGFASRVPRWAIAHKFPAELATTILREIEIQIGRTGALSPVARLDPV 362

Query: 362 NIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNER 421
            +GG +++NATLHNEDYI G+ ++G+ +R GRD+R+GD V + RAG+VIPKV+D+ +++R
Sbjct: 363 TVGGVVVSNATLHNEDYIAGVGSNGEPIREGRDLRIGDTVTIFRAGDVIPKVMDVDLSKR 422

Query: 422 HPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAF 481
                PF FP+ CP C S  VR ++ KTG+  +  RCTGG  C AQ +E +KHFVSR+AF
Sbjct: 423 TAKE-PFEFPTVCPACGSPAVRPIDEKTGRADSVRRCTGGFICPAQAVEGIKHFVSRNAF 481

Query: 482 NIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDS 541
           +I+G G +Q + F +       +  PADIFTL+ R + S  ++EN  G+G  S   L+D+
Sbjct: 482 DIDGFGDKQAELFHE----LGMVMNPADIFTLRERDKRSLKRLENRDGYGKTSANKLFDA 537

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I+ RR I L RFIF+LGIRHVG   A+ LA++Y         I+       + W+ ++ +
Sbjct: 538 IDDRRKIDLHRFIFALGIRHVGEGNAKLLARHYRDADTLLAAIDAAQDREGEAWVEMLDI 597

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
              G+  A A+++F  +P     V+ALL EV+P+    +   SS I  K +VFTGTL++ 
Sbjct: 598 DGFGETAATALLDFMADPNRRGVVDALLTEVTPNP-VEQVASSSPIAGKTIVFTGTLEQT 656

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            R +A+    +LGA VS  +S KTD+++ G+  GSKL+KA +LGV  ++E+ +L L+ 
Sbjct: 657 TRSEAKAVAERLGAKVSGSVSAKTDLLVAGEKAGSKLKKAAELGVDTLDEQGWLDLVA 714


>gi|237732406|ref|ZP_04562887.1| NAD-dependent DNA ligase LigA [Citrobacter sp. 30_2]
 gi|226907945|gb|EEH93863.1| NAD-dependent DNA ligase LigA [Citrobacter sp. 30_2]
          Length = 671

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L      +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMCELRELEAQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K  + + +  E K
Sbjct: 58  PTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSTDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPE-IIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +     +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLRGDNIPTRLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF- 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGVL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   +++YY++++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKEWGLPVSDRVTLCDSPEEVLAYYHKVEEDRPTLGFDIDGVVIKVNSMV 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  D +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPDDTREIEF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCNSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+FTL         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFTLTA------GKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEALEAA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL +       +  + + + S    K +V TG+L  + R  A+
Sbjct: 559 HVFNFFAEESNREVIVQLLAQGIHWPAPVVINAEEIDSPFAGKTVVLTGSLSLMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +T+LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLTELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIAVIDEAEMIRLL 669


>gi|127513305|ref|YP_001094502.1| DNA ligase, NAD-dependent [Shewanella loihica PV-4]
 gi|166216242|sp|A3QFJ5|DNLJ_SHELP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126638600|gb|ABO24243.1| DNA ligase, NAD-dependent [Shewanella loihica PV-4]
          Length = 669

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 252/711 (35%), Positives = 397/711 (55%), Gaps = 50/711 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  + E+  L  E++ H+  YY    P I D+EYD L RR   +    P+LA +   + 
Sbjct: 1   MQAIQDEIKQLTDELNQHNYRYYVDDAPSIPDAEYDRLMRRLQELEAEHPELALA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++GGE      +VTH  P LSL+ +++ E+   F  R+      K  ++  F  EPK
Sbjct: 58  PTQRVGGEALSKFNQVTHLKPMLSLDNVFSEEEFNAFYKRV----GDKLPDTPAFCCEPK 113

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  ++I Y  G F  AA RGDG  GED++  +R I ++P  L  +  P ++EVRGEV+
Sbjct: 114 LDGLAVSILYRDGVFERAATRGDGTVGEDITENVRTIKSVPLRLRGSGFPPLLEVRGEVF 173

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + K  F A+ND+  A G K + NPRNAA+G LR+L+     +R L F+ + LG       
Sbjct: 174 MPKAAFEAVNDKARAKGEKLFVNPRNAAAGSLRQLDSKITASRSLAFYAYALGVVEPETW 233

Query: 252 K---GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 +E L +++  G PV++ V+       +++YY ++ + RS L Y+IDG+V KV++
Sbjct: 234 PLAASHFEQLVQLKEWGCPVSSEVKVCADIPSVLAYYQDILTRRSELAYEIDGVVLKVND 293

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            + Q+ LG  A++PRW  ++KF  ++  T+L  +D Q+GRTG +TPVARL+PV +GG  +
Sbjct: 294 IAQQQTLGFVAKAPRWATAYKFPAQEEITQLEGVDFQVGRTGAVTPVARLQPVFVGGVTV 353

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I  L            + +GD V+++RAG+VIP+VV ++  +R  DAQ  
Sbjct: 354 SNATLHNADEIARL-----------GVMIGDSVIIRRAGDVIPQVVAVVPEKRPSDAQAI 402

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S V R          A  RCTGGL C AQ+ E +KHF SR A +I+G+G 
Sbjct: 403 QFPPQCPVCGSDVERVEGE------AVARCTGGLVCEAQRKEAIKHFASRKALDIDGMGD 456

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L        + I  +   G  S TNL +++   +  
Sbjct: 457 KVVEQLIDKE----LVASPADLFKLTA------SAITMLDRMGMKSATNLVNALEAAKQT 506

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +  RF++SLGIR VG   A +LA Y+ + ++  Q           D  + ++V  VG I+
Sbjct: 507 TFARFLYSLGIREVGEATAANLANYFKTLEHLKQA----------DAETFMKVDDVGVIV 556

Query: 609 AQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSS-EIENKKLVFTGTLQKIQRHKAQ 667
           AQ +V F++ P N+  ++ LL+         E    +  ++ +  V TGTL ++ R+ A+
Sbjct: 557 AQHLVHFFEQPHNLEVIDGLLQAGVHWPDIEEVAEEALSLKGQTWVLTGTLTQLNRNDAK 616

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+ TD ++ G+  GSKL KAQ+LGVK+++E + L +L
Sbjct: 617 AKLQALGAKVAGSVSKNTDCLVAGEAAGSKLTKAQELGVKVIDEAELLAIL 667


>gi|311694426|gb|ADP97299.1| NAD-dependent DNA ligase [marine bacterium HP15]
          Length = 678

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 245/716 (34%), Positives = 385/716 (53%), Gaps = 47/716 (6%)

Query: 12  LSIE--QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           +S       + +  L   I  H+  YY    P + D+EYD L R    +   +P+LA   
Sbjct: 1   MSKATPDIIQRVEELRSAIDDHNYRYYVLDDPRVPDAEYDRLFRELQGLETDYPELA--- 57

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
               P  ++G     S  +V H +P LSL+  ++ ++LR F  R+       +D  + + 
Sbjct: 58  SDTSPTRRVGSAAETSFEEVVHRLPMLSLDNAFSEDELRDFDRRVKDRLGITED--VEYV 115

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVR 188
            EPK+DG  +++ YE G    AA RGDG+SGED++A IR IP++P  L  +  P+++EVR
Sbjct: 116 CEPKLDGLAVSLHYENGALTTAATRGDGYSGEDITANIRTIPSVPLKLRGDDVPDLVEVR 175

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+ K+ F  LN  +   G K + NPRNAA+G LR+   T    R L    + +  T 
Sbjct: 176 GEVYMPKDGFEQLNRRLAERGEKTFVNPRNAAAGSLRQKKSTVTARRPLEMCAYSVAVTD 235

Query: 248 E-IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           E +    Q+E L++++  GF +N  +R+A      +  Y+E+   R  LPY+IDG+V+KV
Sbjct: 236 ESLLPDTQWEGLKRVQSWGFRINPEMRKARGAEECLEAYSELMDKRDGLPYEIDGIVFKV 295

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +    QK LG  +R+PRW I+ KF  ++  T + D++ Q+GRTG +TPVARL+PV +GG 
Sbjct: 296 NRLDQQKALGFVSRAPRWAIAQKFPAQEELTVIEDVEFQVGRTGAVTPVARLKPVFVGGV 355

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHN D I+ L           D+ +GD V ++RAG+VIP+VV ++  +R   A+
Sbjct: 356 TVSNATLHNMDEIRRL-----------DVHIGDTVFIRRAGDVIPQVVKVVAEKRPSGAR 404

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
               P  CP+C S V++          A  RC+GGL C AQ+ E ++H+ SR A +IEGL
Sbjct: 405 EVELPRQCPVCDSDVIQIEGE------AVARCSGGLFCPAQRKEAIRHYASRKALDIEGL 458

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + +D           +   AD++ L             +   G+ S  NL  +I++ R
Sbjct: 459 GDKWIDIMVDQ----GMVETVADLYRLTTDDLVK------LERMGEKSAANLVAAIDRAR 508

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
           N  L RF+++LGIR VG   A++LA ++ + +  A            D  SL  VP VG 
Sbjct: 509 NPVLWRFLYALGIREVGEATAKALAGHFGTLEAIAAA----------DEESLQTVPDVGP 558

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           I+A  I  F++   N   ++AL +          +     ++ +  V TGTL  + R +A
Sbjct: 559 IVAGHIRSFFEQTHNRETLDALREAGVRWQEEEVREGEKPLKGQTWVLTGTLSGMTRDEA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           +E +  LGA V+  +S+KT  ++ G+  GSKL KA+QL V +++E   + LL+++ 
Sbjct: 619 KEKLESLGAKVAGSVSKKTACVVAGEAAGSKLAKAEQLEVPVLDEAGLVALLEEHG 674


>gi|163845839|ref|YP_001633883.1| DNA ligase [Chloroflexus aurantiacus J-10-fl]
 gi|222523550|ref|YP_002568020.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
 gi|190359243|sp|A9WCA1|DNLJ_CHLAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781286|sp|B9LHI6|DNLJ_CHLSY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163667128|gb|ABY33494.1| DNA ligase, NAD-dependent [Chloroflexus aurantiacus J-10-fl]
 gi|222447429|gb|ACM51695.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
          Length = 709

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 266/720 (36%), Positives = 375/720 (52%), Gaps = 55/720 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S       ++ L   I  +D  YY    PI+ D+EYDAL     A+  A P+L     P
Sbjct: 1   MSHTTVADRINELRSLIRRYDYHYYVLDDPIVSDAEYDALMTELRALEAAHPELI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++ G       KV H  P LSL   +   DL  +  R+ R      D  + + +E
Sbjct: 58  DSPTQRVSGTPASQFAKVQHPQPMLSLGNAFTKADLLAWRDRVLRLLG--PDAIVAYVVE 115

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP-----------RVLSLN 180
           PKIDG  + + Y  G+ V  A RGDG  GEDV+A +R I +IP             L   
Sbjct: 116 PKIDGLAVALTYRDGRLVQGATRGDGEVGEDVTANLRTIGSIPLTLQATSTPQDDDLPTT 175

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
           +P  IEVRGEVY+   DF  LND + A G K +ANPRNAA+G LR+ +PT    R L FF
Sbjct: 176 LPTTIEVRGEVYMRTADFETLNDRLAAAGEKIFANPRNAAAGSLRQKDPTITAARPLRFF 235

Query: 240 VHGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDI 299
            +G+G    I    Q++ L+ +R LGFPVN  VR+   F  +++Y     + R  LPY+ 
Sbjct: 236 AYGVGVVEGISLSSQWQTLRYLRALGFPVNQDVRRFTDFAEVLAYCEAWMAKRDDLPYEA 295

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLE 359
           DG+V K+D+F+ Q++LG   R PRW I+ KF  ++A TRLLDI + +GRTG++TP A LE
Sbjct: 296 DGVVIKIDDFAQQRELGVVGRDPRWAIAFKFPAREAITRLLDITVNVGRTGVVTPNAELE 355

Query: 360 PVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVN 419
           PV IGG  + NA+LHN DYI             RDIR+GD V+VKRAG+VIP VV  ++ 
Sbjct: 356 PVQIGGVTVRNASLHNADYI-----------AQRDIRIGDYVIVKRAGDVIPYVVGPVIA 404

Query: 420 ERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRD 479
            R    +P+ FP+ CP C S + R+         AA RC     C AQ + R++HFVSR 
Sbjct: 405 RRDGSERPWQFPTHCPACGSPLEREEGE------AAWRCNNFSICPAQLVRRVEHFVSRS 458

Query: 480 AFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLY 539
           A +I G+G++Q + F +       IR  ADIF L+  Q         + GFG   + NL 
Sbjct: 459 ALDIVGMGERQAELFVQR----GLIRDVADIFFLKADQL------AELEGFGPKRIANLL 508

Query: 540 DSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLI 599
            +I+  R   L+R +  LGIR+VG   A++L     S                     L 
Sbjct: 509 AAIDAARQRPLDRLLVGLGIRYVGTVAAQTLVAALGSLDAIMAARQ----------EELE 558

Query: 600 RVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRH-EKNVSSEIENKKLVFTGTL 658
           ++P +G ++A +IV+F+  P N   +E L        G       S  +  K  V TGTL
Sbjct: 559 QIPGIGPVVAASIVDFFSRPANRALIEKLRAAGVQMGGVSGPTRQSDTLAGKTFVLTGTL 618

Query: 659 QKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + R +A   +   G  V+  +S+KT  ++ G N GSKL KA QLG+ +++E   L L+
Sbjct: 619 PSLSREQASALIVAHGGKVTDSVSKKTSYVVAGANAGSKLAKALQLGIPVIDEAGLLALI 678


>gi|293395040|ref|ZP_06639327.1| DNA ligase [Serratia odorifera DSM 4582]
 gi|291422447|gb|EFE95689.1| DNA ligase [Serratia odorifera DSM 4582]
          Length = 673

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 245/710 (34%), Positives = 393/710 (55%), Gaps = 50/710 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
           K+++ L   + +H+  Y+    P I D+EYD L R    +  A P+L  +   + P  ++
Sbjct: 6   KKINQLRTSLRHHEYLYHVLDAPEIPDAEYDRLMRELRTLEEAHPELITA---DSPTQRV 62

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138
           G     +  +V H +P LSL+ +++ +    F  R+      K    + F  E K+DG  
Sbjct: 63  GAAPLTAFDQVRHEVPMLSLDNVFDEDSYLAFYKRVQDRL--KSSEPLTFCCELKLDGLA 120

Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKND 197
           +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV++ +  
Sbjct: 121 VSLLYEDGELVRAATRGDGTTGENITANVRTIRAIPLRLIGDNIPRRVEVRGEVFMPQAG 180

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIFAKGQY 255
           F  +NDE      K +ANPRNAA+G LR+L+P     R L FF +G+G        +  Y
Sbjct: 181 FEKMNDEARRKDGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPRSHY 240

Query: 256 EMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQL 315
           + L + +  G PV++ VR       ++++Y +++  RS L +DIDG+V K+D+  LQ++L
Sbjct: 241 QRLMQFKAWGLPVSDRVRLCTGSDQVLAFYRQVEQDRSQLGFDIDGVVVKIDDIDLQERL 300

Query: 316 GERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHN 375
           G  AR+PRW  + KF  ++  T + +++ Q+GRTG +TPVARLEPV + G  ++NATLHN
Sbjct: 301 GFVARAPRWATAFKFPAQEQITVVREVEFQVGRTGAITPVARLEPVLVAGVTVSNATLHN 360

Query: 376 EDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCP 435
            D I+ L            +R+GD V+V+RAG+VIP+VV ++ + R PDA+   FP  CP
Sbjct: 361 ADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVEDRRPPDAREVVFPQHCP 409

Query: 436 ICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFF 495
           +C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + ++   
Sbjct: 410 VCGSDVERVEGE------AVARCTGGLICGAQRKEALKHFVSRRAMDVDGMGDKIIEQLV 463

Query: 496 KSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIF 555
           + E     ++ PA +F L          +  +   G  S  NL  ++ K +  +  RF++
Sbjct: 464 EKE----YVKNPAGLFRLTA------GMLTGLDRMGPKSAQNLASALEKAKQTTFARFLY 513

Query: 556 SLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEF 615
           +LGIR VG   A +LA ++ S                 D  +L +VP VG+++A+ +V F
Sbjct: 514 ALGIREVGESTAANLAAHFGSLDKLRAA----------DVEALKQVPDVGEVVAKHVVNF 563

Query: 616 YQNPRNICAVEALLK-----EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +    N   ++ L+           +    + + S    K +V TG+L ++ R +A++ +
Sbjct: 564 FAEALNQQVIDELVSDDIGIHWPAPVVVAVEEIDSPFAGKTVVLTGSLSQLSRDEAKDRL 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL Q
Sbjct: 624 TALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGIAVIDEAEMIRLLGQ 673


>gi|146312580|ref|YP_001177654.1| NAD-dependent DNA ligase LigA [Enterobacter sp. 638]
 gi|190359255|sp|A4WD23|DNLJ_ENT38 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145319456|gb|ABP61603.1| DNA ligase, NAD-dependent [Enterobacter sp. 638]
          Length = 671

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 244/713 (34%), Positives = 395/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MDSIEQQLTQLRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     S  +V H +P LSL+ +++ E    F  R+    +  D  ++ +  E K
Sbjct: 58  PTQRVGAAPLASFSQVRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSAD--TLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGLLVRAATRGDGTTGEDITANVRTIRAIPLTLRGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF- 250
           + +  F  +NDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQKGFEKINDEARRTGGKIFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGVL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV+N V+  ++   ++++Y++++  R +L +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKEWGLPVSNRVQLCDSPEAVLAFYHKVEEDRPSLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  D +   F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPDDTREIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R             RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PAHCPVCGSDVERVEGE------VVTRCTGGLICGAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L      S  K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRL------SAGKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA ++ + +   +               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAHFGTLEQLEKAT----------IDDLQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL+E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGKLLEEGIHWPAPVVINVEEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  +GA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L L  +
Sbjct: 619 ARLVAIGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLFGE 671


>gi|168238909|ref|ZP_02663967.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734182|ref|YP_002115493.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|254781415|sp|B4TQF8|DNLJ_SALSV RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194709684|gb|ACF88905.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288317|gb|EDY27698.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 671

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 243/712 (34%), Positives = 393/712 (55%), Gaps = 48/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL 
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLTKAQELGITVIDEAEMIRLLD 670


>gi|157371681|ref|YP_001479670.1| NAD-dependent DNA ligase LigA [Serratia proteamaculans 568]
 gi|190359284|sp|A8GHF2|DNLJ_SERP5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157323445|gb|ABV42542.1| DNA ligase, NAD-dependent [Serratia proteamaculans 568]
          Length = 673

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 239/713 (33%), Positives = 398/713 (55%), Gaps = 50/713 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P + D+EYD L     A+  A P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEYQYHVLDAPEVPDAEYDRLMGELRALESAHPELITA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R+      K  + + F  E K
Sbjct: 58  PTQRVGAAPLAAFDQVRHEVPMLSLDNVFDEESFLAFYKRVQDRL--KSSDPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE++++ +R I  IP  L+ +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGELVRAATRGDGTTGENITSNVRTIRAIPLRLTGDNIPRRLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E      K +ANPRNAA+G +R+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQMNEEARRKDGKIFANPRNAAAGSIRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +  ++ L + +  G PV++  ++      ++++Y +++  R+ L +DIDG+V K+D+  
Sbjct: 236 PRSHWQRLMQFKDWGLPVSDRAKRCTGSDEVLAFYRQVEQDRTQLGFDIDGVVVKIDDID 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQETLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVLVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +I   R  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVIAERRPADAREILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S V R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PQHCPVCGSDVERVEGE------AVARCTGGLICAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + E     ++ PAD+F L      S   +  +   G  S  NL +++ K +  + 
Sbjct: 459 IEQLVEKE----YVKNPADLFRL------SAGILTGLDRMGPKSAQNLVNALEKSKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +                 D  +L  VP VG+I+A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFGTLDKLLAA----------DIEALKEVPEVGEIVAK 558

Query: 611 AIVEFYQNPRNICAVEALLK-EVSPSIGRH----EKNVSSEIENKKLVFTGTLQKIQRHK 665
               F     N   ++ L+  E+  +         + + S    K +V TG+L ++ R +
Sbjct: 559 HTRHFLDEELNQQVIQELVSDEIGINWPAPVVIVAEEIDSPFAGKTVVLTGSLSQLSRDE 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 619 AKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGIEVIDEAEMIRLL 671


>gi|329297490|ref|ZP_08254826.1| NAD-dependent DNA ligase LigA [Plautia stali symbiont]
          Length = 672

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 249/712 (34%), Positives = 399/712 (56%), Gaps = 49/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +   ++++++L   + +H+  Y+    P I D+EYD L R    +  A PDL     P+ 
Sbjct: 1   MTSVQEQITALRTTLRHHEYLYHVMDTPEIPDAEYDRLMRELRELESAHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+  ++      F  R+    +  D+  + +  E K
Sbjct: 58  PTQRVGAAPLATFEQVRHEVPMLSLDNTFDEAGFLAFNKRMQDRLKSTDN--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYENGLLVRAATRGDGTTGENITANVRTIHAIPLRLHGDNIPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           ++++ F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G G       
Sbjct: 176 MTESGFEKLNEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               ++ LQ+ +  G PV++ +R  +T   ++++Y +++  R +L +DIDG+V KVD  +
Sbjct: 236 PASHWQRLQQFKAWGLPVSDRIRLVHTADEVLAFYRQVEQDRPSLGFDIDGVVIKVDSQA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTVVRDVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  DA+   F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPADAREIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S V            A  RCTGGL C AQ+ E LKHFVS  A +++G+G + 
Sbjct: 405 PSHCPVCGSDVESVEGE------AVTRCTGGLICGAQRKEALKHFVSHRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L         K+  +   G  S  N+ D++ K +  +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKLTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   +               D  +LI V  VG ++A 
Sbjct: 509 PRFLYALGIREVGEATAANLANHFGELEKVMNA----------DLDALIAVQDVGKVVAA 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPS----IGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F +   N   +  L  EV       +    + + S    K +V TG+L ++ R  A
Sbjct: 559 HVRNFMEEESNREVIRQLTDEVGVHWPAVVVVKAEEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 619 KARLTALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLL 670


>gi|206579402|ref|YP_002237241.1| DNA ligase, NAD-dependent [Klebsiella pneumoniae 342]
 gi|288934177|ref|YP_003438236.1| DNA ligase, NAD-dependent [Klebsiella variicola At-22]
 gi|254781350|sp|B5XVT4|DNLJ_KLEP3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206568460|gb|ACI10236.1| DNA ligase, NAD-dependent [Klebsiella pneumoniae 342]
 gi|288888906|gb|ADC57224.1| DNA ligase, NAD-dependent [Klebsiella variicola At-22]
          Length = 671

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 249/713 (34%), Positives = 399/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDD--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  + AA RGDG +GED+++ +R I TIP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLMQAATRGDGTTGEDITSNVRTIRTIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  LQ+ +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  +
Sbjct: 236 PASHSARLQQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEDRPHLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L      S  K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRL------SAGKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAALAAHFGTLEALEQA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E       +    + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVHWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|238785571|ref|ZP_04629551.1| DNA ligase [Yersinia bercovieri ATCC 43970]
 gi|238713506|gb|EEQ05538.1| DNA ligase [Yersinia bercovieri ATCC 43970]
          Length = 670

 Score =  582 bits (1499), Expect = e-163,   Method: Composition-based stats.
 Identities = 247/712 (34%), Positives = 403/712 (56%), Gaps = 47/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  S   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHQYHVLDAPEIPDAEYDRLMQQLRDLESQHPELITS---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++   ++ +   + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRLKRTE--PLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IF 250
           + +  F  LNDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQAGFEQLNDEARRKGGKVFANPRNAAAGSLRQLDPRITAKRRLAFFCYGVGLLDGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +   + L + +  G PV+N V+       ++++Y +++  R+ L +DIDG+V KVD+  
Sbjct: 236 PRSHIQRLMQFKAWGLPVSNRVQLCTGSEQVIAFYRQVEQDRAGLGFDIDGVVIKVDDLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  DA+  +F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPQDAKEITF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PEHCPVCGSDIERVEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+F L         K+  +   G  S  NL  ++ + +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFELTA------GKLTGLDRMGPKSAQNLIVALERAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D   L  VP VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNMANLRAA----------DIDELKSVPDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +EAL K +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVLNFLGEEHNQRVIEALEKVISWPEPQQIIAEEIDSPFAGKTVVLTGSLTILSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
            +T LGA VS  +SRKTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 RLTALGAKVSGSVSRKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLLGE 670


>gi|16765747|ref|NP_461362.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167991721|ref|ZP_02572820.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197262860|ref|ZP_03162934.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|81522316|sp|Q8ZN89|DNLJ_SALTY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|16420966|gb|AAL21321.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|197241115|gb|EDY23735.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205329843|gb|EDZ16607.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247627|emb|CBG25454.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267994529|gb|ACY89414.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158979|emb|CBW18492.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312913414|dbj|BAJ37388.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222873|gb|EFX47944.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323130756|gb|ADX18186.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989355|gb|AEF08338.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 671

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 242/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQELLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKSKTTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|238759468|ref|ZP_04620632.1| DNA ligase [Yersinia aldovae ATCC 35236]
 gi|238702365|gb|EEP94918.1| DNA ligase [Yersinia aldovae ATCC 35236]
          Length = 670

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 245/710 (34%), Positives = 398/710 (56%), Gaps = 47/710 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++++ L   + +H+  Y+    P I D+EYD L ++   +    P+L  +   + 
Sbjct: 1   MESIIQQINQLRTSLRHHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELVTN---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  R++     K    + F  E K
Sbjct: 58  PTQRVGAAPLDAFEQVKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KSVEPLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEEGELVRAATRGDGTTGENITANVRTIRAIPLRLHGDNIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F  LNDE    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPLAGFEQLNDEARRKGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     L + +  G PV++ V+       ++++Y +++  R+ L +DIDG+V KVD+  
Sbjct: 236 PRSHIARLMQFKAWGLPVSDRVKLCTGSEQVIAFYRQVEQDRAGLGFDIDGVVIKVDDLD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW  + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWATAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+V+RAG+VIP+VV +++ +R  D Q   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPQDTQEIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S + R          A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PEHCPVCGSDIERIEGE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++   + +     +  PAD+FTL         K+  +   G  S  NL  ++ K +  + 
Sbjct: 459 IEQLVEKQ----YVENPADLFTLTA------GKLTGLDRMGPKSAQNLIVALEKAKQTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ +  N              D  +L  V  VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFRNLANLRAA----------DIDALKSVQDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            ++ F     N   +EAL + +S    +    + + S    K +V TG+L  + R +A++
Sbjct: 559 HVMNFLNEEHNQKVIEALEQVISWPEPQQIVVEEIDSPFAGKTVVLTGSLTMLSRDEAKD 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 RLTALGAKVSGSVSKKTDLVIAGEAAGSKLVKAQELGITVIDEAEMIRLL 668


>gi|332290231|ref|YP_004421083.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
 gi|330433127|gb|AEC18186.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
          Length = 671

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 254/711 (35%), Positives = 392/711 (55%), Gaps = 45/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++ +  L  ++ YH+  Y+    P+I D+EYD +  +   +    P+L      + 
Sbjct: 1   MDDLQQHIEQLRNDLRYHEYQYHVLDNPVIPDAEYDRMMNQLKRLEAEHPELITD---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G +      ++ H +P LSL+  ++ E+   FI RI        D    F  EPK
Sbjct: 58  PTQRVGAKPANGFQQIRHELPMLSLDNAFSDEEFFAFIRRIEDRLGVLPD-PFTFCCEPK 116

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV-LSLNIPEIIEVRGEVY 192
           +DG  ++I Y  GK   AA RGDG +GED++A IR I  IP    +   P  +EVRGEV+
Sbjct: 117 LDGLAVSILYVNGKLTQAATRGDGVTGEDITANIRTIRNIPLQLRTATPPARLEVRGEVF 176

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNF-FVHGLGKTS-EIF 250
           +  + F  LN+  +  G K +ANPRNAA+G LR+L+P            +G+G       
Sbjct: 177 MPHDGFERLNNHALEHGEKTFANPRNAAAGSLRQLDPQVTYHRPLMLNAYGIGIAEGVEL 236

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               Y+ LQ ++ +G PVN  +R  N    ++ +Y  +   RS+L YDIDG V KV+   
Sbjct: 237 PNTHYDRLQWLKSIGIPVNKEIRLCNGTTEVLDFYRSIAEKRSSLGYDIDGTVLKVNSIP 296

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  +R+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV + G  ++N
Sbjct: 297 LQEQLGFISRAPRWAIAYKFPAQEELTILNDVEFQVGRTGAITPVAKLEPVYVAGVTVSN 356

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L           DI +GD V+++RAG+VIP+++ ++ + R PDA+P  F
Sbjct: 357 ATLHNGDEIARL-----------DIAIGDTVIIRRAGDVIPQIIGVVHDRRPPDAKPIIF 405

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S +VR          A  RCTGGL C AQ+ E LKHFVSR A +I+G+G + 
Sbjct: 406 PTRCPVCDSAIVRIDGE------AVARCTGGLVCEAQRKEGLKHFVSRKAMDIDGVGDKL 459

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++     E     +  P D+FTL +           +   G+ S      SI K +  +L
Sbjct: 460 IEQLVDRE----YLHTPVDLFTLSKETLMG------LERMGEKSAEKALASIEKAKKTTL 509

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+F+LGIR VG   AR+LA ++ + +N               +  L +V  +G+++A 
Sbjct: 510 ARFLFALGIREVGEATARNLANHFHTLENIKNAT----------FEQLQQVQDIGEVVAN 559

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNV-SSEIENKKLVFTGTLQKIQRHKAQEY 669
            I+ F+Q   N   VE L+++       +   +  + ++ K +V TGTL ++ R +A+  
Sbjct: 560 RIILFWQEQHNRNVVEKLIEQGVTWDDVNATEIADNPLKEKTVVLTGTLTQMTRDQAKAL 619

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           + QLG  V+  +S KTD +I GDN GSKL+KA+ LGVK++ E+QFL L+ Q
Sbjct: 620 LLQLGCKVAGSVSSKTDFVIAGDNAGSKLQKAESLGVKVLTEQQFLDLIPQ 670


>gi|290508381|ref|ZP_06547752.1| DNA ligase, NAD-dependent [Klebsiella sp. 1_1_55]
 gi|289777775|gb|EFD85772.1| DNA ligase, NAD-dependent [Klebsiella sp. 1_1_55]
          Length = 671

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 249/713 (34%), Positives = 399/713 (55%), Gaps = 48/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P + D+EYD L R    +    P+L     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELESQHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTDD--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  + AA RGDG +GED+++ +R I TIP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLMQAATRGDGTTGEDITSNVRTIRTIPLKLHGENIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  LQ+ +  G PV++ V   +T   +++YY +++  R  L +DIDG+V KVD  +
Sbjct: 236 PASHSARLQQFKAWGLPVSDRVTLCHTPEEVLTYYRKVEEDRPHLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQITFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD+V+++RAG+VIP+VV+++++ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLKIGDKVVIRRAGDVIPQVVNVVLSERPADARDVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCQSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L      S  K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRL------SAGKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ + +   Q               L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAALAAHFGTLEALEQA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
               F+    N   +  LL E       +    + + S    K +V TG+L ++ R  A+
Sbjct: 559 HTFNFFAEESNRDVIAQLLAEGVHWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL +
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE 671


>gi|161612830|ref|YP_001586795.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|190359282|sp|A9N362|DNLJ_SALPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161362194|gb|ABX65962.1| hypothetical protein SPAB_00529 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 671

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL CSAQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICSAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|168466836|ref|ZP_02700690.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630762|gb|EDX49354.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 671

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------VKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|167581473|ref|ZP_02374347.1| DNA ligase, NAD-dependent [Burkholderia thailandensis TXDOH]
          Length = 691

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 263/726 (36%), Positives = 395/726 (54%), Gaps = 53/726 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLVGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 182 PEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
              + +VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G             +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S                     L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA----------SIDEL 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFT 655
           + V  VG I+A++I +F+    N   +E L  +   +        +     +  K +V T
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGVLAGKTVVLT 623

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E    
Sbjct: 624 GTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEAGMH 683

Query: 716 FLLQQY 721
            LL+ +
Sbjct: 684 KLLEGH 689


>gi|261345310|ref|ZP_05972954.1| DNA ligase, NAD-dependent [Providencia rustigianii DSM 4541]
 gi|282566645|gb|EFB72180.1| DNA ligase, NAD-dependent [Providencia rustigianii DSM 4541]
          Length = 678

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 237/712 (33%), Positives = 393/712 (55%), Gaps = 49/712 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           +  ++++ SL+Q++ +H+  Y+    P I D EYD L +    +    P+L  +   + P
Sbjct: 8   DALKQKIDSLKQQLRHHEYLYHVLDAPEIPDVEYDKLMQELKGLEAENPELITT---DSP 64

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++G     +   V H +P LSL+ +++ E    F  R+       +   + F  E K+
Sbjct: 65  TQRVGAAPLTAFGTVRHEVPMLSLDNVFDEESYLAFDKRVKDRLN--NHTELTFCCELKL 122

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYI 193
           DG  +++ YE G+ V AA RGDG  GE+++  +R I  IP  L  +  P  +E+RGEV++
Sbjct: 123 DGLAVSLLYENGELVQAATRGDGSVGENITVNVRTIKAIPLRLRGDNIPARVEIRGEVFM 182

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF-A 251
            +  F A+N+E      K +ANPRNAA+G LR+L+P     R L F+ +G+G        
Sbjct: 183 PQKGFEAMNEEARRTDGKIFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGLVEGNTLP 242

Query: 252 KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSL 311
              YE L + +  G PV+  V+       ++ +Y+ ++ IR TL +DIDG+V KV++ + 
Sbjct: 243 DTHYERLMQFKAWGLPVSEHVQLRVGCQQVLDFYHHVEKIRPTLGFDIDGVVIKVNDIAT 302

Query: 312 QKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNA 371
           Q++LG  +R+PRW  + KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++NA
Sbjct: 303 QEKLGFVSRAPRWATAFKFPAQEQLTLLKDVEFQVGRTGAITPVARLEPVQVAGVVVSNA 362

Query: 372 TLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFP 431
           TLHN D I+ L            +R+GD V+++RAG+VIP++V +++++R  D++  +FP
Sbjct: 363 TLHNADEIERL-----------GVRIGDTVVIRRAGDVIPQIVSVVMDKRPADSREITFP 411

Query: 432 SFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQL 491
           + CP+C S + R          A  RCTGGL C AQ  E LKHFVSR A +++G+G + +
Sbjct: 412 TQCPVCHSDIERVEGE------AVARCTGGLTCGAQLKESLKHFVSRRAMDVDGMGDKII 465

Query: 492 DFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLE 551
           +    +E     ++  A ++ L      S  K+  +   G  S   L D++ K +  +L 
Sbjct: 466 EQLVDAE----YVKNAAQLYQL------SAGKLTGLERMGPKSAQKLIDALEKSKQTTLA 515

Query: 552 RFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQA 611
           RFI++LGIR VG   A +LA +Y S                 D  SL  V  +G+++A+ 
Sbjct: 516 RFIYALGIREVGEATAANLASHYASLDAVMAA----------DEESLKAVQDIGEVVAKH 565

Query: 612 IVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +V F+    N   +  LL   +      +      + S    K +V TG++ ++ R +A+
Sbjct: 566 VVNFFHEEHNRQVIHDLLTIANIHWPEVKVVNSDEIDSPFAGKTVVLTGSMSRLTRDEAK 625

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           + +  LGA V+  +S+KTD++I G+  GSKL KA +LGVK+++E++ + LL 
Sbjct: 626 DQLVALGAKVAGSVSKKTDMVIAGEAAGSKLAKAIELGVKVIDEDELVRLLN 677


>gi|83720010|ref|YP_442546.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|257138755|ref|ZP_05587017.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|123753789|sp|Q2SX03|DNLJ_BURTA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83653835|gb|ABC37898.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
          Length = 691

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 262/726 (36%), Positives = 394/726 (54%), Gaps = 53/726 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 182 PEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
              + +VRGEV + + DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFRRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G             +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  + 
Sbjct: 361 EPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSAVF 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S                     L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA----------SIDEL 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFT 655
           + V  VG I+A++I +F+    N   +E L  +   +        +     +  K +V T
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGVLAGKTVVLT 623

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E    
Sbjct: 624 GTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEAGMH 683

Query: 716 FLLQQY 721
            LL+ +
Sbjct: 684 KLLEGH 689


>gi|62180995|ref|YP_217412.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|75481868|sp|Q57LT1|DNLJ_SALCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|62128628|gb|AAX66331.1| DNA ligase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715476|gb|EFZ07047.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 671

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAEGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIVQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|161502427|ref|YP_001569539.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|190359281|sp|A9MIG0|DNLJ_SALAR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160863774|gb|ABX20397.1| hypothetical protein SARI_00461 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 671

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 246/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R   A+    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRALEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVRAATRGDGTTGEDITSNVRTIRAIPLKLRGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRSGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++++Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLAFYHNVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIDRL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +    
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATIF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAA----------SIDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNREVIGQLLAEGVHWPAPVVINAQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             + +LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L LL
Sbjct: 619 ARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLL 669


>gi|200388789|ref|ZP_03215401.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605887|gb|EDZ04432.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 671

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/712 (34%), Positives = 392/712 (55%), Gaps = 48/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------VKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL 
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLD 670


>gi|300717845|ref|YP_003742648.1| DNA ligase [Erwinia billingiae Eb661]
 gi|299063681|emb|CAX60801.1| DNA ligase [Erwinia billingiae Eb661]
          Length = 672

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 253/714 (35%), Positives = 396/714 (55%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E  + ++++L+  + +H+  Y+    P + D+EYD L R    +  A P+L  +   + 
Sbjct: 1   MESVQDKITALQTTLRHHEYQYHVMDDPEVPDAEYDRLMRELRELEQAHPELVTA---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+  ++ E    F  R+      K+ + I F  E K
Sbjct: 58  PTQRVGAAPLGAFEQVRHEVPMLSLDNAFDEESYLAFYKRVQDRL--KNTDDITFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVRAATRGDGTTGENITANVRTIRAIPLRLHGENIPSRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F ALN+E    G K +ANPRNAA+G LR+L+P     R L FF +G G       
Sbjct: 176 MPLAGFEALNNEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     LQ+ +  G PV++ ++  +T   ++++Y +++  R TL +DIDG+V KVD   
Sbjct: 236 PRSHMARLQQFKAWGLPVSDRIKLCHTAEEVLAFYRQVEQDRPTLGFDIDGVVIKVDSQD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTTVRDVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GDRV+++RAG+VIP+VV +I +ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDRVIIRRAGDVIPQVVGVIESERPDDAREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R             RCTGGL C AQ+   LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------VVARCTGGLICGAQRKGALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +S+ K +  +L
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNSLEKAKTTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF++SLGI  VG   A +LA ++ S +               D  +LI V  VG ++A 
Sbjct: 509 ARFLYSLGISEVGEATAANLAAHFGSLEKIMAA----------DLDALIAVQDVGTVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F     N   +  L++E   +    E      + S    K +V TG+L  + R +A
Sbjct: 559 HLRNFMDEESNREVIRQLVEEAGINWPAVEVVNAAEIDSPFAGKTVVLTGSLTILSRDEA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           ++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 619 KDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMIRLLGE 672


>gi|197247622|ref|YP_002147380.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|254781407|sp|B5F0F5|DNLJ_SALA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197211325|gb|ACH48722.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 671

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/712 (34%), Positives = 392/712 (55%), Gaps = 48/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL 
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLD 670


>gi|186476101|ref|YP_001857571.1| DNA ligase, NAD-dependent [Burkholderia phymatum STM815]
 gi|254781277|sp|B2JID1|DNLJ_BURP8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|184192560|gb|ACC70525.1| DNA ligase, NAD-dependent [Burkholderia phymatum STM815]
          Length = 683

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 256/712 (35%), Positives = 387/712 (54%), Gaps = 49/712 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
            +    L  E+   +  YY   +P + D+EYD L +    I    PDL     P+ P  +
Sbjct: 15  AERALWLRDELERANYAYYVLDQPDLPDAEYDRLFKELQQIESEHPDLI---TPDSPTQR 71

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +GGE+      V H +P LSL   ++ ED+  F  R+           + +  E K DG 
Sbjct: 72  VGGEVASGFRPVVHDMPMLSLNNGFSDEDIAAFDKRVSDTLH---HTPVDYACELKFDGL 128

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKN 196
            I++RY  G+F  AA RGDG +GEDV+  +R I +IP  L     P++++VRGEV + + 
Sbjct: 129 AISLRYVDGQFTQAATRGDGATGEDVTENVRTIRSIPLKLKGKRVPKLVDVRGEVLMFRR 188

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EIFAKGQ 254
           DF  LN      G++ +ANPRNAA+G LR+L+P     R L+FF +G+G           
Sbjct: 189 DFDKLNQRQRDAGQREFANPRNAAAGSLRQLDPKMTAQRPLSFFAYGIGVLDGIEMPGTH 248

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
            E+L     +G PVN+         G++ +++++   R  LPYDIDG+VYKV+    Q  
Sbjct: 249 SELLDWYHEMGLPVNSERAVVQGAEGVLGFFHKVGEKRDKLPYDIDGVVYKVNRRDEQDA 308

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +TNATLH
Sbjct: 309 LGFVSRAPRFALAHKFPAQEALTKLIAIDVQVGRTGAITPVARLEPVFVGGATVTNATLH 368

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NED ++            +DIR+GD V+V+RAG+VIP+VV  ++  R PDA+ F  P+ C
Sbjct: 369 NEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLERRPPDAREFVMPTQC 417

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S + R  +       A  RC+GGL C AQ+ + L HF  R A +I+GLG++ +D  
Sbjct: 418 PVCGSAIERLPDE------AIARCSGGLFCPAQRKQALWHFAQRRALDIDGLGEKIIDQL 471

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
            +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +L RFI
Sbjct: 472 VE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLIDSLEKAKHTTLARFI 521

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           ++LGIRHVG   A+ LA+++ S                     L+ V  VG I+A+AI +
Sbjct: 522 YALGIRHVGESTAKDLARHFGSLDPIMSAT----------VEELLEVNDVGPIVAEAIHQ 571

Query: 615 FYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           F+    N   +E L      +        K     +  K +V TGTL  + R +A+E + 
Sbjct: 572 FFAEEHNRTVIEQLRAPGKVTWAEGPPAPKAPQGVLAGKTVVLTGTLPNMGRDEAKELLE 631

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
             GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+   T
Sbjct: 632 AAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGMRKLLEGQTT 683


>gi|317491275|ref|ZP_07949711.1| DNA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920822|gb|EFV42145.1| DNA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 678

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/702 (34%), Positives = 384/702 (54%), Gaps = 50/702 (7%)

Query: 25  EQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNL 84
              + +H+  Y+    P I D+EYD L R   A+    P+L     P+ P  ++G     
Sbjct: 17  RTALRHHEYQYHVLDAPEIPDAEYDRLMRELRALEEQHPELI---TPDSPTQRVGAAPLS 73

Query: 85  SLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYE 144
           +  +V H +P LSL+ +++ E    F  R++     K    + F  E K+DG  +++ YE
Sbjct: 74  AFSQVRHEVPMLSLDNVFDDESYLAFDKRVHDRL--KTAEPLTFCCELKLDGLAVSLLYE 131

Query: 145 KGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKNDFLALND 203
            G  V  A RGDG +GED++A ++ I  IP  L  +  P  +EVRGEV++    F A+N+
Sbjct: 132 DGVLVRGATRGDGTTGEDITANVKTIRAIPLRLQGDNIPRRVEVRGEVFMPLAGFEAMNE 191

Query: 204 EMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG-KTSEIFAKGQYEMLQKM 261
           E      K +ANPRNAA+G LR+L+P     R L FF +G+G           Y  LQ+ 
Sbjct: 192 EARRKDGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLMDGGELPASHYARLQQF 251

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
           +  G PV++ V++      ++ +Y +++  R TL +DIDG+V KVD   +Q+QLG  AR+
Sbjct: 252 KAWGLPVSDRVKRCTGSDEVLKFYRQVEQERPTLGFDIDGVVIKVDSIEIQEQLGFVARA 311

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PRW  + KF  ++  T +  ++ Q+GRTG +TPVARLEPV + G +++NATLHN D I  
Sbjct: 312 PRWATAFKFPAQEQMTVVNGVEFQVGRTGAITPVARLEPVLVAGVIVSNATLHNADEIDR 371

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRV 441
           L            +R+GD V+V+RAG+VIP+VV ++  +R  +AQ   FP  CP+C S V
Sbjct: 372 L-----------GLRIGDTVIVRRAGDVIPQVVGVVEAQRPENAQEIVFPQHCPVCGSDV 420

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
            R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + ++   + E   
Sbjct: 421 ERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKIIEQLVEKE--- 471

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             ++ PAD++ L          +  +   G  S TNL +++ K +  +L RF+++LGIR 
Sbjct: 472 -YVKTPADLYRLTA------GILTGLDRMGPKSATNLVNALAKSKETTLARFLYALGIRE 524

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           VG   A +LA ++ S +   +           D  +L  V  VG+++A+ +  F     N
Sbjct: 525 VGEATAANLAAHFGSLEALREA----------DVEALKSVQDVGEVVAKHVRHFLGEEHN 574

Query: 622 ICAVEALLK-EVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAV 676
              ++ L+  E+       +    + + S    K +V TG+L  + R +A++ +  LGA 
Sbjct: 575 QKVIDELISDEIGIHWPAPQVIVAEEIDSPFAGKTVVLTGSLSLMPRDEAKDRLAALGAK 634

Query: 677 VSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 635 VSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLL 676


>gi|204929538|ref|ZP_03220612.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204321257|gb|EDZ06457.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 671

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLTKAQELGITVIDEAEMIRLL 669


>gi|168817829|ref|ZP_02829829.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205345161|gb|EDZ31925.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086917|emb|CBY96687.1| DNA ligase [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 671

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/712 (34%), Positives = 394/712 (55%), Gaps = 48/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLNQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           E +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL 
Sbjct: 619 ERLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGINVIDEAEMIRLLD 670


>gi|167619582|ref|ZP_02388213.1| DNA ligase, NAD-dependent [Burkholderia thailandensis Bt4]
          Length = 691

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 262/726 (36%), Positives = 395/726 (54%), Gaps = 53/726 (7%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P+E  S  Q  K  + L  E+   +  YY   +P + D+EYD L      I    PDL  
Sbjct: 5   PVEP-SAGQPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFAELQQIEAEHPDLV- 62

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD---- 123
              P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K  D    
Sbjct: 63  --TPDSPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDKPTDLAGT 120

Query: 124 --NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI 181
               + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP  L    
Sbjct: 121 VTEPVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTENIRTVRSIPLTLKGKR 180

Query: 182 PEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFF 239
              + +VRGEV + + DF  LN+   A G++ +ANPRNAA+G LR+L+     +R L+FF
Sbjct: 181 VPRMLDVRGEVLMFRRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITASRPLSFF 240

Query: 240 VHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYD 298
            +G+G             +L     LG PVN          G++ +++ + + R +LPYD
Sbjct: 241 AYGIGVLDGVEMPDTHSSLLDWYETLGLPVNRERAVVRGAAGLLEFFHSVGARRESLPYD 300

Query: 299 IDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARL 358
           IDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARL
Sbjct: 301 IDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARL 360

Query: 359 EPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIV 418
           EPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++
Sbjct: 361 EPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSAVL 409

Query: 419 NERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSR 478
           + R  DA+ F  P+ CP C SRV R  +       A  RCTGGL C AQ+ + L HF  R
Sbjct: 410 DRRPADAREFVMPTECPECGSRVERLPDE------AIARCTGGLFCPAQRKQALWHFAQR 463

Query: 479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNL 538
            A +I+GLG++ +D   +       +R PAD+F L        + +  +  F + S  NL
Sbjct: 464 RALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFAEKSAQNL 513

Query: 539 YDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSL 598
            DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S                     L
Sbjct: 514 IDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA----------SIDEL 563

Query: 599 IRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFT 655
           + V  VG I+A++I +F+    N   +E L  +   +        +     +  K +V T
Sbjct: 564 LEVNDVGPIVAESIHQFFAEAHNRTVIEQLRAKGKVTWPEGPPAPRAPQGVLAGKTVVLT 623

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E    
Sbjct: 624 GTLPTLTREAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEAGMH 683

Query: 716 FLLQQY 721
            LL+ +
Sbjct: 684 KLLEGH 689


>gi|157144662|ref|YP_001451981.1| NAD-dependent DNA ligase LigA [Citrobacter koseri ATCC BAA-895]
 gi|166215574|sp|A8ADI2|DNLJ_CITK8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157081867|gb|ABV11545.1| hypothetical protein CKO_00382 [Citrobacter koseri ATCC BAA-895]
          Length = 671

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 246/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K  + + +  E K
Sbjct: 58  PSQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSGDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  + AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLISAATRGDGTTGEDITSNVRTIRAIPLKLRGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPEAVLDFYHKVEEDRPTLGFDIDGVVIKVNSMA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPVEF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALEAA----------SIDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       I  +   + S    K +V TG+L  + R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGIHWPAPIVVNADEIDSPFAGKTIVLTGSLSLMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + L LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLL 669


>gi|153838362|ref|ZP_01991029.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus AQ3810]
 gi|149748221|gb|EDM59080.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus AQ3810]
          Length = 670

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 251/713 (35%), Positives = 393/713 (55%), Gaps = 48/713 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL      
Sbjct: 1   MS-ESVHQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTV--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+      +VTH +P LSL+  ++  +L  F  R       +      +  E
Sbjct: 57  DSPSQRVGGKPLSEFSQVTHEVPMLSLDNAFDDSELDSFHKRAQDRIGGESIKQ--YCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  +  P  +EVRGE
Sbjct: 115 PKLDGLAVSLLYENGILVQAATRGDGTTGENITENVRTINAIPLKLRGDDWPARLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G     
Sbjct: 175 VFMPKAGFEKLNELARQKGEKVFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQGA 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             A   YE   +++  G P+    ++ ++   + +YY ++   R  LPY+IDG+V K+D+
Sbjct: 235 DLAASHYERFLQIKSWGLPMCPETKRVDSLADVKTYYQDILQRRDALPYEIDGVVIKIDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            ++Q++LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IAVQERLGFVARAPRWAIAYKFPAQEEITTLNEVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            +++GD+V+++RAG+VIP+VV +I   R   A+  
Sbjct: 355 SNATLHNADEIERLQ-----------VKIGDQVVIRRAGDVIPQVVSVIKERRPETARDI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S V R          A  RCTGGL C AQ+ + LKHFVSR A +++GLG 
Sbjct: 404 IFPTQCPVCGSHVERIEGE------AVTRCTGGLVCQAQRKQALKHFVSRKALDVDGLGD 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   +  +   G  S  N+ +++ K +  
Sbjct: 458 KVIEQLVDRE----MVETPADLFKL------SAGVLTVLERMGPKSAQNIVNALEKSKLT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA+++ S +                   LI V  +G ++
Sbjct: 508 TLPRFLYSLGIREVGEATAANLAQHFKSLEAIQAATE----------EQLIAVQDIGVVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A+ I  F++  +N   V+ LL +    P +   E+     +E K +V TGTL ++ R +A
Sbjct: 558 AKHITTFFEEEKNQAVVQDLLVQGIHWPEVSAPEQGAELPLEGKTVVLTGTLSQLGRTEA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 618 KEALQSLGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELIN 670


>gi|215918993|ref|NP_819574.2| NAD-dependent DNA ligase [Coxiella burnetii RSA 493]
 gi|218512010|sp|Q83DZ6|DNLJ_COXBU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206583878|gb|AAO90088.2| NAD-dependent DNA ligase [Coxiella burnetii RSA 493]
          Length = 673

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 247/709 (34%), Positives = 388/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L QEI+ H+  YY  S+P I DS YD L    + +   +P+   +  P+ 
Sbjct: 7   PAKIQKRIERLRQEINDHNYRYYVLSQPTIPDSVYDELFHELEKLEKKYPE---TITPSS 63

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 64  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 121

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 122 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 181

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 182 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 241

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 242 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 301

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 302 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 361

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 362 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 410

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 411 PSRCPVCHAEVIKPEGE------AVARCVGGLYCRAQLRESIKHFASRRALDIEGLGDKL 464

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 465 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 514

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G + A+
Sbjct: 515 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVAAE 564

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 565 NIHAFFHQKNNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 623

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 624 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 672


>gi|212710592|ref|ZP_03318720.1| hypothetical protein PROVALCAL_01658 [Providencia alcalifaciens DSM
           30120]
 gi|212686673|gb|EEB46201.1| hypothetical protein PROVALCAL_01658 [Providencia alcalifaciens DSM
           30120]
          Length = 678

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 239/714 (33%), Positives = 392/714 (54%), Gaps = 49/714 (6%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           + +   +++ +L+Q++ +H+  Y+    P I D EYD L +   A+    P+L  +   +
Sbjct: 6   NPDALTQKIDALKQQLRHHEYLYHVMDAPEIPDVEYDKLMQELKALEAEHPELITT---D 62

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            P  ++G     +   V H IP LSL+ +++ E    F  R+       +   + F  E 
Sbjct: 63  SPTQRVGAAPLAAFDTVRHEIPMLSLDNVFDEESYLAFDKRVKDRL--HNHTELTFCCEL 120

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K+DG  +++ YE G+ V AA RGDG  GE+++A +R I  IP  L  +  P  +E+RGEV
Sbjct: 121 KLDGLAVSLLYENGELVQAATRGDGTVGENITANVRTIKAIPLRLRGDNIPARVEIRGEV 180

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF 250
           ++ +  F A+N+E      K +ANPRNAA+G LR+L+P     R L F+ +G+G      
Sbjct: 181 FMPQKGFEAMNEEARKTDGKIFANPRNAAAGSLRQLDPRITAKRPLTFYCYGVGLVEGKT 240

Query: 251 -AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                YE L + +  G PV+  V+       ++ +Y+ ++ IR TL +DIDG+V KV++ 
Sbjct: 241 LPDTHYERLMQFKAWGLPVSEHVQLRVGCQQVLDFYHHVEKIRPTLGFDIDGVVIKVNDI 300

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           ++Q++LG  +R+PRW  + KF  ++  T L D++ Q+GRTG +TPVARLEPV + G +++
Sbjct: 301 AIQEELGFVSRAPRWATAFKFPAQEQITLLKDVEFQVGRTGAITPVARLEPVQVAGVVVS 360

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I  L            +R+GD V+++RAG+VIP++V +++++R  D++   
Sbjct: 361 NATLHNADEIDRL-----------GVRIGDTVVIRRAGDVIPQIVSVVMDKRPADSREII 409

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP+ CP+C S + R          A  RCTGGL C AQ  E LKHFVSR A +++G+G +
Sbjct: 410 FPTHCPVCNSDIERVEGE------AVARCTGGLTCGAQLKESLKHFVSRRAMDVDGMGDK 463

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++    +E     +   A ++ L      S  K+  +   G  S   L D++ K +  +
Sbjct: 464 IIEQLVDAE----YVANAAQLYQL------SAGKLTGLERMGPKSAQKLIDALEKSKQTT 513

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI++LGIR VG   A +LA +Y S                 D  SL  V  +G+++A
Sbjct: 514 LARFIYALGIREVGEATAANLAAHYASLDAVMAA----------DEDSLKTVQDIGEVVA 563

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHK 665
           + +V F++   N   +  LL   +      +      + S    K +V TG++  + R  
Sbjct: 564 KHVVHFFREEHNRQVIHDLLTIANIHWPEVKVINSAEIDSPFAGKTVVLTGSMSTLSRDD 623

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A++ +  LGA V+  +S+KTD++I G+  GSKL KA +LG+K+++EE+ + LL 
Sbjct: 624 AKDKLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKATELGIKVIDEEELIRLLN 677


>gi|168261543|ref|ZP_02683516.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205349337|gb|EDZ35968.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 671

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|238912842|ref|ZP_04656679.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 671

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                E L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLERLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIVQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLTKAQELGINVIDEAEMIRLL 669


>gi|224583040|ref|YP_002636838.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|254781413|sp|C0PZB4|DNLJ_SALPC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|224467567|gb|ACN45397.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
          Length = 671

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIVQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|304398312|ref|ZP_07380186.1| DNA ligase, NAD-dependent [Pantoea sp. aB]
 gi|304354178|gb|EFM18551.1| DNA ligase, NAD-dependent [Pantoea sp. aB]
          Length = 672

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 246/712 (34%), Positives = 391/712 (54%), Gaps = 49/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  +  ++ L   + +H+  Y+    P + D+EYD L R    +    PDL     P+ 
Sbjct: 1   MKSVQDHITELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRQLEEEHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G        +V H +P LSL+  ++      F  R+      K+   I +  E K
Sbjct: 58  PTQRVGAAPLTVFEQVRHEVPMLSLDNAFDEATFMAFNKRVQDRL--KNSEDITYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGAAVSLMYENGLLVQAATRGDGTTGENITANVRTIRAIPLRLKGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +++  F  LN+E      K +ANPRNAA+G LR+L+P     R L FF +G G       
Sbjct: 176 MTQRGFEKLNEEARRTDGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  LQ+ +  G PV++ +++ +     +++Y E++  R  L +DIDG+V KVD  +
Sbjct: 236 PHSHMARLQQFKAWGLPVSDRIKRVHNAEEALAFYREIEQQRPNLGFDIDGVVIKVDSQA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW I+ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWAIAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GDRV+++RAG+VIP+VV++++ ER  + +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDRVVIRRAGDVIPQVVNVVIAERPEETREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          +  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PAHCPVCGSEVERVEGE------SVTRCTGGLICGAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ D++ K ++ +L
Sbjct: 459 IDQLVEKE----YVSTPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKSTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   Q               D  +LI VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAANLANHFGELQKVMDA----------DLEALIAVPDVGKVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F +   N   +  L +E+     +      + + S    K +V TG+L ++ R  A
Sbjct: 559 HVRNFMEEESNREVIRQLTEEIGIHWPQVVVVKAEEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 619 KAQLVALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLL 670


>gi|149184723|ref|ZP_01863041.1| DNA ligase [Erythrobacter sp. SD-21]
 gi|148832043|gb|EDL50476.1| DNA ligase [Erythrobacter sp. SD-21]
          Length = 690

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 274/717 (38%), Positives = 404/717 (56%), Gaps = 34/717 (4%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ ++  +A  EL  L + I+ H+  Y+    P I D E+DAL RR   +   FP L R
Sbjct: 6   PVD-MTEAEAANELMRLARAIAKHNKLYHAEDAPEITDQEFDALVRRNAELEEQFPHLVR 64

Query: 68  SEDPNGPLNKIGGEMNLS-LFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
               + P   +G E+  S L KVTH +  +SL+  ++ E++ +++ R+ RF    +   +
Sbjct: 65  E---DSPSKVVGHEIAASPLSKVTHEVRMMSLDNAFSGEEVAEWVARVRRFLSLDESEEV 121

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
             T E KIDG   ++RYEKG+ V AA RGDG  GEDV+  I  I  IP+ LS ++PE+ E
Sbjct: 122 AITAEDKIDGLSCSLRYEKGRLVRAATRGDGQVGEDVTPNIAHIADIPQQLSGDVPEVFE 181

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           +RGEVY++K DF ALN      G K +ANPRNAA+G LR+ + +    R L F+ HG G 
Sbjct: 182 IRGEVYMAKADFSALNAAQEDAGGKLFANPRNAAAGSLRQKDASVTAKRPLRFWAHGWGA 241

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S +    Q E+++++   G PV+    + +    ++++Y ++   R  LPY+IDG+VYK
Sbjct: 242 ASAVPGATQEEVVRQIENWGVPVSPLFTRVHDVEAMLAHYAKIAKERPDLPYEIDGVVYK 301

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD    Q++LG  A++PRW ++HKF  +QA T L  IDIQ+GRTG LTPV RL PV +GG
Sbjct: 302 VDRLDYQQRLGFVAKAPRWALAHKFPAEQAETTLEAIDIQVGRTGKLTPVGRLAPVLVGG 361

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
             +TN TLHN D I  L            +R GDRV+V+RAG+VIP++  +    R    
Sbjct: 362 VTVTNVTLHNRDEIARL-----------GVRPGDRVVVQRAGDVIPQL--VDNLTRETSR 408

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           +PF+FP  CP C S  V +            RCTGGL C AQ+ ERLKHFVSR A +I+G
Sbjct: 409 EPFAFPDHCPECGSEAVAEEGE------VDVRCTGGLICPAQRTERLKHFVSRGALDIDG 462

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG++ +D FF        +  PADIF L +R+      I  + G+ + SV  L DSI  R
Sbjct: 463 LGEKTIDQFF----ALGWLESPADIFHLHQRRD----AILALEGWQERSVDKLVDSIEAR 514

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R     R +F LGIRHVGA  AR L K++       +      A + +   SL  +  +G
Sbjct: 515 RAPDAARLLFGLGIRHVGAVTARDLMKHFHELPALREAAEAAHAGDEEAAASLTSIDGIG 574

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
             + +A+ +F+    N    + ++ EV+P     E    S +  K +VFTG L+ + R +
Sbjct: 575 GAVVEALGDFFHEDHNKAVWDDIISEVTPPPYIVE-TKESPVSGKTVVFTGKLETMSRDE 633

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           A+    +LGA  S  +S KTD+++ G   GSKL+KA  LG+K+++E  +  ++ +  
Sbjct: 634 AKAQAERLGAKASGSVSAKTDLLVAGPGAGSKLKKAADLGIKVIDEAGWAKIVAEAG 690


>gi|328473436|gb|EGF44284.1| NAD-dependent DNA ligase LigA [Vibrio parahaemolyticus 10329]
          Length = 670

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 251/713 (35%), Positives = 392/713 (54%), Gaps = 48/713 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL      
Sbjct: 1   MS-ESVHQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTV--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+      +VTH +P LSL+  ++  +L  F  R       +      +  E
Sbjct: 57  DSPSQRVGGKPLSEFSQVTHEVPMLSLDNAFDDSELDSFHKRAQDRIGGESIKQ--YCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  +  P  +EVRGE
Sbjct: 115 PKLDGLAVSLLYENGILVQAATRGDGTTGENITENVRTINAIPLKLRGDDWPARLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G     
Sbjct: 175 VFMPKAGFEKLNELARQKGEKVFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQGA 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             A   YE   +++  G P+    ++ ++   + +YY ++   R  LPY+IDG+V K+D+
Sbjct: 235 DLAASHYERFLQIKSWGLPMCQETKRVDSLADVKTYYQDILQRRDALPYEIDGVVIKIDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            ++Q +LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IAVQDRLGFVARAPRWAIAYKFPAQEEITTLNEVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            +++GD+V+++RAG+VIP+VV +I   R   A+  
Sbjct: 355 SNATLHNADEIERLQ-----------VKIGDQVVIRRAGDVIPQVVSVIKERRPETARDI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S V R          A  RCTGGL C AQ+ + LKHFVSR A +++GLG 
Sbjct: 404 IFPTQCPVCGSHVERIEGE------AVTRCTGGLVCQAQRKQALKHFVSRKALDVDGLGD 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   +  +   G  S  N+ +++ K +  
Sbjct: 458 KVIEQLVDRE----MVETPADLFKL------SAGVLTVLERMGPKSAQNIVNALEKSKLT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA+++ S +                   LI V  +G ++
Sbjct: 508 TLPRFLYSLGIREVGEATAANLAQHFKSLEAIQAATE----------EQLIAVQDIGVVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A+ I  F++  +N   V+ LL +    P +   E+     +E K +V TGTL ++ R +A
Sbjct: 558 AKHITTFFEEEQNQAVVQDLLVQGIHWPEVSAPEQGAELPLEGKTVVLTGTLSQLGRTEA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 618 KEALQSLGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELIN 670


>gi|28897574|ref|NP_797179.1| NAD-dependent DNA ligase LigA [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260878266|ref|ZP_05890621.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AN-5034]
 gi|260895418|ref|ZP_05903914.1| DNA ligase (NAD+) [Vibrio parahaemolyticus Peru-466]
 gi|260903353|ref|ZP_05911748.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AQ4037]
 gi|81728289|sp|Q87RJ4|DNLJ_VIBPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|28805786|dbj|BAC59063.1| DNA ligase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088617|gb|EFO38312.1| DNA ligase (NAD+) [Vibrio parahaemolyticus Peru-466]
 gi|308090169|gb|EFO39864.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AN-5034]
 gi|308107994|gb|EFO45534.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AQ4037]
          Length = 670

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 251/713 (35%), Positives = 392/713 (54%), Gaps = 48/713 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL      
Sbjct: 1   MS-ESVHQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTV--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+      +VTH +P LSL+  ++  +L  F  R       +      +  E
Sbjct: 57  DSPSQRVGGKPLSEFSQVTHEVPMLSLDNAFDDSELDSFHKRAQDRIGGESIKQ--YCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  +  P  +EVRGE
Sbjct: 115 PKLDGLAVSLLYENGILVQAATRGDGTTGENITENVRTINAIPLKLRGDDWPARLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G     
Sbjct: 175 VFMPKAGFEKLNELARQKGEKVFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQGA 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             A   YE   +++  G P+    ++ ++   + +YY  +   R  LPY+IDG+V K+D+
Sbjct: 235 DLAASHYERFLQIKSWGLPMCPETKRVDSLADVKTYYQHILQRRDALPYEIDGVVIKIDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            ++Q++LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IAVQERLGFVARAPRWAIAYKFPAQEEITTLNEVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            +++GD+V+++RAG+VIP+VV +I   R   A+  
Sbjct: 355 SNATLHNADEIERLQ-----------VKIGDQVVIRRAGDVIPQVVSVIKERRPETARDI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S V R          A  RCTGGL C AQ+ + LKHFVSR A +++GLG 
Sbjct: 404 IFPTQCPVCGSHVERIEGE------AVTRCTGGLVCQAQRKQALKHFVSRKALDVDGLGD 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   +  +   G  S  N+ +++ K +  
Sbjct: 458 KVIEQLVDRE----MVETPADLFKL------SAGVLTVLERMGPKSAQNIVNALEKSKLT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA+++ S +                   LI V  +G ++
Sbjct: 508 TLPRFLYSLGIREVGEATAANLAQHFKSLEAIQAATE----------EQLIAVQDIGVVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A+ I  F++  +N   V+ LL +    P +   E+     +E K +V TGTL ++ R +A
Sbjct: 558 AKHITTFFEEEQNQAVVQDLLVQGIHWPEVSAPEQGAELPLEGKTVVLTGTLSQLGRTEA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 618 KEALQSLGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELIN 670


>gi|56412686|ref|YP_149761.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361620|ref|YP_002141256.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81362021|sp|Q5PNE2|DNLJ_SALPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781414|sp|B5BB72|DNLJ_SALPK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56126943|gb|AAV76449.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197093096|emb|CAR58535.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
          Length = 671

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIVQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGINVIDEAEMIRLL 669


>gi|168231967|ref|ZP_02657025.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194471791|ref|ZP_03077775.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194458155|gb|EDX46994.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333574|gb|EDZ20338.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 671

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/712 (34%), Positives = 392/712 (55%), Gaps = 48/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL 
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGINVIDEAEMIRLLD 670


>gi|291618312|ref|YP_003521054.1| LigA [Pantoea ananatis LMG 20103]
 gi|291153342|gb|ADD77926.1| LigA [Pantoea ananatis LMG 20103]
          Length = 672

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 251/712 (35%), Positives = 403/712 (56%), Gaps = 49/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++ ++ L   + +H+  Y+    P + D+EYD L R    +    PDL     P+ 
Sbjct: 1   MKSVQEHITELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEEQHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G    +   +V H +P LSL+  ++    R F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLMVFEQVRHEVPMLSLDNAFDEASFRAFNKRVQDRLKSSDD--LVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G    AA RGDG +GE++++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLTRAATRGDGTTGENITSNVRTIRAIPLRLKGENIPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +++N F  LN E      K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MTQNGFEKLNAEARRTEGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGIGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     LQ+ +  G PV++ +R  +     +++Y+E+ + R+ L +DIDG+V KVD   
Sbjct: 236 PRSHMARLQQFKAWGLPVSDRIRLVHNVDEALAFYHEVDAQRAELGFDIDGVVIKVDSQD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  AR+PRW ++ KFA ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEKLGFVARAPRWAVAFKFAAQEQMTIVRDVEFQVGRTGAITPVARLEPVQVAGVMVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++V+ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVVSERPEDAREILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PSHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRAMDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L R   T       +   G  S  N+ D++ K ++ +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRLTRETLTG------LDRMGAKSAQNVVDALEKAKSTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   Q               D  +LI V  VG ++A+
Sbjct: 509 ARFLYALGIREVGEATAANLANHFGELQKVMDA----------DLDALIAVQDVGTVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPS----IGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F +   N   +  L++++  +    +    + + S    K +V TG+L ++ R  A
Sbjct: 559 HVRHFMEEESNRDVIRQLVEDIGINWPQVMVVKAEEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +T+LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 619 KARLTELGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLL 670


>gi|301155433|emb|CBW14899.1| DNA ligase, NAD(+)-dependent [Haemophilus parainfluenzae T3T1]
          Length = 667

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 254/705 (36%), Positives = 402/705 (57%), Gaps = 45/705 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++++ +L Q++  ++  Y+    P I D+EYD L  +  A+  A P+L  +   + P  +
Sbjct: 4   QQQIDTLRQDLRRYEYEYHVLDNPTIPDAEYDRLFHQLKALEAAHPELITA---DSPTQR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +G +      ++ H IP LSL+  ++ E+   F+ RI     +  D  + F  EPK+DG 
Sbjct: 61  VGAKPLSGFAQIRHEIPMLSLDNAFSDEEFYAFVKRIEDRLIRLPD-PLTFCCEPKLDGL 119

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISKN 196
            ++I Y  G    AA RGDG +GED++A IR I  IP  L   N P  +EVRGEV++   
Sbjct: 120 AVSILYVNGVLTQAATRGDGTTGEDITANIRTIRNIPLQLLMDNPPARLEVRGEVFMPHE 179

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLGKTSEIF-AKGQ 254
            F  LN + +  G K +ANPRNAA+G LR+L+P   ++       +G+G    +      
Sbjct: 180 GFERLNQQALEKGEKTFANPRNAAAGSLRQLDPKITSKRPLVLNAYGIGIAEGVDLPNTH 239

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
           Y+ LQ ++ +G PVN  +R  N    ++ +Y ++++ RS+L YDIDG V K+++ +LQ++
Sbjct: 240 YDRLQWLKSIGIPVNPEIRLCNGTDEVLDFYRDIQNKRSSLGYDIDGTVLKINDIALQEK 299

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG  +++PRW I++KF  ++  TRL D++ Q+GRTG +TPVA+LEPV + G  ++NATLH
Sbjct: 300 LGFISKAPRWAIAYKFPAQEELTRLNDVEFQVGRTGAITPVAKLEPVFVAGVTVSNATLH 359

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           N D I+ L           DI +GD V+++RAG+VIP+++ ++ + R  DA+P  FP  C
Sbjct: 360 NGDEIERL-----------DIAIGDMVVIRRAGDVIPQIIGVLHDRRPADARPIVFPETC 408

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P+C S +VR          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++  
Sbjct: 409 PVCDSAIVRIEGE------AVARCTGGLFCAAQRKEALKHFVSRKAMDIDGVGGKLIEQL 462

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
              E     I  PAD+F L        T +  +   G  S  N   S+ K +N +L RF+
Sbjct: 463 VDRE----LIHTPADLFKL------DLTALTRLERMGTKSAENALASLEKAKNTTLARFV 512

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F+LGIR VG   A +LA ++ + +               D  +L +VP VG+++A  I+ 
Sbjct: 513 FALGIREVGEATALNLANHFKTLEALQNA----------DLEALQQVPDVGEVVANRILA 562

Query: 615 FYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
           F+  P N+  V  L+ +         ++ + +  + K +V TGTL ++ R++A+  +  +
Sbjct: 563 FWHEPHNVAVVNDLIAQGVHWETVEAKEVIENRFKGKTVVLTGTLTQMGRNEAKALLQDM 622

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           GA VS  +S KTD +I GD  GSKL KAQ+LGV ++ EE+FL  +
Sbjct: 623 GAKVSGSVSAKTDFVIAGDAAGSKLTKAQELGVTVLTEEEFLAQI 667


>gi|327394702|dbj|BAK12124.1| DNA ligase LigA [Pantoea ananatis AJ13355]
          Length = 672

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 251/712 (35%), Positives = 403/712 (56%), Gaps = 49/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++ ++ L   + +H+  Y+    P + D+EYD L R    +    PDL     P+ 
Sbjct: 1   MKSVQEHITELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRELEEQHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G    +   +V H +P LSL+  ++    R F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLMVFEQVRHEVPMLSLDNAFDEASFRAFNKRVQDRLKSSDD--LVYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G    AA RGDG +GE++++ +R I  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLTRAATRGDGTTGENITSNVRTIRAIPLRLKGENIPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +++N F  LN E      K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MTQNGFEKLNAEARRTEGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGIGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     LQ+ +  G PV++ +R  +     +++Y+E+ + R+ L +DIDG+V KVD   
Sbjct: 236 PRSHMARLQQFKAWGLPVSDRIRLVHNVDEALAFYHEVDAQRAELGFDIDGVVIKVDSQD 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  AR+PRW ++ KFA ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEKLGFVARAPRWAVAFKFAAQEQMTVVRDVEFQVGRTGAITPVARLEPVQVAGVMVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++V+ER  DA+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVVSERPEDAREILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PSHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRAMDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L R   T       +   G  S  N+ D++ K ++ +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRLTRETLTG------LDRMGAKSAQNVVDALEKAKSTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   Q               D  +LI V  VG ++A+
Sbjct: 509 ARFLYALGIREVGEATAANLANHFGELQKVMDA----------DLDALIAVQDVGTVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPS----IGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F +   N   +  L++++  +    +    + + S    K +V TG+L ++ R  A
Sbjct: 559 HVRHFMEEESNRDVIRQLVEDIGINWPQVMVVKAEEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +T+LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL
Sbjct: 619 KARLTELGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLL 670


>gi|194289797|ref|YP_002005704.1| DNA ligase [Cupriavidus taiwanensis LMG 19424]
 gi|254781303|sp|B3R2C2|DNLJ_CUPTR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193223632|emb|CAQ69639.1| DNA ligase [Cupriavidus taiwanensis LMG 19424]
          Length = 709

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 252/709 (35%), Positives = 378/709 (53%), Gaps = 54/709 (7%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
            ++ L +E+  H+  YY    P + D+EYDAL     A+    P+L   + P+ P  ++G
Sbjct: 27  RVAWLREELDRHNYQYYVLDAPTVPDAEYDALFSELMALELEHPEL---QTPDSPTQRVG 83

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD-----------NSIFF 128
           GE   +   V H +P LSL   +  ED+  F  R  +   +              +++ +
Sbjct: 84  GEPLSAFDSVRHRVPMLSLNNAFADEDVLNFDRRCAQGLGRTAPAAGEADLFSAADAVEY 143

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVR 188
             E K DG  +++RYE G+ V AA RGDG +GEDV+  +R I  IP  L    P ++EVR
Sbjct: 144 ACELKFDGLAMSLRYEDGRLVQAATRGDGETGEDVTVNVRTIKAIPLKLRGQAPAVLEVR 203

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEV++ + DF  LN      G K + NPRNAA+G LR+L+P     R L+FF +GLG+  
Sbjct: 204 GEVFMFRRDFDKLNARQAEAGEKTFVNPRNAAAGSLRQLDPRITARRPLSFFAYGLGELQ 263

Query: 248 -EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
                     ML     LG PV           G++ +Y ++   R  LPYDIDG+VYKV
Sbjct: 264 GVERPPTHSAMLDGFAALGLPVCKDRAVVKGAQGLLDFYRDIGKRRDDLPYDIDGVVYKV 323

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +  + Q++LG  +R+PR+ ++HKF  ++ +T + DI++Q+GRTG +TPVARL PV +GG 
Sbjct: 324 NALAEQERLGFVSRAPRFALAHKFPAQEMTTVVEDIEVQVGRTGAITPVARLRPVFVGGV 383

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            +TNATLHNED I+            +D+ VGD V+V+RAG+VIP+VV ++   R  DA+
Sbjct: 384 TVTNATLHNEDEIRR-----------KDVHVGDTVIVRRAGDVIPEVVAVVAERRPADAR 432

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
            F  P+ CP+C S + +  +       A  RCTGGL C+AQ+ + L HF  R A +IEGL
Sbjct: 433 AFVMPTACPVCGSHIEKLEDE------AIARCTGGLICAAQRKQSLLHFAQRRAMDIEGL 486

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + ++           +R PAD++ L         K+  +    D S  NL  +I+K R
Sbjct: 487 GDRLVEQLVDQ----GIVRTPADLYKL------GVAKLAALERMADKSAANLVAAIDKSR 536

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
             ++ RFIF+LGIRHVG   A+ LA+++                   D  +L+ V  VG 
Sbjct: 537 ATTMNRFIFALGIRHVGEATAKDLARHFGKLDALMAA----------DEAALLEVNDVGP 586

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           ++AQ+I  F+  P N+  +E L                 + +  K  V TGTL  + R  
Sbjct: 587 VVAQSIAHFFAEPHNVEVIEQLRAAGVHWPESEPVAKSPAPLSGKTFVLTGTLPTLSRED 646

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQF 714
           A+E +   GA V+  +S+KTD ++ G   GSKL+KA+ LGV +++E   
Sbjct: 647 AKELLEAAGAKVAGSVSKKTDYVVAGAEAGSKLDKAEALGVPVLDEAGM 695


>gi|168243193|ref|ZP_02668125.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449589|ref|YP_002046491.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|254781411|sp|B4TCF6|DNLJ_SALHS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194407893|gb|ACF68112.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205337689|gb|EDZ24453.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 671

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQTAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|194444893|ref|YP_002041687.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|254781412|sp|B4SZU5|DNLJ_SALNS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194403556|gb|ACF63778.1| DNA ligase [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 671

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGINVIDEAEMIRLL 669


>gi|255264005|ref|ZP_05343347.1| DNA ligase, NAD-dependent [Thalassiobium sp. R2A62]
 gi|255106340|gb|EET49014.1| DNA ligase, NAD-dependent [Thalassiobium sp. R2A62]
          Length = 711

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 291/715 (40%), Positives = 427/715 (59%), Gaps = 18/715 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I ++ L+   A  EL+ L   +   +D Y+    P + D+EYDALKRR  AI   FPDL 
Sbjct: 13  IDVDDLTRTAATDELTWLSYVLGQANDDYHGSDAPQMSDAEYDALKRRNMAIEARFPDLK 72

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R    + P +++G        K+TH +  LSL   +  ED+ +F  R+ ++   +D  ++
Sbjct: 73  RG---DSPSDQVGAAPIDGFGKITHVVRMLSLGNAFTDEDVVEFDRRVRKYLGLED--AL 127

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  + AA RGDG  GEDV+A  R +  IP+ L    P+++E
Sbjct: 128 AYTAEPKIDGLSLSLRYEGGVLIQAATRGDGAVGEDVTANARMVQDIPQTLKNA-PDVLE 186

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF  LN    A G K +ANPRNAA+G LR+LN      R L FF +  G 
Sbjct: 187 VRGEVYMSHADFEDLNTRQEARGAKSFANPRNAAAGSLRQLNAEITKDRPLRFFAYASGD 246

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q   ++++  LGF  N   +  +    ++++Y  ++  R+TL YDIDG+VYK
Sbjct: 247 LSAPLADTQNAAIERLAALGFSTNPLTQLCDDPEAMIAHYRRIEEQRATLGYDIDGVVYK 306

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V++  LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL+PV +GG
Sbjct: 307 VNDLGLQRRLGFRSTTPRWAIAHKFPAELAWTTLEAIDIQVGRTGALSPVARLKPVTVGG 366

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYIKGLD+ G  +R GRDI VGD V + RAG+VIPK+ D+ + +R   A
Sbjct: 367 VVVSNATLHNEDYIKGLDSKGAPIREGRDIWVGDWVQIYRAGDVIPKICDVDLAKRLATA 426

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
           Q + FP  CP C S  VR+         A  RC GG+ C AQ +E+LKHFVSR  F+I+G
Sbjct: 427 QAYEFPETCPECGSHAVREEG------DAVRRCVGGMICPAQAVEKLKHFVSRGGFDIDG 480

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F         ++ PADIFTL+ R  +   +++N  G+GD S +NL+D+I+ +
Sbjct: 481 LGAKQVEQFHSDA----WVKEPADIFTLRDRFGSGLQQLKNREGWGDKSASNLFDAIDDK 536

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I L R IF+LGIRHVG   A  +A  Y ++  F   +   +    D W +LI +  VG
Sbjct: 537 RRIGLGRLIFALGIRHVGDASANLIANRYGTWSAFEGAMTAAVIGEGDAWETLIDIDGVG 596

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++A ++V   Q      +++ L+  +       +    S +  K +VFTG+L+K+ R +
Sbjct: 597 AVMAGSLVRAMQEEAERASIDRLVAHLDVQ-EAVQVTSDSPVAGKTVVFTGSLEKMTRAE 655

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           A+     LGA VS  +S KTD+++ G   GSK +KA  LGV+ ++E+ +L L+  
Sbjct: 656 AKARAESLGAKVSGSVSAKTDLLVAGPGAGSKAKKAADLGVETIDEDDWLALIGD 710


>gi|207857840|ref|YP_002244491.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|254781409|sp|B5R3V4|DNLJ_SALEP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206709643|emb|CAR33993.1| DNA ligase [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
          Length = 671

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQTAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + V S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEVDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|120554094|ref|YP_958445.1| DNA ligase, NAD-dependent [Marinobacter aquaeolei VT8]
 gi|166215819|sp|A1TZT9|DNLJ_MARAV RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120323943|gb|ABM18258.1| DNA ligase, NAD-dependent [Marinobacter aquaeolei VT8]
          Length = 678

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 252/720 (35%), Positives = 393/720 (54%), Gaps = 48/720 (6%)

Query: 12  LS--IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSE 69
           ++   E  RK + SL   +  H+  YY    P I D+EYD L R    +    P+LA   
Sbjct: 1   MTNVPETIRKRVDSLRATLEDHNYYYYVQDDPRIPDAEYDRLFRELQKLEAEHPELA--- 57

Query: 70  DPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFT 129
             + P  ++G     S  +V H +P LSL+  ++ ++LR F  R+        D +I + 
Sbjct: 58  TEDSPTRRVGSSAETSFEEVIHRLPMLSLDNAFSEDELRDFDRRVRDRLG--ADGAIEYV 115

Query: 130 LEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVR 188
            EPK+DG  +++ YE G    AA RGDG++GED++A IR IP++P  L  +  P+++EVR
Sbjct: 116 CEPKLDGLAVSLHYENGTLTRAATRGDGYTGEDITANIRTIPSVPLKLRGSGYPDLVEVR 175

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GEVY+ +  F  LN+ +   G K + NPRNAA+G LR+   T    R L    + +  T 
Sbjct: 176 GEVYMPRAGFEKLNERLAEQGEKTFVNPRNAAAGSLRQKKSTVTARRPLELCAYSMAVTD 235

Query: 248 EIF-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           E    +  ++ LQ +R  GF +N  +R+A      +  YNE+ + R +LPY+IDG+V+KV
Sbjct: 236 ESVLPETHWDSLQLVRDWGFRINPEMRKAEGVEACLDAYNELMAKRDSLPYEIDGIVFKV 295

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           +   LQ++LG  +R+PRW I+HKF  ++  T + D++ Q+GRTG +TPVARL+PV +GG 
Sbjct: 296 NRLDLQQELGFVSRAPRWAIAHKFPAQEELTIIEDVEFQVGRTGAVTPVARLKPVFVGGV 355

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
            ++NATLHN D I+ L           D+ +GD V ++RAG+VIP+VV ++  +R  +A 
Sbjct: 356 TVSNATLHNMDEIRRL-----------DVHIGDTVFIRRAGDVIPQVVKVVPEKRPAEAP 404

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
               P  CP+C S +V+          A  RC+GGL C AQ+ E ++H+ SR A +IEGL
Sbjct: 405 MVEMPEHCPVCGSDIVQIEGE------AVARCSGGLYCPAQRKEAIRHYASRKAMDIEGL 458

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G + ++           +   AD++ L + Q  S      +   GD S  NL  +I++ R
Sbjct: 459 GDRLIEVLVDE----GMVSTVADLYRLTKFQIAS------LERMGDKSAANLIAAIDRSR 508

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
              L RF+++LGIR VG   A+ LA ++ + +  +            D  +L  VP VG 
Sbjct: 509 EPVLWRFLYALGIREVGEATAKGLAAHFGTLEAISAA----------DEETLQTVPDVGP 558

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVS-SEIENKKLVFTGTLQKIQRHK 665
           I+A  I  F+  P N   + AL +           +     +  +  V TGTL  + R +
Sbjct: 559 IVAGHIRSFFDQPHNQETLAALKEAGVTWQEEQVLSADEQPLNGQTWVLTGTLSGMTRDQ 618

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNTTL 725
           A+E + QLGA V+  +S+KT  ++ G+  GSKL KA+QLGV +++EE    LL+++   +
Sbjct: 619 AKEKLEQLGAKVAGSVSKKTACVVAGEAAGSKLAKAEQLGVPVLDEEGLANLLREHGIEV 678


>gi|254440003|ref|ZP_05053497.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
 gi|198255449|gb|EDY79763.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
          Length = 706

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 294/712 (41%), Positives = 432/712 (60%), Gaps = 15/712 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
             IE L+ ++A +EL+ L   ++  +  Y+Q   P I D++YDALK R   I   F DL 
Sbjct: 5   TSIENLTKDEAAQELARLSALLAQANAEYHQADAPRIPDADYDALKLRNAMIEARFSDLK 64

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R    + P   +G        KV H++  LSL   +  +D+ +F   + +F    +   +
Sbjct: 65  RR---DSPSETVGATPADGFGKVPHALRMLSLGNAFTDDDVTEFDKSVRKFLGL-ETGDL 120

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            FT EPKIDG  +++RYE GK V AA RGDG  GE+V+A  R I  +P+VL    P+I+E
Sbjct: 121 AFTAEPKIDGLSLSLRYENGKLVQAATRGDGAVGENVTANARTIKDVPQVLLDA-PKILE 179

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S +DF ALN     VG K +ANPRNAA+G LR+L+ +   +R L FF +  G+
Sbjct: 180 VRGEVYMSHSDFAALNTRQSNVGSKTFANPRNAAAGSLRQLDASITKSRPLKFFAYAWGE 239

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q   + +++ LGF  N   +   +   ++++Y +++  R+TL YDIDG+VYK
Sbjct: 240 VSAPLADTQSGAIARLKTLGFQTNPLTKICASPSEMIAHYRDIEMQRATLGYDIDGVVYK 299

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+ SLQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 300 VDDLSLQRRLGFRSTTPRWAIAHKFPAELAWTTLDAIDIQVGRTGALSPVARLSPVTVGG 359

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            ++ NATLHNEDYI G    G  +RGG+DIRVGD V + RAG+VIPKV D+ +++R  + 
Sbjct: 360 VVVANATLHNEDYIAGRGNKGDDIRGGKDIRVGDWVQIYRAGDVIPKVADVDLSKRLGET 419

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            PF FP+ CP C S  VR+            RCTGGL C AQ +E+LKHFVSR AF+I+G
Sbjct: 420 APFDFPTTCPKCGSDAVREEG------DVVRRCTGGLICPAQAVEKLKHFVSRAAFDIDG 473

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F+   D   +++ PADIFTL  R   S TK+ N  G+GD SV  L+ +++++
Sbjct: 474 LGAKQIEAFYN--DDQLAVKEPADIFTLGARDMGSLTKLANRDGWGDTSVKKLWQAVDEK 531

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I + R IF+LGIRHVG   +  LA +Y ++  F   +          W  L+ +  VG
Sbjct: 532 REIPVARLIFALGIRHVGENASNLLAIHYGTWSTFEDAMTQASVGEGAGWDDLLGIDGVG 591

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++A ++V  +       +++ L+ ++ P      ++ +S +  K +VFTG+L+K+ R +
Sbjct: 592 AVMAASVVTTFHQSAERASIDRLVAQLRPQDSARPRS-NSPVAGKTVVFTGSLEKMTRAE 650

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           A+     LGA VS  +S KTD++I G   GSK +KA  LG++ M+E+ +L L
Sbjct: 651 AKARAESLGAKVSGSVSAKTDLLIAGPGAGSKAKKATDLGIETMDEDGWLAL 702


>gi|20807100|ref|NP_622271.1| NAD-dependent DNA ligase [Thermoanaerobacter tengcongensis MB4]
 gi|81482513|sp|Q8RC42|DNLJ_THETN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|20515592|gb|AAM23875.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Thermoanaerobacter tengcongensis MB4]
          Length = 666

 Score =  579 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 249/709 (35%), Positives = 383/709 (54%), Gaps = 49/709 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  E+ARK +  L ++I+YH+  YY   +P I D EYD L R    +   +P+      P
Sbjct: 1   MDREEARKRIEELREKINYHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFK---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE        TH +P LSL   +  E++++F  R+           + + +E
Sbjct: 58  DSPSQRVGGEPLDEFEPFTHIVPMLSLANAFTAEEIKEFDRRVKEAVG-----EVEYVVE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
           PKIDG  + + YE G F   + RGDG  GE+V+  ++ I +IP  L  ++   + VRGEV
Sbjct: 113 PKIDGLSVELVYENGMFTVGSTRGDGIVGENVTPNLKTIKSIPLRLKDSVN--LVVRGEV 170

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIF 250
           ++ K  F  LN+E    G   +ANPRNAA+G +R+L+P     R L+ F+  L +     
Sbjct: 171 FMPKASFAKLNEERAERGESLFANPRNAAAGSVRQLDPKVTAKRDLDIFIFNLQRIEGRD 230

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            K   E L+ ++  GF V   +++  T   ++    E+  ++ +LPYDIDG V KV+E  
Sbjct: 231 FKTHVEALEFLKEQGFKVIPLIKKCTTIEEVIKAIEELGEMKDSLPYDIDGAVIKVNELD 290

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            ++ LG+ A+  RW I+ K+  +   T+++DI +Q+GRTG LTP A LEPV I G++++ 
Sbjct: 291 KREILGQTAKDYRWAIAFKYPAEMKKTKIVDIVVQVGRTGALTPTAVLEPVVISGSVVSR 350

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNEDYIK            +DIR+GD VLV +AG +IP+VV+++  ER  D + F  
Sbjct: 351 ATLHNEDYIK-----------EKDIRIGDTVLVHKAGGIIPEVVEVVKEERTGDEKAFVM 399

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP C +  VR          A  RCTG L C AQ   R+ HF S+DA +IEGLG   
Sbjct: 400 PDKCPECGALAVRLPGE------AVRRCTG-LNCPAQIARRIIHFASKDAMDIEGLGPAI 452

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +            I+  AD++ L+ R   +      +   GD S  NL ++I K +   L
Sbjct: 453 ISQLLSK----GLIQNVADLYYLKYRDLIT------LERMGDKSARNLLEAIEKSKKRDL 502

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
           +R +F LGI  +G++ A+ +A+++ S  N  +            +   + +P +G  +A+
Sbjct: 503 DRLLFGLGINLIGSKAAQVIAEHFKSMDNIMKA----------KYEDFLELPDIGPKMAR 552

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +IV F+   +N   VE L +            VS+  E K  V TG L+   R +A   +
Sbjct: 553 SIVTFFSEEQNRRVVERLKEAGVNMEKLSTGKVSNIFEGKIFVLTGALKNYTRDEAARLI 612

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G  V+  +S+KTD +IVG +PGSKL+KAQ+LGVKI+NEEQF  +L+
Sbjct: 613 VERGGKVTNSVSKKTDYLIVGADPGSKLKKAQELGVKIINEEQFEAMLK 661


>gi|205353534|ref|YP_002227335.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|254781410|sp|B5RCP9|DNLJ_SALG2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|205273315|emb|CAR38285.1| DNA ligase [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326628629|gb|EGE34972.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 671

 Score =  579 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIEQL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQTAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|16761347|ref|NP_456964.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|81513487|sp|Q8Z4W4|DNLJ_SALTI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|25294013|pir||AI0809 DNA ligase (NAD) (EC 6.5.1.2) - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503646|emb|CAD07659.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhi]
          Length = 671

 Score =  579 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P ILD+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQTGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINAQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|167549563|ref|ZP_02343322.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205325268|gb|EDZ13107.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 671

 Score =  578 bits (1490), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 392/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLETLQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGINVIDEAEMIRLL 669


>gi|322613832|gb|EFY10771.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617441|gb|EFY14340.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624929|gb|EFY21758.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629628|gb|EFY26404.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633942|gb|EFY30679.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635621|gb|EFY32332.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639981|gb|EFY36651.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644326|gb|EFY40867.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322655311|gb|EFY51620.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658357|gb|EFY54623.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664357|gb|EFY60554.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668412|gb|EFY64568.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673252|gb|EFY69358.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676644|gb|EFY72712.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683394|gb|EFY79408.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685720|gb|EFY81713.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192602|gb|EFZ77831.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196835|gb|EFZ81978.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202141|gb|EFZ87199.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208024|gb|EFZ92969.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212850|gb|EFZ97659.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217119|gb|EGA01841.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219619|gb|EGA04102.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323229192|gb|EGA13316.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235493|gb|EGA19577.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237321|gb|EGA21384.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245552|gb|EGA29550.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248968|gb|EGA32891.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253065|gb|EGA36897.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255865|gb|EGA39610.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261411|gb|EGA44996.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266454|gb|EGA49942.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269716|gb|EGA53166.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 671

 Score =  578 bits (1490), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 393/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H IP LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEIPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  +GA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVAVGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|29140957|ref|NP_804299.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213160907|ref|ZP_03346617.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424270|ref|ZP_03357114.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213583650|ref|ZP_03365476.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213650852|ref|ZP_03380905.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|29136582|gb|AAO68148.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
          Length = 671

 Score =  578 bits (1490), Expect = e-163,   Method: Composition-based stats.
 Identities = 244/711 (34%), Positives = 394/711 (55%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P ILD+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y+ ++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQAAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINAQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|206560458|ref|YP_002231222.1| DNA ligase [Burkholderia cenocepacia J2315]
 gi|254781275|sp|B4ECN6|DNLJ_BURCJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|198036499|emb|CAR52396.1| DNA ligase [Burkholderia cenocepacia J2315]
          Length = 691

 Score =  578 bits (1490), Expect = e-162,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 384/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFRELQQLETDHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE       V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEAAGGFTPVVHDAPMLSLNNGFADEDIVAFDKRVADALAKATDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYENGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGKHVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+      R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDSKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L      G PVN      +   G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHTALLDWYEAFGLPVNRERAVVHGAEGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|149915267|ref|ZP_01903795.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
 gi|149810988|gb|EDM70827.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
          Length = 720

 Score =  578 bits (1490), Expect = e-162,   Method: Composition-based stats.
 Identities = 304/716 (42%), Positives = 440/716 (61%), Gaps = 16/716 (2%)

Query: 8   PIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLAR 67
           P++ LS +QA +EL+ L   ++  D  Y+    PI+ D+ YDAL +R  AI   FPDL R
Sbjct: 17  PVDKLSADQAAQELARLADLVAQADAAYHGQDAPIMSDAAYDALVQRNAAIEARFPDLMR 76

Query: 68  SEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIF 127
               + P  ++G   +    KVTH++  LSL   +  +++R+F  RI R+     + ++ 
Sbjct: 77  E---DSPSRRVGFTPSEGFGKVTHAVRMLSLGNAFEDDEIREFDARIRRYLGLSPEAALT 133

Query: 128 FTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIE 186
           +T EPKIDG  +++RYE+G+ V AA RGDG  GE+V+A  R I  IP  L    +PE++E
Sbjct: 134 YTSEPKIDGLSLSLRYEQGRLVQAATRGDGAEGENVTANARTIADIPHDLGGAGVPELLE 193

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK 245
           VRGEVY+S  DF ALN        K +ANPRNAA+G LR+L+P     R L FF +  G 
Sbjct: 194 VRGEVYMSHADFEALNTRQTERSDKTFANPRNAAAGSLRQLDPKITARRPLKFFAYAWGA 253

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            SE  A  Q E + ++   GF  N      +    +++ Y  ++ +R+ L YDIDG+VYK
Sbjct: 254 HSEPLAPSQMEAIARLAGFGFQTNPLTALCDGPDEMLAQYRRIEQLRAELGYDIDGVVYK 313

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           V+E +LQ +LG R+ +PRW I+HKF  + A TRL  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 314 VNEIALQHRLGYRSTTPRWAIAHKFPAELAWTRLEAIDIQVGRTGALSPVARLHPVTVGG 373

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI G DA G  +RGG+DIRVGD V V RAG+VIPKV D+ +++R  D+
Sbjct: 374 VVVSNATLHNEDYIAGRDAKGNKIRGGKDIRVGDWVQVYRAGDVIPKVADVDLSKRPEDS 433

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P++FP  CP C S  +R+         A  RCTGGL C AQ +E+LKHFVSR AF+IEG
Sbjct: 434 APYTFPKVCPECGSDAIREEG------DAVRRCTGGLICPAQAVEKLKHFVSRAAFDIEG 487

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTST-TKIENILGFGDVSVTNLYDSINK 544
           LG +Q++ F         IR PADIFTL+ R      T+++N  G+G+ S  NL+D+I++
Sbjct: 488 LGAKQVEQFHAD----GWIREPADIFTLKDRYGPGCLTQLKNRDGWGEKSAANLFDAIDE 543

Query: 545 RRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLV 604
           RR I+L R +F+LGIRHVG   +  LA++Y ++  F   ++   A    DW  L+ +  V
Sbjct: 544 RRRIALGRLLFALGIRHVGEAASMMLARFYGTWDEFTAAMDGAAAGEGPDWDRLLGIDGV 603

Query: 605 GDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRH 664
           G ++AQ++V  +       +++ L+  +            S +  K +VFTGTL+K+ R 
Sbjct: 604 GKVMAQSLVTTFAQDEERASIDRLVAHLEIERAERPDTDGSPVAGKTVVFTGTLEKMTRA 663

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +A+     LGA VS  +S KTD++I G   GSK + A+QLGV++++E+ +L L+  
Sbjct: 664 EAKARAEALGAKVSGSVSAKTDLVIAGPGAGSKAKAAEQLGVEMIDEDGWLALIGD 719


>gi|197105771|ref|YP_002131148.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
 gi|254781386|sp|B4RFE9|DNLJ_PHEZH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|196479191|gb|ACG78719.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
          Length = 692

 Score =  578 bits (1490), Expect = e-162,   Method: Composition-based stats.
 Identities = 286/712 (40%), Positives = 416/712 (58%), Gaps = 27/712 (3%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           +E+L+  +A +EL+ L  EI+ HD  YY+   P I D+ YDAL+RR D +  AFP L R 
Sbjct: 4   VESLTEAEAAEELTRLADEIAAHDIRYYREDAPTISDAAYDALRRRNDELEAAFPHLIRE 63

Query: 69  EDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFF 128
              N P  +IG         V H +P LSL+  ++  D  +F  R+ RF +   D  + +
Sbjct: 64  ---NSPSLRIGAARAEQFAPVEHGVPMLSLDNAFSDADALEFDARVKRFLRL--DEEVAY 118

Query: 129 TLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEV 187
           T EPKIDG   +IRYE G+ V AA RGDG  GEDV+A +R I  IP+ L     PE+IE+
Sbjct: 119 TAEPKIDGLSCSIRYENGRLVRAATRGDGRVGEDVTANVRTIGEIPQKLHGQAWPEVIEI 178

Query: 188 RGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKT 246
           RGEVY+   +F ALN+   + G+K YANPRNAA+G LR+++P     R L FF +  G  
Sbjct: 179 RGEVYLGHAEFAALNEAAASAGQKTYANPRNAAAGSLRQIDPKITAQRPLRFFAYAWGFV 238

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV 306
           S  FA+ Q+E LQ ++  GF      R      G++  Y EM++ R  L +DIDG+VYKV
Sbjct: 239 SAPFAQTQWEALQALKAWGFRTTPQSRCVKGAEGLMEAYREMEAERPHLGFDIDGVVYKV 298

Query: 307 DEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGA 366
           D    Q++LG  +R+PRW I+ KF  +QA T L  IDIQ+GRTG LTPVARL PV +GG 
Sbjct: 299 DRLEWQQRLGFVSRAPRWGIARKFPAEQARTVLEAIDIQVGRTGALTPVARLTPVTVGGV 358

Query: 367 LITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQ 426
           ++TNATLHN D I  L           D+RVGD V+++RAG+VIP+++ +I  ER  D+ 
Sbjct: 359 VVTNATLHNADEIARL-----------DVRVGDTVVLQRAGDVIPQILRVIPEERPKDSV 407

Query: 427 PFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGL 486
           P+ FP  CP      V      +G      RC+G  AC  Q++  L HFVSR AF+IEGL
Sbjct: 408 PYDFPHVCPCPLRTEVVRETTASGAETVVRRCSGEFACPFQRINHLLHFVSRRAFDIEGL 467

Query: 487 GKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRR 546
           G++QL  FF+       I+ PADIF L  ++     ++  +   G+ SV NL  +I  RR
Sbjct: 468 GEKQLTAFFER----GWIKAPADIFRLHEKRD----ELLAMERMGETSVGNLLANIEARR 519

Query: 547 NISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGD 606
            I L+RFI+ LGIRH+G   A  +A+ Y +  +F + ++ + A + +    L  +  +G 
Sbjct: 520 TIGLDRFIYGLGIRHIGETTATVMARGYGTAAHFLEAMDKVAARDPEAVEELDALDQIGG 579

Query: 607 IIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            + +A   F+    N   VE L  +++       K   + +  K +VFTG L+++ R +A
Sbjct: 580 AVIEAAAAFFGEDHNRAMVEDLAGQLTILDAEKPK-TDTAVAGKTVVFTGALERMTRDEA 638

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +    +LGA VS  +S+KTDI++ G   GSKL+ A +LG++++ E+++L ++
Sbjct: 639 KAQAERLGAKVSGSVSKKTDIVVAGPGAGSKLKTAAELGIQVLTEDEWLEMV 690


>gi|198243638|ref|YP_002216496.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|254781408|sp|B5FQB9|DNLJ_SALDC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197938154|gb|ACH75487.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624250|gb|EGE30595.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 671

 Score =  578 bits (1490), Expect = e-162,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 391/711 (54%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D+EYD L R    +    PDL     P+ 
Sbjct: 1   MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+    +  ++  + +  E K
Sbjct: 58  PTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTEN--VIWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N++    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   ++ +Y  ++  R TL +DIDG+V KV+   
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYRNVEKDRPTLGFDIDGVVIKVNSLV 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +P  F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PTHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVERE----YVHTPADLFRLTA------GKLTGLDRMGPKSAQNVVNALEKAKATTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ + +                   L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLEALQTAT----------IDELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL E       +  + + + S    K +V TG+L ++ R  A+
Sbjct: 559 HVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +  LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLAALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|161831535|ref|YP_001596473.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 331]
 gi|190359249|sp|A9NC33|DNLJ_COXBR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161763402|gb|ABX79044.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 331]
          Length = 670

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 246/709 (34%), Positives = 387/709 (54%), Gaps = 46/709 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
             + +K +  L  EI+ H+  YY  S+P I DS YD L    + +   +P+   +  P+ 
Sbjct: 4   PAKIQKRIERLRHEINDHNYRYYVLSQPTIPDSVYDELFHELEKLEKKYPE---TITPSS 60

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G E       V H IP LSL+ +++ + LR F  RI +    K D    +  EPK
Sbjct: 61  PTQRVGAEPLKVFEPVHHEIPMLSLDNVFDEKGLRAFDKRIRQRL--KLDKPFEYVCEPK 118

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ YE G+ + AA RGDG++GE+V+   R I ++P  L  N  PE++E+RGEV 
Sbjct: 119 MDGVALSLLYENGELIRAATRGDGYTGENVTQNTRTIASVPLQLRGNDYPELVEIRGEVL 178

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFA 251
           + +  F   N E    G K +ANPRNAASG LR+L+P     R L F+ + +G       
Sbjct: 179 MPREGFAKFNREAEKRGDKTFANPRNAASGSLRQLDPRITAKRPLIFYGYLIGLLKGKDF 238

Query: 252 K-GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                ++L+  +  G PV + ++      G + YY  +   R  +P+DIDG+V KV+   
Sbjct: 239 PKNHCDVLKWFKDWGIPVISEIKVVGGIEGCLDYYEHLVKTREKMPFDIDGIVIKVNSLQ 298

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           +Q +LG  +R+PRW I++KF  ++  T +  I+ Q+GRTG +TPVARLEPV++ G  ++N
Sbjct: 299 VQAELGFVSRAPRWAIAYKFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSN 358

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D +             +D+RVGD V+V+RAG+VIP+VV  I+ +R   A+    
Sbjct: 359 ATLHNFDEL-----------YRKDVRVGDTVIVRRAGDVIPEVVGPILAKRPKKAKLIKI 407

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C + V++          A  RC GGL C AQ  E +KHF SR A +IEGLG + 
Sbjct: 408 PSRCPVCHAEVIKPEGE------AVARCVGGLYCRAQLRESIKHFSSRRALDIEGLGDKL 461

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++ F + +     I+    I+ L++      + I  +   G+ S  NL  +I K +  +L
Sbjct: 462 VELFIQEK----LIKDITGIYQLKK------SAITALPRMGEKSAENLLTAIEKSKKTTL 511

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   AR+LA+++       +              +L  +  +G + A+
Sbjct: 512 PRFLYALGIRGVGDTTARTLARHFHELDLLMKA----------SIETLQEIRDIGPVAAE 561

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
            I  F+    N   +  L+  +     + +  V SEI  K  V TG L+ + R +A+E +
Sbjct: 562 NIHAFFHQKNNAELINKLI-HLGVHWPQEKAVVKSEIAGKTFVLTGALKSLTREEAEEKI 620

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
            + G   ++ +S+ TD +IVG+NPGSK EKA+ LG+ +++EE FL LL+
Sbjct: 621 ERSGGKATSSVSKNTDYVIVGENPGSKYEKAKALGISLIDEEAFLKLLK 669


>gi|254489942|ref|ZP_05103137.1| DNA ligase, NAD-dependent [Methylophaga thiooxidans DMS010]
 gi|224465027|gb|EEF81281.1| DNA ligase, NAD-dependent [Methylophaga thiooxydans DMS010]
          Length = 673

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 247/715 (34%), Positives = 391/715 (54%), Gaps = 46/715 (6%)

Query: 12  LSIE-QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           ++I  + ++  ++L + I++++  YY    P + D+EYD L      +    P+L  +  
Sbjct: 1   MTISTEVQQRAATLRELINHYNYLYYVTDNPEVPDAEYDRLFSELQQLEQTHPELLTA-- 58

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
            + P  ++GGE+     ++ H++P LSL+ +++ E L  F  R+  +     D    +  
Sbjct: 59  -DSPTQRVGGEVLDKFAEIEHAMPMLSLDNVFDQEALTAFDKRVRDWLN--TDQPQIYAA 115

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRG 189
           EPK+DG  I+IRYE+G  V AA RGDG+ GEDV+A +R I ++P  LS +  P I+EVRG
Sbjct: 116 EPKLDGLAISIRYEQGVLVQAATRGDGNYGEDVTANVRTIKSVPLKLSGDNIPAIVEVRG 175

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE 248
           E+++ K+ F  LN   +   +K + NPRNAA+G LR+L+     TR L  + +G+G    
Sbjct: 176 EIFMPKDGFERLNQSQLDNNKKVFVNPRNAAAGSLRQLDSKITATRPLEIYCYGIGYIEG 235

Query: 249 I-FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
                   E +  +   G  ++  +++         Y  ++   R +L YDIDG+V KVD
Sbjct: 236 AARPASHTEAMSMIANWGCRISPELKKLEGLEACHRYIEQLGERRDSLAYDIDGVVLKVD 295

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
             +LQ++LG  +R+PRW I++KF  ++  T + DI+IQ+GRTG LTPVARL+PV +GG  
Sbjct: 296 NTALQERLGFVSRAPRWAIAYKFPAQEEMTTIEDIEIQVGRTGALTPVARLKPVFVGGVT 355

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHNED I+            +D+R+GD+V+V+RAG+VIP+VV +I+++R    + 
Sbjct: 356 VSNATLHNEDEIRR-----------KDVRIGDQVIVRRAGDVIPEVVKVILSKRTDTVRE 404

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P+ CP+C S V R+         A  RC+GGL C AQ+ E +KHF SR A +++GLG
Sbjct: 405 FVMPTQCPVCGSDVEREAGE------AVSRCSGGLFCPAQRKEAIKHFASRKALDVDGLG 458

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
               D   +    A  I+  AD+F L   Q         +   G  S  NL  +I   + 
Sbjct: 459 ----DKLVEQMVDAELIKDAADLFVLTVEQLAG------LERMGQKSADNLVRAIKASKQ 508

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
               RF+++LGIR VG   ARSLA ++                   D  +L+ +  VG I
Sbjct: 509 TRFPRFLYALGIREVGEATARSLAMHFADLDALKAA----------DSEALVEIEDVGPI 558

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +A  I  F+Q P N+  +  L+          + +  S +  K +V TGTL ++ R +A+
Sbjct: 559 VAHHIETFFQQPHNLEVINRLIDVGVSWPQEEKSHSDSALSGKTIVLTGTLVQMSRSEAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
           E +  LGA V+  +S+KTD ++ G + GSKL KA  L + +++E   L  L+Q  
Sbjct: 619 EKLLALGAKVAGSVSKKTDYVVAGADAGSKLTKAASLDISVVDEAMLLEWLKQEK 673


>gi|260774893|ref|ZP_05883794.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609148|gb|EEX35306.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 669

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 258/712 (36%), Positives = 398/712 (55%), Gaps = 48/712 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S ++ ++ L+ L + + YH   YY    P + D+EYD L R    +    PDL      
Sbjct: 1   MS-QEIQERLNQLRETLHYHGVKYYVEDNPEVPDAEYDRLMRELLELEAEHPDLV---SI 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+       VTH IP LSL+  ++ E+L  F  R+       + N   F  E
Sbjct: 57  DSPSQRVGGQPLDGFQSVTHEIPMLSLDNAFDDEELESFHKRMSDRIPTAEFNV--FCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I +IP  LS    P+ IEVRGE
Sbjct: 115 PKLDGLAVSLLYENGILVQAATRGDGTTGENITENVRTIKSIPLKLSGQGWPQRIEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++ K  F  LN +    G K + NPRNAA+G LR+L+     TR L+F+ + +G    I
Sbjct: 175 VFMPKEGFDKLNQQAQKKGEKVFVNPRNAAAGSLRQLDSRITATRPLSFYAYSVGVVEGI 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             ++  YE   +++  G P+    R+      + +YY ++   R  LPY+IDG+V KVD+
Sbjct: 235 ALSESHYERFLQLKGWGLPMCPETRRVANLTEVKAYYQDILERREALPYEIDGVVIKVDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IALQEQLGFVARAPRWAIAYKFPAQEEITLLNDVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            ++VGD V+++RAG+VIP++V +I   R  +A+  
Sbjct: 355 SNATLHNADEIERL-----------GVKVGDSVIIRRAGDVIPQIVSVIEERRPGNARDI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP  CP+C S V R          A  RC+GGL C AQ+ E LKHFVSR A +++GLG+
Sbjct: 404 VFPERCPVCSSEVERIEGE------AVARCSGGLVCQAQRKEALKHFVSRKALDVDGLGE 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   I  +   G  S  N+ D++N+ +  
Sbjct: 458 KVIEQLVDRE----MVETPADLFKL------SAGVITVLDRMGPKSAQNVVDALNQAKLT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA+Y+ +                 +   LI V  +GDI+
Sbjct: 508 TLPRFLYSLGIREVGEATAANLAQYFKTLDAVKAA----------NHEQLIEVSDIGDIV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A  ++ F+   +N   ++ LL +    P I    ++    +  K +V TG+L ++ R+ A
Sbjct: 558 ASHVIAFFAQDKNQQVIQDLLDQGIEWPEIEEQSEDTPQPLAGKTVVLTGSLSQLSRNDA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  + L+
Sbjct: 618 KSALQALGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLVDLI 669


>gi|240142614|ref|YP_002967127.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
 gi|240012561|gb|ACS43786.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
          Length = 712

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 306/715 (42%), Positives = 445/715 (62%), Gaps = 14/715 (1%)

Query: 5   QLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPD 64
           + +P+  LS E AR E ++L  EI+ HD+ Y+    PI+ D+EYDAL+RR   I  A P 
Sbjct: 8   RAVPVAELSNEDARIEHAALASEIAEHDERYHGQDAPIVTDAEYDALRRRAAEIEAAHPA 67

Query: 65  LARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDN 124
           LA   +      K+G + +    K+ H+IP LSLE  +  ED+ +F  RI RF       
Sbjct: 68  LAAESEVA---KKVGAKPSSRFGKIVHAIPMLSLENAFVDEDVAEFAVRIRRFLDLPGGA 124

Query: 125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI 184
            + FT EPKIDG  ++IRYE  + V+AA RGDG +GE+V+A    I  IP  L  + P++
Sbjct: 125 PLAFTAEPKIDGLSLSIRYENRRLVHAATRGDGAAGENVTANALTIQDIPDDLPRDAPDV 184

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGL 243
           +E+RGEVY+SK+ F A+N    A G+  +ANPRNAA+G LR+L+P    +R L FF +  
Sbjct: 185 VEIRGEVYLSKSAFAAINARQEAAGKPLFANPRNAAAGSLRQLDPKITASRPLKFFAYSW 244

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G+TS   A+ Q+  L +    GF VN   +  +T   ++  Y  + ++R+ L YDIDG+V
Sbjct: 245 GETSAPIAEAQHAALARFDDWGFYVNPLTKLCSTVEEMLEVYRAIGAMRADLEYDIDGVV 304

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YKVD+ +LQ++LG  +R+PRW ++HKF  +QA T L  I+IQ+GRTG LTPVA+L P+ +
Sbjct: 305 YKVDDLALQRRLGFVSRAPRWAVAHKFPAQQAETVLEAIEIQVGRTGSLTPVAKLRPLTV 364

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG +++NATLHNEDYIKGLD+ G+ +R GRD+RVGD V+V+RAG+VIP++VD+  ++R  
Sbjct: 365 GGVVVSNATLHNEDYIKGLDSDGQPIREGRDLRVGDHVIVQRAGDVIPQIVDVDPSKRSE 424

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
              P+ FP  CP+C S  VR+ NPK+G+  +  RCTGGL C AQ +ER+KHF SR A +I
Sbjct: 425 GTAPYEFPKLCPVCGSHAVREANPKSGREDSVRRCTGGLICQAQAVERIKHFASRGAMDI 484

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSIN 543
           EGLG ++++ F + +     +R P+DIFTL+RRQ      +    G G  SV NL+ +I+
Sbjct: 485 EGLGDERIEDFHRDD----LLRTPSDIFTLRRRQDAGEIDLTAREGMGPTSVANLFAAID 540

Query: 544 KRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPL 603
            RR + LER I  LGIRHVG   A+ LAK Y S     +      A      + L  +  
Sbjct: 541 ARRKVPLERLIHGLGIRHVGETNAKLLAKAYRSLPAVREAAQVPDALKRM--VDL--ING 596

Query: 604 VGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQR 663
           +G ++A A+VEF+  P N   V+ LL EV  +         S +  K +VFTG+L ++ R
Sbjct: 597 IGPVVAAAVVEFFLEPHNSEEVDRLLAEVGTTA--PAAAKESPVTGKTIVFTGSLVRMSR 654

Query: 664 HKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +A+     LGA  +  +S+KTD+++ G   GSKL KA+Q GV++++E  +  L+
Sbjct: 655 DEAEAMAEGLGARTAGTVSKKTDLVVAGPGAGSKLAKAEQFGVRVIDENGWFDLV 709


>gi|315634861|ref|ZP_07890143.1| NAD-dependent DNA ligase LigA [Aggregatibacter segnis ATCC 33393]
 gi|315476413|gb|EFU67163.1| NAD-dependent DNA ligase LigA [Aggregatibacter segnis ATCC 33393]
          Length = 671

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 247/708 (34%), Positives = 392/708 (55%), Gaps = 45/708 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
             ++++  L + + YH+  Y+    P I DSEYD L  +  A+    P+L  +   + P 
Sbjct: 4   SIQQQIDDLRKTLRYHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELITA---DSPT 60

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++G        ++ H +P LSL+  ++ E+   F+ RI           + F  EPK+D
Sbjct: 61  QRVGARPLSEFAQIKHELPMLSLDNAFSDEEFLAFVKRIQDRLVLVP-EPLTFCCEPKLD 119

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYIS 194
           G  ++I Y  G    AA RGDG +GED++  IR I  IP  L + N P  +EVRGEV++ 
Sbjct: 120 GLAVSILYVNGVLTQAATRGDGTTGEDITQNIRTIRNIPLQLLTDNPPARLEVRGEVFMP 179

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLGKTSEIF-AK 252
            + F  LN+  +  G K +ANPRNAA+G LR+L+P   ++    F  + +G    I    
Sbjct: 180 HDGFERLNERALEQGEKTFANPRNAAAGSLRQLDPKITSQRPLVFNAYSIGVAQGIDLPP 239

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             +E LQ ++ +G PVN+ +R  +    ++++Y  M   RS+L YDIDG V KV++  LQ
Sbjct: 240 THFERLQWLKSIGVPVNSEIRLCDGVENVLNFYRTMMEKRSSLGYDIDGTVLKVNDIELQ 299

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           ++LG  +++PRW I++KF  ++  T L D++ Q+GRTG +TPVA+L+PV + G  ++NAT
Sbjct: 300 QRLGFISKAPRWAIAYKFPAQEELTVLNDVEFQVGRTGAITPVAKLQPVFVAGVTVSNAT 359

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN D I+ L           +I +GD V+++RAG+VIP+++ ++ + R  +A+   FP+
Sbjct: 360 LHNGDEIERL-----------NIAIGDTVIIRRAGDVIPQIIGVVHDRRPANARQIVFPT 408

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP+C S +VR          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++
Sbjct: 409 RCPVCDSLIVRIEGE------AVARCTGGLFCAAQRKEALKHFVSRKAMDIDGVGAKLIE 462

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
                E     +  PAD+F L        T +  +   G  S  N   S+ K ++ +L R
Sbjct: 463 QLVDRE----LVHTPADLFKL------DLTTLTRLERMGPKSAENALASLEKAKHTTLAR 512

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR VG   A +LA ++ + +               D   L +VP VG+++A  I
Sbjct: 513 FIFALGIRDVGEATALNLANHFKTLEALQNA----------DLEQLQQVPDVGEVVANRI 562

Query: 613 VEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
             F++   N+  V  L+ +         +    +  + K +V TGTL ++ R+ A+  + 
Sbjct: 563 FVFWREEHNVAVVNDLIAQGVHWETVEVQDVKENPFKGKTVVLTGTLSQMGRNDAKALLQ 622

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           QLGA VS  +S KTD +I G+  GSKL KA +LGV++++EE+FL  + 
Sbjct: 623 QLGAKVSGSVSAKTDYVIAGEAAGSKLSKAAELGVQVLSEEEFLAWVN 670


>gi|325576592|ref|ZP_08147310.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
 gi|325161155|gb|EGC73270.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
          Length = 675

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 253/710 (35%), Positives = 400/710 (56%), Gaps = 45/710 (6%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           +I   ++++ +L  ++  ++  Y+    P I D+EYD L  +  A+  A P+L  +   +
Sbjct: 7   NIMSLQQQIDTLRHDLRRYEYEYHVLDNPTIPDAEYDRLFHQLKALEAAHPELITA---D 63

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            P  ++G +      ++ H IP LSL+  ++ E+   F+ RI     +     + F  EP
Sbjct: 64  SPTQRVGAKPLSGFAQIRHEIPMLSLDNAFSDEEFYAFVKRIEDRLIRLP-EPLTFCCEP 122

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEV 191
           K+DG  ++I Y  G    AA RGDG +GED++A IR I  IP  L   N P  +EVRGEV
Sbjct: 123 KLDGLAVSILYVNGILTQAATRGDGATGEDITANIRTIRNIPLQLLMDNPPARLEVRGEV 182

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGLGKTSEIF 250
           ++    F  LN + +  G K +ANPRNAA+G LR+L+P   ++       +G+G    + 
Sbjct: 183 FMPHAGFERLNQQALEKGEKTFANPRNAAAGSLRQLDPKITSKRPLVLNAYGIGIAEGVD 242

Query: 251 -AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                Y+ LQ ++ +G PVN  +R  N    ++ +Y ++++ RS L YDIDG V K+++ 
Sbjct: 243 LPNTHYDRLQWLKSIGIPVNPEIRLCNGTDEVLDFYRDIQNKRSALGYDIDGTVLKINDI 302

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
           +LQ++LG  +++PRW I++KF  ++  TRL D++ Q+GRTG +TPVA+LEPV + G  ++
Sbjct: 303 ALQEKLGFISKAPRWAIAYKFPAQEELTRLNDVEFQVGRTGAITPVAKLEPVFVAGVTVS 362

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHN D I+ L           DI +GD V+++RAG+VIP+++ ++ + R  DA+P  
Sbjct: 363 NATLHNGDEIERL-----------DIAIGDTVVIRRAGDVIPQIIGVLHDRRPADARPIV 411

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
           FP  CP+C S +VR          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G +
Sbjct: 412 FPKTCPVCDSAIVRIEGE------AVARCTGGLFCAAQRKEALKHFVSRKAMDIDGVGGK 465

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++     E     +  PAD+F L        T +  +   G  S  N   S+ K +N +
Sbjct: 466 LIEQLVDRE----LVHTPADLFKL------DLTTLTRLERMGAKSAENALASLEKAKNTT 515

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFIF+LGIR VG   A +LA ++ + +               D  +L +VP VG+++A
Sbjct: 516 LARFIFALGIREVGEATALNLANHFKTLEALQNA----------DLEALQQVPDVGEVVA 565

Query: 610 QAIVEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
             I+ F+  P N+  V  L+ +         ++   +  + K +V TGTL ++ R++A+ 
Sbjct: 566 NRILAFWHEPHNVAVVNDLIAQGVRWETVETKEVAENRFKGKTVVLTGTLTQMGRNEAKA 625

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +  +GA VS  +S KTD +I GD  GSKL KAQ+LGV ++ EE+FL  +
Sbjct: 626 LLQDMGAKVSGSVSAKTDFVIAGDAAGSKLTKAQELGVTVLTEEEFLAQI 675


>gi|308187689|ref|YP_003931820.1| DNA ligase [Pantoea vagans C9-1]
 gi|308058199|gb|ADO10371.1| DNA ligase [Pantoea vagans C9-1]
          Length = 672

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 244/713 (34%), Positives = 390/713 (54%), Gaps = 49/713 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  +  ++ L   + +H+  Y+    P + D+EYD L R    +    PDL     P+ 
Sbjct: 1   MKSVQDHITELRTTLRHHEYLYHVMDAPEVPDAEYDRLMRELRQLEEEHPDLI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G        +V H +P LSL+  ++      F  R+    +  DD  I +  E K
Sbjct: 58  PTQRVGAAPLTVFEQVRHEVPMLSLDNAFDEATFMAFNKRVQDRLKSSDD--ITYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGE++
Sbjct: 116 LDGAAVSLMYENGLLVRAATRGDGTTGENITANVRTIRAIPLRLKGDNIPARLEVRGEIF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +++  F  LN+E      K +ANPRNAA+G LR+L+P     R L FF +G G       
Sbjct: 176 MTQRGFEKLNEEARRTDGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGFGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  LQ+ +  G PV++ ++  +     +++Y +++  R  L +DIDG+V KVD  +
Sbjct: 236 PHSHMGRLQQFKAWGLPVSDRIKLVHNAEEALAFYRDIEQQRPNLGFDIDGVVIKVDSQA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW I+ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWAIAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVQVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GDRV+++RAG+VIP+VV++++ ER  + +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDRVVIRRAGDVIPQVVNVVIAERPEETREVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          +  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PAHCPVCGSEVERVEGE------SVTRCTGGLICGAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+F L         K+  +   G  S  N+ D++ K ++ +L
Sbjct: 459 IDQLVEKE----YVDTPADLFRLTA------GKLTGLDRMGPKSAQNIVDALEKAKSTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   Q               D  +LI VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAANLANHFGELQKVMDA----------DLEALIAVPDVGKVVAA 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F +   N   +  L  ++     +      + + S    K +V TG+L ++ R  A
Sbjct: 559 HVRNFMEEESNREVIRQLTDDIGIHWPQVVVVKAEEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +  +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+++++E + + LL 
Sbjct: 619 KAQLIALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIEVIDEAEMIRLLD 671


>gi|167837047|ref|ZP_02463930.1| DNA ligase, NAD-dependent [Burkholderia thailandensis MSMB43]
          Length = 691

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 261/733 (35%), Positives = 395/733 (53%), Gaps = 56/733 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M +  + P  +    Q  K  + L  E+   +  YY   +P + D+EYD L      I  
Sbjct: 1   MARSPVEPPAS----QPAKRAAWLRAELERANYAYYVLDQPDLPDAEYDRLFVELQQIEA 56

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             PDL     P+ P  ++GGE+      V H  P LSL   ++ +D+  F  R+     K
Sbjct: 57  EHPDLV---TPDSPTQRVGGEVAGGFTPVVHDTPMLSLNNGFSDDDVVAFDKRVADGLDK 113

Query: 121 KDD------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP 174
             D        + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + +IP
Sbjct: 114 ATDLAGTVTEPVEYACELKFDGLAISLRYEGGRFVQASTRGDGTTGEDVTENIRTVRSIP 173

Query: 175 RVLSLNIPEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DI 232
             L       + +VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     
Sbjct: 174 LTLKGRHVPRMLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITA 233

Query: 233 TRYLNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSI 291
           +R L+FF +G+G             +L     LG PVN          G++ +++ +   
Sbjct: 234 SRPLSFFAYGIGVLDGVEMPGTHSGLLDWYETLGLPVNRERAVVRGAAGLLGFFHSVGER 293

Query: 292 RSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGI 351
           R +LPYDIDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG 
Sbjct: 294 RESLPYDIDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGA 353

Query: 352 LTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIP 411
           +TPVARLEPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP
Sbjct: 354 ITPVARLEPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIP 402

Query: 412 KVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLER 471
           +VV  +++ R  DA+ F  P+ CP C SR+ R  +       A  RCTGGL C AQ+ + 
Sbjct: 403 EVVSAVLDRRPADAREFVMPTECPECGSRIERLPDE------AIARCTGGLFCPAQRKQA 456

Query: 472 LKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFG 531
           L HF  R A +I+GLG++ +D   +       +R PAD+F L        + +  +  F 
Sbjct: 457 LWHFAQRRALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFA 506

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
           + S  NL DS+ K ++ +L RFI++LGIRHVG   A+ LAK++ S               
Sbjct: 507 EKSAQNLIDSLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPVMDA-------- 558

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIE 648
                 L+ V  VG I+A++I +F+    N   +E L  +   +        +     + 
Sbjct: 559 --SIDELLEVNDVGPIVAESIHQFFAEEHNRTVIEQLRAKGKVTWPEGPPAPRAPQGVLA 616

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +
Sbjct: 617 GKTVVLTGTLPTLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPV 676

Query: 709 MNEEQFLFLLQQY 721
           ++E     LL+ +
Sbjct: 677 LDEAGMHKLLEGH 689


>gi|134296034|ref|YP_001119769.1| DNA ligase [Burkholderia vietnamiensis G4]
 gi|166215568|sp|A4JF81|DNLJ_BURVG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|134139191|gb|ABO54934.1| DNA ligase, NAD-dependent [Burkholderia vietnamiensis G4]
          Length = 691

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 253/713 (35%), Positives = 384/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFGELQQLEADHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GG +      V H  P LSL   ++ +D+  F  R+     K  D      + + +  E 
Sbjct: 72  GGAVASGFTPVVHDAPMLSLNNGFSDDDIVAFDKRVADALDKPTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYERGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGAHVPALLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFSYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN          G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYEALGLPVNRERAVVRGAQGLLEFFRKVGERRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++  R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLERRPVDAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLDPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   ++ L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIDQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPTLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|300724062|ref|YP_003713378.1| DNA ligase [Xenorhabdus nematophila ATCC 19061]
 gi|297630595|emb|CBJ91260.1| DNA ligase [Xenorhabdus nematophila ATCC 19061]
          Length = 658

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 241/699 (34%), Positives = 381/699 (54%), Gaps = 49/699 (7%)

Query: 29  SYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFK 88
            +H+  Y+    P I D+EYD L R   A+    P+   +   + P  +IG     +  +
Sbjct: 2   RHHEYLYHVMDAPEIPDAEYDRLMRELKALEEQHPEWVTA---DSPTQRIGATPLSAFEQ 58

Query: 89  VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKF 148
           V H IP LSL+ +++ E    F  R+      KD     F  E K+DG  +++ YE G+ 
Sbjct: 59  VRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KDSQDWVFCCELKLDGLAVSLLYENGEL 116

Query: 149 VYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKNDFLALNDEMIA 207
           V AA RGDG +GE+++A +R I  IP  L     P  +E+RGEV+I +  F  LN+E   
Sbjct: 117 VQAATRGDGTTGENITANVRTIHAIPLRLKGENIPARVEIRGEVFIKQTGFEKLNEEARR 176

Query: 208 VGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG-KTSEIFAKGQYEMLQKMRCLG 265
            G K +ANPRNAA+G LR+L+P     R L F+ +G+G +         Y  L + +  G
Sbjct: 177 TGNKVFANPRNAAAGSLRQLDPRITAKRPLTFYCYGIGVQEGGALPASHYARLMQFKEWG 236

Query: 266 FPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWM 325
            PV++ V+       ++ +Y +++  R TL +DIDG+V KVD   LQ++LG  A++PRW 
Sbjct: 237 LPVSDKVKLCLGTQQVIDFYQDIEQQRPTLGFDIDGVVVKVDSLELQERLGFVAKAPRWA 296

Query: 326 ISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDAS 385
            + KF  ++  T + D++ Q+GRTG +TPVARLEPV++ G  ++NATLHN D I+ L   
Sbjct: 297 TAFKFPAQEQMTVVRDVEFQVGRTGAITPVARLEPVSVAGVTVSNATLHNADEIERL--- 353

Query: 386 GKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDL 445
                    +R+GD V+++RAG+VIP+VV +I   R  ++    FP  CP+C S + R  
Sbjct: 354 --------GLRIGDTVIIRRAGDVIPQVVGVIHERRPAESLEVIFPQHCPVCGSDIERVE 405

Query: 446 NPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIR 505
                   A  RCTGGL C AQ+ E L+HFVSR A +++G+G++ ++     E     ++
Sbjct: 406 GE------AVARCTGGLFCGAQRKEALRHFVSRRAMDVDGMGEKIIEQLVDKE----YVK 455

Query: 506 IPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE 565
            PAD+F L         K+  +   G  S  N+ +++ K R  +  RFI+SLGIR VG  
Sbjct: 456 TPADLFRLTA------GKLTGLERMGPKSAQNVINALEKARKTTFARFIYSLGIREVGET 509

Query: 566 IARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAV 625
            A +L  ++ + +               D  +LI V  VG I+A  +V F+  P N   +
Sbjct: 510 TAANLVSHFGTLEKLQAA----------DTEALIAVQDVGGIVASHVVNFFNEPHNQAVI 559

Query: 626 EALLKEVSPSIGRHEK----NVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAIL 681
           + L+  +       E      +      K +V TG+L ++ R +A++ +  LGA V+  +
Sbjct: 560 DDLVNNIGIHWESAESPNLGEIDGPFAGKTVVLTGSLNRLSRDEAKDKLAALGAKVTGSV 619

Query: 682 SRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           S+KTD++I G+  GSKL KA +LG+ +++E++ + LL++
Sbjct: 620 SKKTDLVIAGEAAGSKLAKANELGIPVIDEDEMIRLLRE 658


>gi|254252054|ref|ZP_04945372.1| NAD-dependent DNA ligase [Burkholderia dolosa AUO158]
 gi|124894663|gb|EAY68543.1| NAD-dependent DNA ligase [Burkholderia dolosa AUO158]
          Length = 691

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 257/713 (36%), Positives = 385/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANHAYYVLDQPDLPDAEYDRLFLELQQLEADHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GG +      V H  P LSL   +  +D+  F  R+     K  D      + + +  E 
Sbjct: 72  GGAVASGFTPVVHDAPMLSLNNGFADDDIVAFDKRVADALAKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYENGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGRTVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A G++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G+++++  +   R  LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYEALGLPVNRERAVVHGADGLLAFFRRVGEKRDALPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGAVLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLVCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L        + +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFSTLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIDELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTIVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD +I G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVIAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|262394922|ref|YP_003286776.1| DNA ligase [Vibrio sp. Ex25]
 gi|262338516|gb|ACY52311.1| DNA ligase [Vibrio sp. Ex25]
          Length = 690

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 253/714 (35%), Positives = 392/714 (54%), Gaps = 48/714 (6%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
            +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL     
Sbjct: 20  TMS-ESVLQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITV-- 76

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
            + P  ++GG+   +  +VTH +P LSL+  ++  +L  F  R       +      +  
Sbjct: 77  -DSPSQRVGGQPLSAFSQVTHEVPMLSLDNAFDDSELDSFHKRAQERVGSQSVK--EYCC 133

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  N  P  +EVRG
Sbjct: 134 EPKLDGLAVSLLYENGVLVQAATRGDGTTGENITENVRTIKAIPLKLRGNDWPNRLEVRG 193

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSE 248
           EV++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G    
Sbjct: 194 EVFMPKAGFEKLNELARKKGEKIFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQG 253

Query: 249 -IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
              A   YE   +++  G P+    ++  +   + +YY ++   R  LPY+IDG+V K+D
Sbjct: 254 AELAASHYERFLQIKSWGLPMCPETKRVESLADVKAYYQDILQRRDALPYEIDGVVIKID 313

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + ++Q++LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  
Sbjct: 314 DIAVQERLGFVARAPRWAIAYKFPAQEEMTTLNEVEFQVGRTGAITPVAKLEPVFVGGVT 373

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHN D I+ L            +++GD V+++RAG+VIP+VV +I   R   A+ 
Sbjct: 374 VSNATLHNADEIERLQ-----------VKIGDHVVIRRAGDVIPQVVSVIKERRPETARD 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
             FP+ CP+C S V R          A  RCTGGL C AQ+ + LKHFVSR A +++GLG
Sbjct: 423 IIFPTQCPVCGSHVERIEGE------AVTRCTGGLVCQAQRKQALKHFVSRKALDVDGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + ++     E     ++ PAD+F L      S   +  +   G  S  N+ +++ K + 
Sbjct: 477 DKVIEQLVDRE----MVKTPADLFKL------SAGILTVLDRMGPKSAQNIVNALEKSKE 526

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF++SLGIR VG   A +LA ++ + +                   LI V  +G +
Sbjct: 527 TTLPRFLYSLGIREVGEATAANLAMHFKTLEAIQNANE----------EQLIEVQDIGAV 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +AQ I  F+   +N   V+ LL++    P I   E+     +E K +V TGTL ++ R +
Sbjct: 577 VAQHITTFFSEEQNQAVVKDLLEQGIHWPEINTTEQVGELPLEGKTVVLTGTLSQLGRTE 636

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 637 AKEALQSLGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELMN 690


>gi|167563194|ref|ZP_02356110.1| DNA ligase, NAD-dependent [Burkholderia oklahomensis EO147]
          Length = 691

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 260/733 (35%), Positives = 397/733 (54%), Gaps = 56/733 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M +  + P  +    Q  K  + L  E+   +  YY   +P + D+EYD L      +  
Sbjct: 1   MARSPVEPPAS----QPAKRAAWLRAELERANYAYYVLDQPELPDAEYDRLFVELQQVEA 56

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             PDL     P  P  ++GGE+      V H  P LSL   ++ ED+  F  R+     K
Sbjct: 57  EHPDLV---TPESPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDEDVVAFDKRVADGLDK 113

Query: 121 KDD------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP 174
             D      + + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + ++P
Sbjct: 114 ATDLAGTVTDPVEYACELKFDGLAISLRYEDGRFVQASTRGDGTTGEDVTRNIRTVRSVP 173

Query: 175 RVLSLNIPEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DI 232
             L       + +VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     
Sbjct: 174 LKLKGKHVPRVLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITA 233

Query: 233 TRYLNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSI 291
           +R L+FF +G+G             +L     LG PVN          G++ +++ +   
Sbjct: 234 SRPLSFFAYGIGVLDGVDMPDTHGGLLDWYETLGLPVNRERAVVRGAAGLLDFFHAVGER 293

Query: 292 RSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGI 351
           R +LPYDIDG+VYKV+    Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG 
Sbjct: 294 RESLPYDIDGVVYKVNRRDEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGA 353

Query: 352 LTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIP 411
           +TPVARLEPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP
Sbjct: 354 ITPVARLEPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIP 402

Query: 412 KVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLER 471
           +VV  +++ R  DA+ F  P+ CP C S + R  +       A  RCTGGL C AQ+ + 
Sbjct: 403 EVVSAVLDRRPADAREFVMPTACPECGSGIERLPDE------AIARCTGGLFCPAQRKQA 456

Query: 472 LKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFG 531
           L HF  R A +I+GLG++ +D   +       +R PAD+F L        + +  +  F 
Sbjct: 457 LWHFAQRRALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFA 506

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
           + S  NL DS++K ++ +L RFI++LGIRHVG   A+ LAK++ S               
Sbjct: 507 EKSAQNLIDSLDKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA-------- 558

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIE 648
                +L+ V  VG I+A++I +F+    N   +E L      +        +     + 
Sbjct: 559 --SIEALLEVNDVGPIVAESIHQFFAEEHNRTVIEQLRAPGRVTWPEGPPAPRAPQGVLA 616

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +
Sbjct: 617 GKTVVLTGTLPTLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPV 676

Query: 709 MNEEQFLFLLQQY 721
           ++EE    LL+ +
Sbjct: 677 LDEEGMHKLLEGH 689


>gi|167570377|ref|ZP_02363251.1| DNA ligase, NAD-dependent [Burkholderia oklahomensis C6786]
          Length = 691

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 261/733 (35%), Positives = 398/733 (54%), Gaps = 56/733 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M +  + P  +    Q  K  + L  E+   +  YY   +P + D+EYD L      +  
Sbjct: 1   MARSPVEPPAS----QPAKRAAWLRAELERANYAYYVLDQPELPDAEYDRLFVELQQVEA 56

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             PDL     P  P  ++GGE+      V H  P LSL   ++ ED+  F  R+     K
Sbjct: 57  EHPDLV---TPESPTQRVGGEVASGFTPVVHDTPMLSLNNGFSDEDVVAFDKRVADGLDK 113

Query: 121 KDD------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP 174
             D      + + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+  IR + ++P
Sbjct: 114 ATDLAGTVTDPVEYACELKFDGLAISLRYEDGRFVQASTRGDGTTGEDVTRNIRTVRSVP 173

Query: 175 RVLSLNIPEII-EVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DI 232
             L       + +VRGEV + K DF  LN+   A G++ +ANPRNAA+G LR+L+     
Sbjct: 174 LKLKGKHVPRVLDVRGEVLMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDSKITA 233

Query: 233 TRYLNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSI 291
           +R L+FF +G+G             +L     LG PVN          G++ +++ +   
Sbjct: 234 SRPLSFFAYGIGVLDGVDMPDTHGGLLDWYETLGLPVNRERAVVRGAAGLLDFFHAVGER 293

Query: 292 RSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGI 351
           R +LPYDIDG+VYKV+    Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG 
Sbjct: 294 RESLPYDIDGVVYKVNRRDEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGA 353

Query: 352 LTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIP 411
           +TPVARLEPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP
Sbjct: 354 ITPVARLEPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIP 402

Query: 412 KVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLER 471
           +VV  +++ R  DA+ F  P+ CP C SR+ R  +       A  RCTGGL C AQ+ + 
Sbjct: 403 EVVSAVLDRRPADAREFVMPTACPECGSRIERLPDE------AIARCTGGLFCPAQRKQA 456

Query: 472 LKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFG 531
           L HF  R A +I+GLG++ +D   +       +R PAD+F L        + +  +  F 
Sbjct: 457 LWHFAQRRALDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFSTLVELDRFA 506

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
           + S  NL DS++K ++ +L RFI++LGIRHVG   A+ LAK++ S               
Sbjct: 507 EKSAQNLIDSLDKAKHTTLSRFIYALGIRHVGESTAKDLAKHFGSLDPIMDA-------- 558

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIE 648
                +L+ V  VG I+A++I +F+    N   +E L      +        +     + 
Sbjct: 559 --SIEALLEVNDVGPIVAESIHQFFAEEHNRTVIEQLRAPGRVTWPEGPPAPRAPQGVLA 616

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +
Sbjct: 617 GKTVVLTGTLPTLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPV 676

Query: 709 MNEEQFLFLLQQY 721
           ++EE    LL+ +
Sbjct: 677 LDEEGMHKLLEGH 689


>gi|113460523|ref|YP_718587.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 129PT]
 gi|122945214|sp|Q0I2H6|DNLJ_HAES1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|112822566|gb|ABI24655.1| DNA ligase (NAD+) [Haemophilus somnus 129PT]
          Length = 673

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 261/707 (36%), Positives = 400/707 (56%), Gaps = 45/707 (6%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
            ++++  L Q + +H+  Y+    P I DSEYD L  +  A+   +P+ A     N P  
Sbjct: 8   IKQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYA---SENSPTQ 64

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDG 136
           ++G +   +  +V H IP LSL+  ++ ED   F+ RI         +S+ F  EPK+DG
Sbjct: 65  RVGAKPLSNFAQVKHDIPMLSLDNAFSDEDFFAFVKRIQDRL-IHVHHSLTFCCEPKLDG 123

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISK 195
             ++I Y  G+ V AA RGDG +GED++A IR I  IP  L + N P  +EVRGEV++S+
Sbjct: 124 LAVSILYINGQLVQAATRGDGTTGEDITANIRTIRNIPLQLLTDNPPARLEVRGEVFMSQ 183

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTS-EIFAKG 253
             F  LN   +A G K +ANPRNAA+G LR+L+P     R L    +G+G          
Sbjct: 184 AGFEKLNKTALAKGEKTFANPRNAAAGSLRQLDPKITGQRPLMLNAYGIGIAEGVELPDT 243

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +  LQ ++ +G PVNN ++  +    ++ +Y  +K  RS+L YDIDG V K+++  LQ+
Sbjct: 244 HFARLQWLKSIGIPVNNEIQLCHGIEKVLDFYRTIKQKRSSLGYDIDGTVLKINDIDLQQ 303

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  +++PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV + G  ++NATL
Sbjct: 304 QLGFISKAPRWAIAYKFPAQEELTILNNVEFQVGRTGAITPVAKLEPVFVAGVTVSNATL 363

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I  L           DI +GD V+V+RAG+VIP+++ ++   R  +A+   FPS 
Sbjct: 364 HNGDEIARL-----------DIAIGDTVIVRRAGDVIPQIIGVLHERRPENAKSIIFPSN 412

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S + +          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++ 
Sbjct: 413 CPVCDSVISKIEGE------AVARCTGGLICAAQRKEALKHFVSRKAMDIDGIGAKLIEQ 466

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + E     +  PAD+F L +        +  +   G  S  N   S+ K +  +L RF
Sbjct: 467 LVERE----LVHTPADLFKLDQ------VTLMRLERMGAKSAENALASLAKAKKTTLARF 516

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IF+LGIR VG   A +LA ++ + + F              +  L +V  VG+++A+ I 
Sbjct: 517 IFALGIREVGETTALNLATHFKTLEAFENAT----------FEQLQKVQDVGEVVAKRIR 566

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNV-SSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
            F+  P N+  V+ L+ +         K V  + ++ K +V TGTL K+ R +A+EY+ Q
Sbjct: 567 SFWSEPHNVAVVKDLIAQGIHWDDVEVKEVRDNPLKGKTVVLTGTLTKMGRSEAKEYLLQ 626

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           LG  VS  +S KTD +I G++ GSKL KA +LG+ I++E +FL LL 
Sbjct: 627 LGCKVSGSVSSKTDFVIAGESAGSKLTKATELGINILSENEFLALLA 673


>gi|170703080|ref|ZP_02893902.1| DNA ligase, NAD-dependent [Burkholderia ambifaria IOP40-10]
 gi|170132009|gb|EDT00515.1| DNA ligase, NAD-dependent [Burkholderia ambifaria IOP40-10]
          Length = 691

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 385/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    PDL     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFGELQQLETDHPDLV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE+      V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEVAGGFTPVVHDAPMLSLNNGFADEDIAAFDKRVADALGKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGAHVPALLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L      G PVN          G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESFGLPVNRERAVVYGADGLLGFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPDDAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWAEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E++   LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEDELHQLLE 687


>gi|114570616|ref|YP_757296.1| DNA ligase [Maricaulis maris MCS10]
 gi|122315591|sp|Q0AMX9|DNLJ_MARMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114341078|gb|ABI66358.1| DNA ligase, NAD-dependent [Maricaulis maris MCS10]
          Length = 701

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 282/717 (39%), Positives = 425/717 (59%), Gaps = 25/717 (3%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           L  ++ L+  +AR E + L +EI+ HD  YYQ   P I D+ YDAL+R+ +AI   FP  
Sbjct: 4   LKDVDQLTEAEARAEHARLAREIAGHDKAYYQSDAPKISDAAYDALRRKLEAIEVRFPQF 63

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
                   P  ++G   +    ++ H++P LSL   +N ED+  F+ RI RF    + + 
Sbjct: 64  IDLL---SPTQRVGAVPSGKFGEIRHAVPMLSLGNAFNDEDVADFVGRIRRFLGLAESDV 120

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRV-LSLNIPEI 184
           +  T EPKIDG   ++RY  GK V+ A RGDG +GEDV+  +  +  IP      + P++
Sbjct: 121 VAVTAEPKIDGLSASLRYVGGKLVHGATRGDGQTGEDVTQNLLTLDDIPDTLPPGDWPDV 180

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYL-NFFVHGL 243
           +EVRGEVY+S  DF ALN+  I  G+  Y NPRNAA+G LR+++P   ++    FF +  
Sbjct: 181 VEVRGEVYMSHADFAALNERQIEAGKDAYKNPRNAAAGSLRQIDPKMTSQRPLRFFAYAW 240

Query: 244 GKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLV 303
           G+ SE  +  Q   + +   +GFPVN+ + +  T   +++ Y ++++ R+ L YDIDG+V
Sbjct: 241 GEVSEPLSDTQMGAVARFGEMGFPVNDLMARCETVEALLAVYRDIEARRAGLGYDIDGVV 300

Query: 304 YKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNI 363
           YK D    Q++LG  AR+PRW I+HKF  +QA+T L  IDIQ+GRTG LTPVARL PV +
Sbjct: 301 YKADRLDWQERLGFVARAPRWAIAHKFPAEQATTILEAIDIQVGRTGALTPVARLTPVTV 360

Query: 364 GGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHP 423
           GG ++TNATLHN+D I+            +DIRVGD V+++RAG+VIP+VV ++  +R  
Sbjct: 361 GGVVVTNATLHNQDEIER-----------KDIRVGDTVVIQRAGDVIPQVVRVVDPDRPG 409

Query: 424 DAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNI 483
             + F FP+ CP+C S+ +R+ + KTGKL    RCTGGL C AQ  ERLKHFVSR AF+I
Sbjct: 410 RGEAFDFPTECPVCGSQALREHDAKTGKLDVVRRCTGGLICGAQLKERLKHFVSRKAFDI 469

Query: 484 EGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKI--ENILGFGDVSVTNLYDS 541
           EGLG +Q++ F +       I  PA IFTL+ R +    K   +   GFG+ S+ NL+ S
Sbjct: 470 EGLGIKQIEAFQEE----GLITEPAHIFTLKARNEAGEIKPPLQEREGFGETSIRNLFTS 525

Query: 542 INKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRV 601
           I  RR I+L RF+ +LGIRHVG   +   A+ Y S+  F     N+          ++ +
Sbjct: 526 IEDRRTITLARFLNALGIRHVGENTSALFARTYGSWAAFHAAAANLSD--EAVRAEMLGI 583

Query: 602 PLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKI 661
             +G+   +A+ +++    N   ++ L+ +++        N  S +  K +VFTG L+++
Sbjct: 584 DGIGNAAVEALEQYFTEAHNRDLLDRLVAQLTIEDAEAIAN-DSPVAGKTVVFTGALERM 642

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            R +A+     LGA V+  +S KTD ++ G   GSK +KA +LGV+ + E+++  L+
Sbjct: 643 TRDEAKAKAQALGAKVAGSVSGKTDYLVAGPGAGSKAKKAAELGVETLTEDEWFDLI 699


>gi|269968476|ref|ZP_06182487.1| DNA ligase [Vibrio alginolyticus 40B]
 gi|269826910|gb|EEZ81233.1| DNA ligase [Vibrio alginolyticus 40B]
          Length = 690

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 252/714 (35%), Positives = 390/714 (54%), Gaps = 48/714 (6%)

Query: 11  ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
            +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL     
Sbjct: 20  TMS-ESVLQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITV-- 76

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
            + P  ++GG+   +  +VTH +P LSL+  ++  +L  F  R       +      +  
Sbjct: 77  -DSPSQRVGGQPLSAFSQVTHEVPMLSLDNAFDDSELDSFHKRAQERVGSQSVK--EYCC 133

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRG 189
           EPK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  N  P  +EVRG
Sbjct: 134 EPKLDGLAVSLLYENGVLVQAATRGDGTTGENITENVRTIKAIPLKLRGNDWPNRLEVRG 193

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSE 248
           EV++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G    
Sbjct: 194 EVFMPKAGFEKLNELARKKGEKIFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQG 253

Query: 249 -IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
              A   YE   +++  G P+    ++  +   + +YY ++   R  LPY+IDG+V K+D
Sbjct: 254 AELAASHYERFLQIKSWGLPMCPETKRVESLADVKAYYQDILQRRDALPYEIDGVVIKID 313

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           + ++Q++LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  
Sbjct: 314 DIAVQERLGFVARAPRWAIAYKFPAQEEMTTLNEVEFQVGRTGAITPVAKLEPVFVGGVT 373

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++NATLHN D I+ L            +++GD V+++RAG+VIP+VV +I   R   A+ 
Sbjct: 374 VSNATLHNADEIERLQ-----------VKIGDHVVIRRAGDVIPQVVSVIKERRPETARD 422

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
             FP+ CP+C S V R          A  RC GGL C AQ+ + LKHFVSR A +++GLG
Sbjct: 423 IVFPTQCPVCGSHVERIEGE------AVTRCMGGLVCQAQRKQALKHFVSRKALDVDGLG 476

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + ++     E     ++ PAD+F L      S   +  +   G  S  N+ +++ K + 
Sbjct: 477 DKVIEQLVDRE----MVKTPADLFKL------SAGILTVLDRMGPKSAQNIVNALEKSKE 526

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF++SLGIR VG   A +LA ++ +                     LI V  +G +
Sbjct: 527 TTLPRFLYSLGIREVGEATAANLAMHFKTLGAIQNATE----------EQLIEVQDIGAV 576

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
           +AQ I  F+   +N   V+ LL++    P I   E+     +E K +V TGTL ++ R +
Sbjct: 577 VAQHITTFFSEEQNQAVVKDLLEQGIHWPEINTTEQVGELPLEGKTVVLTGTLSQLGRTE 636

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           A+E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 637 AKEALQALGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELMN 690


>gi|84516174|ref|ZP_01003534.1| DNA ligase [Loktanella vestfoldensis SKA53]
 gi|84509870|gb|EAQ06327.1| DNA ligase [Loktanella vestfoldensis SKA53]
          Length = 722

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 289/713 (40%), Positives = 421/713 (59%), Gaps = 16/713 (2%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
           I +  L+  +A  EL+ L Q ++  +  Y++   P I D+ YDALK+R  AI   F +L 
Sbjct: 22  IAVADLTRAEAMVELARLAQTLAQANTAYHRNDTPEISDAAYDALKQRNAAIEARFRELK 81

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSI 126
           R+   + P +++G  +     KV H++  LSL   ++ +D+  F  R+ ++     D  +
Sbjct: 82  RA---DSPSDQVGAVVADGFGKVQHAVRMLSLGNAFSDDDVTDFDERLRKYLGLTADQPL 138

Query: 127 FFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIE 186
            +T EPKIDG  +++RYE G  V AA RGDG  GE+V+A    I  IP+ L+   P ++E
Sbjct: 139 RYTAEPKIDGLSLSLRYEDGVLVQAATRGDGAVGENVTANACTIADIPQRLTGA-PAVLE 197

Query: 187 VRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGK 245
           VRGEVY+S +DF ALN      G K +ANPRNAA+G LR+L+      R L FF +  G 
Sbjct: 198 VRGEVYMSHDDFAALNARQADKGAKTFANPRNAAAGSLRQLDAGITAARPLRFFAYAWGA 257

Query: 246 TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYK 305
            S   A  Q   + ++  LGF  N      ++   +++ Y+ +++ R++L YDIDG+VYK
Sbjct: 258 LSAPLAATQSGAIARLAELGFATNPLTATCDSPADLIAIYSGIEAQRASLGYDIDGVVYK 317

Query: 306 VDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGG 365
           VD+ +LQ++LG R+ +PRW I+HKF  + A T L  IDIQ+GRTG L+PVARL PV +GG
Sbjct: 318 VDDLALQQRLGFRSTTPRWAIAHKFPAELAWTVLDAIDIQVGRTGALSPVARLVPVTVGG 377

Query: 366 ALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDA 425
            +++NATLHNEDYI G    G+ +R GRDIRVGD V V RAG+VIPK+ D+    R   A
Sbjct: 378 VVVSNATLHNEDYIAGRGGDGQPIRQGRDIRVGDWVQVYRAGDVIPKIKDVDSARRPAGA 437

Query: 426 QPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEG 485
            P+ FP  CP C S  +RD         A  RCTGG+ C AQ +ERLKHFVSR AF+IEG
Sbjct: 438 TPYIFPDTCPECGSPAIRDPG------DAVRRCTGGMICPAQAVERLKHFVSRAAFDIEG 491

Query: 486 LGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR 545
           LG +Q++ F         I  P DIFTL+ R      +++N  G+G  S  NL+ +I+ +
Sbjct: 492 LGAKQVEQFHAD----GWITTPVDIFTLRARYGQGLQQLKNREGWGAKSADNLFAAIDDK 547

Query: 546 RNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVG 605
           R I+L R I++LGIRHVG   A  LA +Y S+  FA  +          W +L  +  VG
Sbjct: 548 RAIALNRLIYALGIRHVGESSAALLANHYGSWAGFATAMQAAHIGQGPAWDALTSIDGVG 607

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHK 665
            ++A +++   QNP    ++ AL+ ++         +  S +    +VFTGTL+K+ R +
Sbjct: 608 AVMATSLITTLQNPSEAASIAALVAQLDVQDAPKIAS-DSPVSGLTVVFTGTLEKMTRAE 666

Query: 666 AQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           A+     LGA V+  +S KTDI++ G   GSK  KA+ LG++ M+E+ +L L+
Sbjct: 667 AKARAESLGAKVAGSVSAKTDILVAGPGAGSKAAKAEALGIRTMDEDGWLALI 719


>gi|294504743|ref|YP_003568805.1| DNA ligase [Yersinia pestis Z176003]
 gi|262362805|gb|ACY59526.1| DNA ligase [Yersinia pestis D106004]
 gi|262366729|gb|ACY63286.1| DNA ligase [Yersinia pestis D182038]
 gi|294355202|gb|ADE65543.1| DNA ligase [Yersinia pestis Z176003]
          Length = 656

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 242/697 (34%), Positives = 392/697 (56%), Gaps = 47/697 (6%)

Query: 29  SYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEMNLSLFK 88
            +H+  Y+    P I D+EYD + ++   +    P+L  +   + P  ++G     +  +
Sbjct: 2   RHHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTN---DSPTQRVGAAPLDAFEQ 58

Query: 89  VTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKF 148
           V H +P LSL+ +++ E    F  R++     K    + F  E K+DG  +++ YE G+ 
Sbjct: 59  VKHEVPMLSLDNVFDEESYLAFDKRVHDRL--KTAEPLTFCCELKLDGLAVSLLYENGEL 116

Query: 149 VYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKNDFLALNDEMIA 207
           V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV++ +  F  LN+E   
Sbjct: 117 VRAATRGDGTTGENITANVRTIRAIPLRLHGDNVPRRVEVRGEVFMPQAGFEQLNEEARR 176

Query: 208 VGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-IFAKGQYEMLQKMRCLG 265
            G K +ANPRNAA+G LR+L+P     R L FF +G+G        +   + L + +  G
Sbjct: 177 KGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLDGGELPRSHIQCLMQFKAWG 236

Query: 266 FPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWM 325
            PV+  V+       ++++Y +++  R+ L +DIDG+V KVD+ +LQ+QLG  AR+PRW 
Sbjct: 237 LPVSERVKLCTGSDQVIAFYRQIEQDRAGLGFDIDGVVIKVDDLALQEQLGFVARAPRWA 296

Query: 326 ISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDAS 385
            + KF  ++  T++ +++ Q+GRTG +TPVARLEPV + G +++NATLHN D I+ L   
Sbjct: 297 TAFKFPAQEQITQVREVEFQVGRTGAITPVARLEPVQVAGVIVSNATLHNADEIERL--- 353

Query: 386 GKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDL 445
                    +R+GD V+V+RAG+VIP+VV +++ +R  D +  +FPS CP+C S + R  
Sbjct: 354 --------GLRIGDTVIVRRAGDVIPQVVGVVMEQRPDDTKEITFPSQCPVCGSDIERVE 405

Query: 446 NPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIR 505
                   A  RCTGGL C+AQ+ E LKHFVSR A +++G+G + ++   + +     + 
Sbjct: 406 GE------AVARCTGGLFCAAQRKEALKHFVSRRALDVDGMGDKIIEQLVEKQ----YVE 455

Query: 506 IPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAE 565
            PAD+F L         K+  +   G  S  NL  ++ K +  +  RF+++LGIR VG  
Sbjct: 456 NPADLFQLTA------GKLTGLDRMGPKSAQNLIAALEKAKQTTFARFLYALGIREVGEA 509

Query: 566 IARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAV 625
            A +LA ++ +  N              D  +L  VP VG+++A+ ++ F     N   +
Sbjct: 510 TAANLAAHFRTLDNLRAA----------DIETLKSVPDVGEVVAKHVMNFLSEEHNQKVI 559

Query: 626 EALLKEVSPSIGRHE--KNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSR 683
           E L K VS    +    +   S    K +V TG+L  + R +A++ +T LGA VS  +S+
Sbjct: 560 EELEKVVSWPEPQQIVVEESDSPFAGKTVVLTGSLTILSRDEAKDRLTALGAKVSGSVSK 619

Query: 684 KTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           KT ++I G+  GSKL KAQ+LG+K+++E + + LL +
Sbjct: 620 KTHLVIAGEAAGSKLAKAQELGIKVIDEAEMIRLLGE 656


>gi|91225892|ref|ZP_01260861.1| DNA ligase [Vibrio alginolyticus 12G01]
 gi|91189542|gb|EAS75818.1| DNA ligase [Vibrio alginolyticus 12G01]
          Length = 670

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 252/713 (35%), Positives = 389/713 (54%), Gaps = 48/713 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S E   + L  L++ + YH   YY    P I D+EYD L R    I    PDL      
Sbjct: 1   MS-ESVLQRLEELKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITV--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+   +  +VTH +P LSL+  ++  +L  F  R              +  E
Sbjct: 57  DSPSQRVGGQPLSAFSQVTHEVPMLSLDNAFDDSELDSFHKRAQERVGSLSVK--EYCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L  N  P  +EVRGE
Sbjct: 115 PKLDGLAVSLLYENGVLVQAATRGDGTTGENITENVRTIKAIPLKLRGNDWPNRLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSE- 248
           V++ K  F  LN+     G K + NPRNAA+G LR+L+     +R L+F+ + +G     
Sbjct: 175 VFMPKAGFEKLNELARKKGEKIFVNPRNAAAGSLRQLDSRITASRPLSFYAYSVGVVQGA 234

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             A   YE   +++  G P+    ++  +   + +YY ++   R  LPY+IDG+V K+D+
Sbjct: 235 ELAASHYERFLQIKSWGLPMCPETKRVESLADVKAYYQDILQRRDALPYEIDGVVIKIDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            ++Q++LG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IAVQERLGFVARAPRWAIAYKFPAQEEMTTLNEVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L            +++GD V+++RAG+VIP+VV +I   R   A+  
Sbjct: 355 SNATLHNADEIERLQ-----------VKIGDHVVIRRAGDVIPQVVSVIKERRPETARDI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S V R          A  RC GGL C AQ+ + LKHFVSR A +++GLG 
Sbjct: 404 VFPTQCPVCGSHVERIEGE------AVTRCMGGLVCQAQRKQALKHFVSRKALDVDGLGD 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     ++ PAD+F L      S   +  +   G  S  N+ +++ K +  
Sbjct: 458 KVIEQLVDRE----MVKTPADLFKL------SAGILTVLDRMGPKSAQNIVNALEKSKET 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA ++ +                     LI V  +G ++
Sbjct: 508 TLPRFLYSLGIREVGEATAANLAMHFKTLGAIQNATE----------EQLIEVQDIGAVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           AQ I  F+   +N   V+ LL++    P I   E+     +E K +V TGTL ++ R +A
Sbjct: 558 AQHITTFFSEEQNQAVVKDLLEQGIHWPEINTTEQVGELPLEGKTVVLTGTLSQLGRTEA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LG++I  E+  L L+ 
Sbjct: 618 KEALQALGAKVTGSVSKKTDILFAGENAGSKLAKAQELGIEIKTEQDLLELMN 670


>gi|254247879|ref|ZP_04941200.1| NAD-dependent DNA ligase [Burkholderia cenocepacia PC184]
 gi|124872655|gb|EAY64371.1| NAD-dependent DNA ligase [Burkholderia cenocepacia PC184]
          Length = 691

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 257/713 (36%), Positives = 386/713 (54%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFRELQQLETDHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE       V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEAAGGFTPVVHDAPMLSLNNGFADEDIVAFDKRVADALAKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEQGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGKHVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+      R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDSKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESLGLPVNRERAVVHGAEGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|170718864|ref|YP_001784038.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 2336]
 gi|254781341|sp|B0USD9|DNLJ_HAES2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168826993|gb|ACA32364.1| DNA ligase, NAD-dependent [Haemophilus somnus 2336]
          Length = 667

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 260/707 (36%), Positives = 400/707 (56%), Gaps = 45/707 (6%)

Query: 17  ARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLN 76
            ++++  L Q + +H+  Y+    P I DSEYD L  +  A+   +P+ A     N P  
Sbjct: 2   IKQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYA---SENSPTQ 58

Query: 77  KIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDG 136
           ++G +   +  +V H IP LSL+  ++ ED   F+ RI         +S+ F  EPK+DG
Sbjct: 59  RVGAKPLSNFAQVKHDIPMLSLDNAFSDEDFFAFVKRIQDRL-IHVHHSLTFCCEPKLDG 117

Query: 137 TMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYISK 195
             ++I Y  G+ V AA RGDG +GED++A IR I  IP  L + N P  +EVRGEV++S+
Sbjct: 118 LAVSILYINGQLVQAATRGDGTTGEDITANIRTIRNIPLQLLTDNPPTRLEVRGEVFMSQ 177

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTS-EIFAKG 253
             F  LN   +A G K +ANPRNAA+G LR+L+P     R L    +G+G          
Sbjct: 178 AGFEKLNKTALAKGEKTFANPRNAAAGSLRQLDPKITGQRPLMLNAYGIGIAEGVELPDT 237

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
            +  LQ ++ +G PVNN ++  +    ++ +Y  +K  RS+L YDIDG V K+++  LQ+
Sbjct: 238 HFARLQWLKSIGIPVNNEIQLCHGIEKVLDFYRTIKQKRSSLGYDIDGTVLKINDIDLQQ 297

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  +++PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV + G  ++NATL
Sbjct: 298 QLGFISKAPRWAIAYKFPAQEELTILNNVEFQVGRTGAITPVAKLEPVFVAGVTVSNATL 357

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D I  L           DI +GD V+V+RAG+VIP+++ ++   R  +A+   FP+ 
Sbjct: 358 HNGDEIARL-----------DIAIGDTVIVRRAGDVIPQIIGVLHERRPENAKSIIFPTN 406

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C S + +          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++ 
Sbjct: 407 CPVCDSVISKIEGE------AVARCTGGLICAAQRKEALKHFVSRKAMDIDGIGAKLIEQ 460

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             + E     +  PAD+F L +        +  +   G  S  N   S+ K +  +L RF
Sbjct: 461 LVERE----LVHTPADLFKLDQ------VTLMRLERMGAKSAENALASLAKAKKTTLARF 510

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IF+LGIR VG   A +LA ++ + + F              +  L +V  VG+++A+ I 
Sbjct: 511 IFALGIREVGETTALNLATHFKTLEAFENAT----------FEQLQKVQDVGEVVAKRIR 560

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNV-SSEIENKKLVFTGTLQKIQRHKAQEYVTQ 672
            F+  P N+  V+ L+ +         K V  + ++ K +V TGTL K+ R +A+EY+ Q
Sbjct: 561 SFWSEPHNVAVVKDLIAQGIHWDNVEVKEVRDNPLKGKTVVLTGTLTKMGRSEAKEYLLQ 620

Query: 673 LGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           LG  VS  +S KTD +I G++ GSKL KA +LG+ I++E +FL LL 
Sbjct: 621 LGCKVSGSVSSKTDFVIAGESAGSKLTKATELGINILSENEFLALLA 667


>gi|332798609|ref|YP_004460108.1| DNA ligase [Tepidanaerobacter sp. Re1]
 gi|332696344|gb|AEE90801.1| DNA ligase [Tepidanaerobacter sp. Re1]
          Length = 675

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 254/720 (35%), Positives = 389/720 (54%), Gaps = 51/720 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           + I QA   +  L + I YH+  YY    P I D+EYD L R   ++   FP L     P
Sbjct: 1   MDIVQAENRIKELRESIDYHNYRYYVLDNPEITDAEYDKLMRELISLESQFPQLI---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE   +  KVTH  P +SL   ++ E+LR F  R+         N + + +E
Sbjct: 58  DSPSQRVGGEPLEAFKKVTHREPMISLADAFSEEELRDFNRRVTENVG----NQVEYVVE 113

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP---RVLSLNIPEIIEVR 188
            KIDG  +++ YE G  V AA RGDG  GEDV+  ++ I ++P    +    IP +IEVR
Sbjct: 114 LKIDGLAVSLTYENGLLVTAATRGDGVVGEDVTQNVKTIKSVPLRLNIQKDKIPMVIEVR 173

Query: 189 GEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS 247
           GE+Y+SK  F  LN+E   +G   +ANPRNAA+G +R+L+      R L+ F++ LG   
Sbjct: 174 GEIYLSKEGFKKLNEEREEMGLPTFANPRNAAAGSIRQLDSKITAKRPLSTFMYALGYVE 233

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
            I      E+L+  +  GF VN  ++  N F  ++ Y    K  R +LPY+IDG+V KV+
Sbjct: 234 GIEFNTHLEVLEFYKACGFKVNPHIKSFNNFDDVIDYCMSWKEKRHSLPYEIDGMVIKVN 293

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
               QK LG  A++PRW I++KF  +Q  + + DI + +GRTG+LTP A L PV I G+ 
Sbjct: 294 SLHFQKILGSTAKTPRWAIAYKFPAEQKISVIEDIVVSVGRTGVLTPNAVLTPVQIAGST 353

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           ++ ATLHNEDYIK            +DI +GD V+V++AG++IP+VV +I  +R  + + 
Sbjct: 354 VSRATLHNEDYIK-----------EKDIHIGDSVIVQKAGDIIPEVVAVIKEKRTGNEKE 402

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P  CP C S V+R           A+RCTG  +C AQ   R+ HF SRDA +I GLG
Sbjct: 403 FKMPHRCPECGSEVIRLPGE------VAYRCTGV-SCPAQIRRRIIHFASRDAMDIRGLG 455

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
              +            I+  +DI+ L++        +  +   G+ S  NL  +I   + 
Sbjct: 456 PAIVSLLLSEN----LIKDVSDIYFLKKE------ALIPLERMGEKSANNLIKAIENSKK 505

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
             L R +++LGI  +G++ + +LA+ + S                  +  LI++P +GD 
Sbjct: 506 QPLNRLVYALGIPLIGSKASLTLAQEFKSMDRLQNAT----------YEELIKIPEIGDK 555

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +A++I+ F++  +    +  L +     +   E+     +EN   V TG L+K  R KAQ
Sbjct: 556 MAESIIAFFKQEQTKALITRLKEAGVNMLYAKEEIGPKPLENLTFVLTGALEKYSRSKAQ 615

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL--QQYNTTL 725
           E +  LG  V+  +S+KTD ++VG +PGSK  KA +LGVKI++E+QF  ++   Q  T++
Sbjct: 616 ELIENLGGKVTGSVSKKTDYVVVGKDPGSKYNKALELGVKILDEQQFEEMISNAQAETSI 675


>gi|332970057|gb|EGK09055.1| NAD-dependent DNA ligase LigA [Desmospora sp. 8437]
          Length = 670

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 233/715 (32%), Positives = 379/715 (53%), Gaps = 53/715 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  ++A + + +L +EI  HD  Y+  ++P+I D EYDA+ R    +    P+L     P
Sbjct: 1   MERKEAEQRIEALRREIHEHDHRYHVLNQPVISDQEYDAMMRELLGLEQEHPELV---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE      KV H+ P LSL   +N E+L++F  RI R     + + + +  E
Sbjct: 58  DSPSQRVGGEPLPYFEKVRHTQPMLSLANAFNFEELQEFDRRIRR---LAEVDGVDYVCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            KIDG  ++IRYE+G  V  A RGDG +GE+++  ++ I ++P  L   +   +EVRGE 
Sbjct: 115 LKIDGLAVSIRYEEGVMVRGATRGDGTTGENITQNLKTIRSLPLRLRDAV--TLEVRGEA 172

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
           ++ + +F  +N +  + G   +ANPRNAA+G LR+L+P     R L+ F++G+G+     
Sbjct: 173 FLPRKEFERINRQKESRGETLFANPRNAAAGALRQLDPKLTAERALDIFLYGIGEIHGTE 232

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                 E L  +  LG  VN           ++ + +  +  R  L YDIDG+V KVD+ 
Sbjct: 233 TPGTHTESLDLLSRLGLKVNPDWVTVKGIDDVMQFIDHWREHREELGYDIDGIVIKVDDL 292

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            L+++LG  A+SPRW I++KF  ++  T L  ++I++GRTG +TP A L+PV + G  + 
Sbjct: 293 ELRERLGTTAKSPRWAIAYKFPAEEGVTVLRGVEIKVGRTGAVTPTALLDPVILAGTTVQ 352

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
            ATLHNED+I+            ++I +GD V+VK+AG++IP+VV ++   R  + +P+ 
Sbjct: 353 RATLHNEDFIR-----------EKEILLGDHVIVKKAGDIIPEVVGVVQERRTGEEKPYQ 401

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP C S +VR           A RC      +  + E + HFVSR A NIEGLG++
Sbjct: 402 MPTECPECGSELVRLEGE------VALRCINPQCPAQTR-EGIIHFVSRGAMNIEGLGEK 454

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +   F     A  +R PAD++ L+            +   G  SV NL  +I + +  S
Sbjct: 455 VVTQLFN----ADLVRGPADLYDLKAEDL------LPLERMGKKSVENLLAAIEESKQNS 504

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           +E+ IF LGIR VGA+ A  LA+++   +               D   L  V  +G  +A
Sbjct: 505 VEKLIFGLGIRFVGAKGALILAQHFGGLEAIMAA----------DREELEAVDEIGPKMA 554

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEK-----NVSSEIENKKLVFTGTLQKIQRH 664
           ++I  ++  P     +  L       + +        +  S    K +V TGTL+ + R 
Sbjct: 555 ESIETYFDKPEVKETLRRLEAAGVNMMYKGPAPVQRGDSDSPFAGKTVVLTGTLESMSRK 614

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +A + +   G  V+  +S+ TD +I G+  GSKL+KA+ LGV +++E+ FL +L+
Sbjct: 615 EAADRIEAQGGKVTGSVSKNTDYVIAGEKAGSKLKKARDLGVDVVDEQAFLAMLE 669


>gi|307266289|ref|ZP_07547829.1| DNA ligase, NAD-dependent [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918667|gb|EFN48901.1| DNA ligase, NAD-dependent [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 662

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 243/709 (34%), Positives = 383/709 (54%), Gaps = 49/709 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
           + ++ +  L ++I+YH+  YY   +P I D EYD L R    +   +P+      P+ P 
Sbjct: 2   EPKERIKELREKINYHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFK---TPDSPS 58

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++GGE        TH +P LSL   ++  +LR F  R+           + + +E KID
Sbjct: 59  QRVGGEPLKEFEPFTHVVPMLSLANAFSEGELRDFDRRVREAVG-----DVEYVVELKID 113

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISK 195
           G  + + YE G F   + RGDG  GE+V+  ++ I +IP  L L     + VRGEV++ +
Sbjct: 114 GLSVELIYENGIFTVGSTRGDGIVGENVTQNLKTIKSIP--LRLKDDASLVVRGEVFMPR 171

Query: 196 NDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQ 254
             F  LN+E   +G   +ANPRNAA+G LR+L+P     R L+ F+  L K      K  
Sbjct: 172 TSFEKLNEEREKLGESLFANPRNAAAGSLRQLDPKVTAKRDLDIFIFNLQKIEGRKFKTH 231

Query: 255 YEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQ 314
            E L+ ++  GF V    ++ +    ++    E++++R  LPYDIDG V KV++   ++ 
Sbjct: 232 IETLEFLKEQGFKVIPIHKKCSNIDEVIKEIEEIRNLRDKLPYDIDGAVVKVNDLEKREI 291

Query: 315 LGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLH 374
           LG+ A+ PRW I+ K+  ++  T++LDI +Q+GRTG LTP A LEPV I G++++ ATLH
Sbjct: 292 LGQTAKDPRWAIAFKYPAERKKTKVLDIIVQVGRTGALTPTAILEPVAISGSVVSRATLH 351

Query: 375 NEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFC 434
           NEDYIK            +DIR+GD V+V++AGE+IP+VV+++  ER    + F  P  C
Sbjct: 352 NEDYIK-----------EKDIRIGDTVIVQKAGEIIPEVVEVVKEERTGQEREFVMPDRC 400

Query: 435 PICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFF 494
           P C +  VR          A  RCTG L C AQ L  + HF S+DA +IEGLG   ++  
Sbjct: 401 PECGALAVRLPGE------AIRRCTG-LNCPAQLLRGIIHFASKDAMDIEGLGPAIINQL 453

Query: 495 FKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFI 554
                    I   AD++ L+            +   GD SV NL ++I + +   L+R +
Sbjct: 454 LSK----GLIHNIADLYYLKYEDLI------QLERMGDKSVKNLLNAIEESKTRDLDRLL 503

Query: 555 FSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVE 614
           F LGI  +G++ A+ +A+++ +  N  +            +    ++P +G  +A++IV 
Sbjct: 504 FGLGINLIGSKAAQVIAEHFKTMDNIMKA----------KFEDFTQLPDIGPKMARSIVS 553

Query: 615 FYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLG 674
           F+   +N+  +E L           +  VS+  E K  V TGTL+   R +A   + + G
Sbjct: 554 FFAEKQNVEIIEKLKNAGVNMKKLSKGKVSNIFEGKTFVLTGTLENYTREEATRMIEERG 613

Query: 675 AVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
             V+  +S+KTD I+VG +PGSKL+KAQ+LG+KI++E+QF  +L+  N 
Sbjct: 614 GKVTNSVSKKTDYILVGKDPGSKLKKAQELGIKIIDEKQFEEMLKGENI 662


>gi|171322051|ref|ZP_02910925.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MEX-5]
 gi|171092642|gb|EDT37943.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MEX-5]
          Length = 691

 Score =  575 bits (1482), Expect = e-161,   Method: Composition-based stats.
 Identities = 259/731 (35%), Positives = 389/731 (53%), Gaps = 56/731 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M + Q  P  +    Q     + L  ++   +  YY   +P + D+EYD L      +  
Sbjct: 1   MARTQAEPPAS----QPEARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFGELQQLET 56

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             P+L     P+ P  ++GGE+      V H  P LSL   +  ED+  F  R+     K
Sbjct: 57  DHPELV---TPDSPTQRVGGEVAGGFTPVVHDAPMLSLNNGFADEDIAAFDKRVADALNK 113

Query: 121 KDD------NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIP 174
             D        + +  E K DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP
Sbjct: 114 TTDLAGSVTEPVEYACELKFDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIP 173

Query: 175 RVLSLNI-PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DI 232
             L     P +++VRGEV + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P    
Sbjct: 174 LKLKGAHVPALLDVRGEVLMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITA 233

Query: 233 TRYLNFFVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSI 291
            R L+FF +G+G             +L      G PVN          G++ ++ ++   
Sbjct: 234 QRPLSFFAYGIGVLDGVPMPDTHSALLDWYESFGLPVNRERAVVYGADGLLGFFRKVGEK 293

Query: 292 RSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGI 351
           R +LPYDIDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG 
Sbjct: 294 RESLPYDIDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGA 353

Query: 352 LTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIP 411
           +TPVARLEPV +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP
Sbjct: 354 ITPVARLEPVFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIP 402

Query: 412 KVVDIIVNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLER 471
           +VV  +++ R  DA  F  P+ CP+C S++ R  +       A  RCTGGL C AQ+ + 
Sbjct: 403 EVVGALLDRRPDDAAEFVMPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQA 456

Query: 472 LKHFVSRDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFG 531
           L HF  R A +I+GLG++ +D   +       +R PAD+F L          +  +  F 
Sbjct: 457 LWHFAQRRALDIDGLGEKIIDQLVE----LSLVRTPADLFNL------GFATLAELDRFA 506

Query: 532 DVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHN 591
           + S  NL DS+ K ++ +L RFI+ LGIRHVG   A+ LAK++ S               
Sbjct: 507 EKSAQNLLDSLEKAKHTTLARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA-------- 558

Query: 592 NDDWLSLIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIE 648
                 L+ V  VG I+A++I +F+    N   +E L      +        K     + 
Sbjct: 559 --SIEELLEVNDVGPIVAESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLA 616

Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKI 708
            K +V TGTL  + R  A+E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +
Sbjct: 617 GKTVVLTGTLPNLTRDAAKEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPV 676

Query: 709 MNEEQFLFLLQ 719
           ++E+    LL+
Sbjct: 677 LDEDGLHQLLE 687


>gi|330445331|ref|ZP_08308983.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489522|dbj|GAA03480.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 671

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 252/714 (35%), Positives = 407/714 (57%), Gaps = 48/714 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SI+  ++EL +L +++ YH   YY    P I D+EYD + ++   I    P+       
Sbjct: 1   MSID-LQQELFTLREQLDYHGHRYYVEDNPEIPDAEYDRMMQQLLKIEAEHPEWVTV--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG       +V H I  LSL+  +N +DLR F  R+    +    + + +  E
Sbjct: 57  DSPSQRVGGTALEGFTQVKHEIAMLSLDNAFNDDDLRAFQKRLQDRLRS--GSELNYCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L   + P  +EVRGE
Sbjct: 115 PKLDGLAVSLMYENGVLVQAATRGDGATGENITHNVRTIRAIPLKLQGTDWPARLEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-E 248
           V++ K  F ALN++ +  G K +ANPRNAA+G LR+L+P    TR L+F+ + +G     
Sbjct: 175 VFMPKKGFEALNEKALKKGEKTFANPRNAAAGSLRQLDPKITATRPLSFYAYAVGVVEGR 234

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             A+ QYE L +++  G P+   +R+ ++   ++ Y+  +   R +L Y+IDG+V KVD 
Sbjct: 235 ELAETQYERLCQLKAWGLPMCPEIRKVDSIEEVIVYHQSIGEKRQSLGYEIDGVVIKVDG 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
              Q+QLG  AR+PRW I++KF  ++  T L +++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IDTQQQLGFVARAPRWAIAYKFPAQEEMTVLNNVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D ++ L            + +GD V+++RAG+VIP++  ++ + R   AQ  
Sbjct: 355 SNATLHNADEVERL-----------GVMIGDTVIIRRAGDVIPQIASVVESRRPESAQAI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+CQS++ R          A  RCTGGL C AQ+ E LKHFVSR A +++G G+
Sbjct: 404 VFPTECPVCQSKIERIEGE------AVARCTGGLFCQAQRKEALKHFVSRKALDVDGCGE 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F      + S  ++  +   G  S   L D++   +  
Sbjct: 458 KVIEQLVDRE----MVATPADLF------KFSAGEVTVLERMGPKSAQKLVDALKASKLT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RFI+SLGIR VG   A +LA Y+ + +  +Q               LI VP VGD++
Sbjct: 508 TLPRFIYSLGIREVGEATAANLANYFETLEAISQATK----------EQLIEVPDVGDVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A  I  F++   N+  V+ L +     P I + E+ +   +E K +V TG+L ++ R  A
Sbjct: 558 AAHIFNFFREEHNMAVVKDLQEVGIHWPEIEKPEEGIELPLEGKTVVLTGSLSQLTRSDA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +  + +LGA V+  +S+KTD+++ G+  GSKL KAQ+L ++I +E++ + L+ +
Sbjct: 618 KAALQKLGAKVTGSVSKKTDLLVAGEAAGSKLAKAQELDIEIWDEQKLVDLMSK 671


>gi|167586849|ref|ZP_02379237.1| DNA ligase, NAD-dependent [Burkholderia ubonensis Bu]
          Length = 691

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 257/715 (35%), Positives = 385/715 (53%), Gaps = 52/715 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      I    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANHAYYVLDQPDLPDAEYDRLFLELQQIEADHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GG +      V H  P LSL   +  ED+  F  RI     K  D      + + +  E 
Sbjct: 72  GGAVAGGFTPVVHDAPMLSLNNGFEDEDIVAFDKRIADALDKAVDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV A+ RGDG +GEDV+  +R I ++P  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYENGVFVQASTRGDGTTGEDVTQNVRTIRSLPLKLKGRNLPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE-I 249
            + K DF  LN+   A G++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAGQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGAP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN         +G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYETLGLPVNRERAVVRGANGLLGFFRKIGEQRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQERLGFVSRAPRFALAHKFPAQEALTTLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R   A  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGAVLDRRPDPAPEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C SR+ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSRIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVEQN----LVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLNPIMDAT----------VEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+ +
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLEGH 689


>gi|116690045|ref|YP_835668.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia HI2424]
 gi|166215562|sp|A0K8E8|DNLJ_BURCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215593|sp|Q1BHI7|DNLJ_BURCA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116648134|gb|ABK08775.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia HI2424]
          Length = 691

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 386/713 (54%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFRELQQLETDHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE       V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEAAGGFTPVVHDAPMLSLNNGFADEDIVAFDKRVADALAKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEQGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGKHVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+      R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDSKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESLGLPVNRERAVVHGAEGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLIDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +++ +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESLHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|107028796|ref|YP_625891.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia AU 1054]
 gi|105897960|gb|ABF80918.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia AU 1054]
          Length = 746

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 386/713 (54%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    P+L     P+ P  ++
Sbjct: 70  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFRELQQLETDHPELV---TPDSPTQRV 126

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE       V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 127 GGEAAGGFTPVVHDAPMLSLNNGFADEDIVAFDKRVADALAKTTDLAGSVTDPVEYACEL 186

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 187 KFDGLAISLRYEQGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGKHVPAVLDVRGEV 246

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+      R L+FF +G+G      
Sbjct: 247 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDSKITAQRPLSFFAYGIGVLDGMP 306

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 307 MPDTHSALLDWYESLGLPVNRERAVVHGAEGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 366

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 367 DEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 426

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 427 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPADAAEFV 475

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 476 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 529

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 530 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLIDSLEKAKHTT 579

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 580 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 629

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +++ +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 630 ESLHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 689

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 690 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 742


>gi|197336238|ref|YP_002156719.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
 gi|254781450|sp|B5FGU7|DNLJ_VIBFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197317728|gb|ACH67175.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
          Length = 668

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 257/713 (36%), Positives = 400/713 (56%), Gaps = 50/713 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SIEQ    L  L+Q+++YH   YY    P + D+EYD + +   +I    P+L      
Sbjct: 1   MSIEQT---LDELKQQLNYHAYRYYVEDSPELPDAEYDRMMQELLSIESEHPELVTV--- 54

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE      ++ H IP LSL+  ++ E+L  F  R+      K  +   F  E
Sbjct: 55  DSPSQRVGGEALDGFTQIQHEIPMLSLDNAFSDEELEAFEKRMNDRLISKPVS--LFCCE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ Y  GK V A  RGDG +GE+++  +R I  IP  L     P  +EVRGE
Sbjct: 113 PKLDGLAVSLLYVNGKLVQAGTRGDGTTGENITENVRTIRCIPLTLQGEGWPTRLEVRGE 172

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE- 248
           V++ K  F ALN+  +  G KP+ANPRNAA+G LR+L+     TR L+F+ + +G     
Sbjct: 173 VFMPKAGFEALNERALKRGEKPFANPRNAAAGSLRQLDSKITATRPLSFYAYSVGVIEGG 232

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 Y+   +++  G P+    +Q  +   + +YY ++   R  L Y+IDG+V KVD+
Sbjct: 233 ELETSHYQRFVQLKSWGLPMCEETKQCYSLTEVKAYYKDILKRRDALKYEIDGVVIKVDD 292

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 293 IALQEQLGFVARAPRWAIAYKFPAQEELTVLNDVEFQVGRTGAITPVAKLEPVFVGGVTV 352

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I  L            + +GD V+++RAG+VIP++V ++   R  D++  
Sbjct: 353 SNATLHNADEIARL-----------GVHIGDTVIIRRAGDVIPQIVSVVEARRPTDSKAI 401

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            +P+ CP+C S + R          A  RC  GL C AQ+ E LKHFVSR A +++GLG 
Sbjct: 402 VYPTHCPVCGSNLERVEGE------AVTRCGAGLVCQAQRKEALKHFVSRKALDVDGLGD 455

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   +  +   G  S  N+ D++NK +  
Sbjct: 456 KVVEQLVDKE----MVETPADLFKL------SAGVLTVLERMGPKSAQNVVDALNKAKAT 505

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA ++ + +                +  LI V  VGDI+
Sbjct: 506 TLPRFLYSLGIREVGEATAANLAAHFYTLEAIQVAT----------FEQLIEVSDVGDIV 555

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A+ ++ F+  P N   ++ L +     P I   +++V   +  K +V TGTL K++R++A
Sbjct: 556 AKHVLNFFAEPHNKTVIDDLQEMGIHWPEIKALDESVPQPLAGKVVVLTGTLHKLKRNEA 615

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +  + +LGA V+  +S+KTDI+  G+  GSKL KA++LGV++MNEEQ + LL 
Sbjct: 616 KAALQELGAKVTGSVSKKTDILFAGEAAGSKLAKAEELGVEVMNEEQLIELLN 668


>gi|289577826|ref|YP_003476453.1| DNA ligase, NAD-dependent [Thermoanaerobacter italicus Ab9]
 gi|289527539|gb|ADD01891.1| DNA ligase, NAD-dependent [Thermoanaerobacter italicus Ab9]
          Length = 662

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 238/707 (33%), Positives = 386/707 (54%), Gaps = 49/707 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           ++ ++ L ++I+YH+  YY   +P I D EYD L R    +   +P+L     P+ P  +
Sbjct: 4   KERINELREKINYHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPELK---TPDSPSQR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           +GGE        TH +P LSL   ++  +L+ F  R+           + + +E KIDG 
Sbjct: 61  VGGEPLKEFEPFTHIVPMLSLANAFSEGELKDFDRRVREAVG-----DVEYVVELKIDGL 115

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKND 197
            + + YE G F   + RGDG  GE+V+  ++ I +IP  L  N+   + VRGEV++ +  
Sbjct: 116 SVELIYENGIFTVGSTRGDGIIGENVTPNLKTIKSIPLRLKDNVS--LVVRGEVFMPRAS 173

Query: 198 FLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKGQYE 256
           F  LN E   +G   +ANPRNAA+G LR+L+P     R L+ F+  L +      K   E
Sbjct: 174 FERLNTEREKLGESLFANPRNAAAGSLRQLDPKVTAKRDLDIFIFNLQRVEGRKFKTHVE 233

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            LQ ++  GF V    ++ +    ++    E+++++  LPYDIDG V KV++   ++ LG
Sbjct: 234 TLQFLKEQGFKVIPIHKKCSNIDEVIREIEEIRNLKDKLPYDIDGAVVKVNDLEKREILG 293

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
           + A+ PRW I+ K+  ++  T++LDI +Q+GRTG LTP A LEPV I G++++ ATLHNE
Sbjct: 294 QTAKEPRWAIAFKYPAERKKTKVLDIIVQVGRTGALTPTAILEPVPISGSVVSRATLHNE 353

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           DYIK            +DIR+GD V++++AGE+IP+VV+++  ER    + F  P+ CP+
Sbjct: 354 DYIK-----------EKDIRIGDTVIIQKAGEIIPEVVEVVKEERTGHEREFIMPNKCPV 402

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C +  VR          A  RCT    C AQ L  + HF S+DA +IEGLG   ++    
Sbjct: 403 CGALAVRLPGE------AVRRCTSV-NCPAQLLRGIIHFASKDAMDIEGLGPAIINQLLS 455

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
           +      I   AD++ L+            +   GD SV NL ++I + +   L+R +F 
Sbjct: 456 N----GLIHNIADLYYLKYEDLI------QLERMGDKSVKNLLNAIEESKTRDLDRLLFG 505

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGI  +G++ A+ +A+++ +  +  +            +    ++P VG  +A++IV F+
Sbjct: 506 LGINLIGSKAAQVIAEHFKTMDDIMKA----------KFEDFTKLPDVGPKMARSIVSFF 555

Query: 617 QNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAV 676
              +N+  +E L K         ++ VSS  E K  V TG L+   R +A   + + G  
Sbjct: 556 AEKQNVETIEKLKKAGVNMKKLSKEKVSSIFEGKTFVLTGALENYTREEATRIIEERGGK 615

Query: 677 VSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
           V+  +S+KTD ++VG +PGSKL+KAQ+LG++I++E+QF  +L+  N 
Sbjct: 616 VTNSVSKKTDYVLVGKDPGSKLKKAQELGIEIIDEKQFEEMLKGENI 662


>gi|170733380|ref|YP_001765327.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia MC0-3]
 gi|254781274|sp|B1JUF5|DNLJ_BURCC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169816622|gb|ACA91205.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia MC0-3]
          Length = 691

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 386/713 (54%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    P+L     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANHAYYVLDQPDLPDAEYDRLFRELQQLETDHPELV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE       V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEAAGGFTPVVHDAPMLSLNNGFADEDIVAFDKRVADALAKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV AA RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEQGVFVQAATRGDGTTGEDVTENVRTIRSIPLKLKGKHVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+      R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDSKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESLGLPVNRERAVVHGAEGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q++LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQERLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLIDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           +++ +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESLHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|283832193|ref|ZP_06351934.1| DNA ligase, NAD-dependent [Citrobacter youngae ATCC 29220]
 gi|291071830|gb|EFE09939.1| DNA ligase, NAD-dependent [Citrobacter youngae ATCC 29220]
          Length = 671

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 243/711 (34%), Positives = 390/711 (54%), Gaps = 48/711 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E   ++L+ L   + +H+  Y+    P I D EYD L  +   +    P+L     P+ 
Sbjct: 1   MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDVEYDLLMHKLQWLEALHPELI---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  ++ H +P LSL+ +++ E    F  R+      K  + + +  E K
Sbjct: 58  PTQRVGAAPLTAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL--KSTDKLTWCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPE-IIEVRGEVY 192
           +DG  ++I YE G  V AA RGDG +GED+++ +R I  IP  L        +EVRGEV+
Sbjct: 116 LDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLRGENIPTRLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  +N+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 LPQAGFEKINEEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGAL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  L + +  G PV++ V   ++   +++YY++++  R TL +DIDG+V KV+  +
Sbjct: 236 PDTHLGRLLQFKAWGLPVSDRVALCDSPEEVLAYYHKVEEDRPTLGFDIDGVVIKVNSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G L++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD+V+++RAG+VIP+VV+++++ER  + +   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDKVVIRRAGDVIPQVVNVVLSERPEETREIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PQHCPVCNSDVERVEGE------AVARCTGGLICGAQRKESLKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     +  PAD+FTL         K+  +   G  S  N+ +++ K +  + 
Sbjct: 459 IDQLVEKE----YVHTPADLFTLTA------GKLTGLDRMGPKSAQNVVNALEKAKETTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A  LA Y+ +                     L +VP VG ++A 
Sbjct: 509 ARFLYALGIREVGEATAAGLAAYFGTLDALEAA----------SIEELQKVPDVGIVVAT 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS---PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
            +  F+    N   +  LL +       +  + + + S    K +V TG+L  + R  A+
Sbjct: 559 HVFNFFAEESNREVIGQLLAQGIHWPAPVVINAEEIDSPFAGKTVVLTGSLSLMSRDDAK 618

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
             +T+LGA V+  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 ARLTELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLL 669


>gi|221215451|ref|ZP_03588415.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD1]
 gi|221164635|gb|EED97117.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD1]
          Length = 691

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 383/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L R    +    PDL     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANHAYYVLDQPDLPDAEYDRLFRELQQLESDHPDLV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GG +      V H  P LSL   +  +D+  F  R+     K  D      + + +  E 
Sbjct: 72  GGAVASGFTPVVHDAPMLSLNNGFADDDIVAFDKRVADALGKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGERVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN          G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYEALGLPVNRERAVVYGAQGLLDFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A T+L+ I +Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIGVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGAVLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLKKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI++LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYALGIRHVGESTAKDLAKHFGSLDPIMNAT----------IDELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDDA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD +I G   GSKL KA+ LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVIAGAEAGSKLAKAEALGIPVLDEDGLHQLLE 687


>gi|307729327|ref|YP_003906551.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1003]
 gi|307583862|gb|ADN57260.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1003]
          Length = 688

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 261/722 (36%), Positives = 389/722 (53%), Gaps = 49/722 (6%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
            P    +     +  + L  E+   +  YY   +P + D+EYD L +  ++I    PDL 
Sbjct: 4   TPASNPATSAPAERAAWLRTELERANYAYYVLDQPDLPDAEYDRLFKELESIEAEHPDLI 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQ---KKDD 123
               P+ P  ++GGE       V H  P LSL   +  ED+  F  R+        K+  
Sbjct: 64  V---PDSPTQRVGGEAASGFEPVVHDQPMLSLNNGFADEDIIAFDKRVGDALGNNAKEPP 120

Query: 124 NSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-P 182
             + +  E K DG  I++RY  G FV AA RGDG +GE+V+  IR + +IP  L     P
Sbjct: 121 VPVDYATELKFDGLAISLRYVDGVFVQAATRGDGTTGENVTENIRTVRSIPLRLKGKRVP 180

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            I++VRGEV + K DF  LN+   A G K +ANPRNAA+G LR+L+      R L+FF +
Sbjct: 181 HILDVRGEVLMFKRDFERLNERQRAAGHKEFANPRNAAAGSLRQLDSKITAQRPLSFFAY 240

Query: 242 GLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           G+G            E+L   + LG PVN          G+++++  +   R  LPYDID
Sbjct: 241 GIGVLDGMEMPATHSELLDWYKELGLPVNAERAVVKGAEGLLAFFRAVGEKRDKLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKV+    Q+ LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEP
Sbjct: 301 GVVYKVNRRDEQEALGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ 
Sbjct: 361 VFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSALLDR 409

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ F  P+ CP+C S + R  +       A  RCTGGL C AQ+ + L HF  R A
Sbjct: 410 RPADAREFVMPTHCPVCGSNIERLPDE------AIARCTGGLICPAQRKQALWHFAQRRA 463

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +I+GLG++ +D   +       +R PAD+F L          +  +  F D S  NL D
Sbjct: 464 MDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFATLAELDRFADKSAQNLLD 513

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           S+ K ++ +L RFI++LGIRHVG   A+ LAK++ S                    +L+ 
Sbjct: 514 SLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA----------SVEALLE 563

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGT 657
           V  VG ++A++I +F+    N   +E L      +        K     +  K +V TGT
Sbjct: 564 VNDVGPVVAESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTIVLTGT 623

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           L  + R  A+E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    L
Sbjct: 624 LPTLSREDAKEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGMRKL 683

Query: 718 LQ 719
           L+
Sbjct: 684 LE 685


>gi|78485583|ref|YP_391508.1| DNA ligase, NAD-dependent [Thiomicrospira crunogena XCL-2]
 gi|123741582|sp|Q31G89|DNLJ_THICR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78363869|gb|ABB41834.1| DNA ligase, NAD-dependent [Thiomicrospira crunogena XCL-2]
          Length = 672

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 265/711 (37%), Positives = 403/711 (56%), Gaps = 48/711 (6%)

Query: 18  RKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNK 77
           +K    L + ++ H   YY    PII D +YD L ++   I    PD      P  P  +
Sbjct: 4   QKAYQKLVESLNQHSYQYYVLDDPIISDPQYDVLYQKLLRIEDEHPDWIL---PESPSQR 60

Query: 78  IGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGT 137
           IG E       V H++P  SL+  +  ++L+ F+ RI       D  S+ F+ EPK+DG 
Sbjct: 61  IGDEPLKEFHTVRHAVPMYSLDNAFEDDELKSFLKRIEEKL--PDQKSLAFSAEPKMDGL 118

Query: 138 MITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVYISKN 196
            I IRYE G+ V A  RGDG  GEDV+  IR I ++P  L  N  PE++EVRGEV++SK+
Sbjct: 119 AINIRYENGQLVQATTRGDGQVGEDVTHNIRPIYSVPLKLFGNNWPEVVEVRGEVFMSKS 178

Query: 197 DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIFAKGQY 255
            F  LN+    +G K +ANPRNAA+G LR+L+      R+L+FF++G G+ S+ +   QY
Sbjct: 179 AFEQLNEHQQEIGGKIFANPRNAAAGSLRQLDSKVAAKRHLSFFLYGWGELSDDWQLPQY 238

Query: 256 E--MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
              M++++   G P N      +   G+ +YY ++++ RS LPY+IDG+VYK+++  LQ+
Sbjct: 239 YSEMIEQLVEWGLPANPQSEIISGLEGMFAYYEKIQAKRSELPYEIDGIVYKLNDIKLQQ 298

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  AR+PRW I+ KF  ++  T+LLDI++Q+GRTG +TPVARL+PV++GG +++NATL
Sbjct: 299 QLGFTARAPRWAIARKFPAEEVWTKLLDIEVQVGRTGAITPVARLQPVSVGGVIVSNATL 358

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HN D IK            +D+R+GD V+V+RAG+VIP+VV  I+ +R  + Q F  P  
Sbjct: 359 HNMDEIKR-----------KDVRIGDTVIVRRAGDVIPEVVGPILTQRPENTQLFEMPQH 407

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C S VV++L+       A  RCTGGL C AQ+   L HFVSR A +I+GLG + +D 
Sbjct: 408 CPECGSDVVKELDK------AVFRCTGGLVCPAQRKRALHHFVSRKAMDIQGLGDKLIDQ 461

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
                     ++ P D + L   +  +      +    + S  N+   I      +L +F
Sbjct: 462 LVDK----GWVKHPDDFYHLTVEKLAT------LERMAEKSAQNVITGIQASLETTLAKF 511

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           I+SLGI  VG   A++LA ++       Q           ++  LI +  VG+++A+ IV
Sbjct: 512 IYSLGIPEVGEVTAKNLANHFKDLNAIKQA----------EFEELITLNDVGEVVAEHIV 561

Query: 614 EFYQNPRNICAVEALLKEV--SPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
            F++ P N   ++ LL      P+      N  S   NK +V TGTL ++ R +A+  + 
Sbjct: 562 NFFKEPHNESVIQGLLDAGMHWPTPETTLVNEDSPFANKVVVLTGTLSEMSRPEAKVLLE 621

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYN 722
             GA ++  +S KTD +I G+  GSKL KA+ LGV +++E ++L ++ Q +
Sbjct: 622 AQGAKITGSVSAKTDYVIAGEKAGSKLTKAESLGVAVLSEAEWLAMMPQQD 672


>gi|161524425|ref|YP_001579437.1| DNA ligase, NAD-dependent [Burkholderia multivorans ATCC 17616]
 gi|189350820|ref|YP_001946448.1| NAD-dependent DNA ligase [Burkholderia multivorans ATCC 17616]
 gi|254781276|sp|A9AIK9|DNLJ_BURM1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160341854|gb|ABX14940.1| DNA ligase, NAD-dependent [Burkholderia multivorans ATCC 17616]
 gi|189334842|dbj|BAG43912.1| NAD-dependent DNA ligase [Burkholderia multivorans ATCC 17616]
          Length = 691

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/712 (35%), Positives = 384/712 (53%), Gaps = 52/712 (7%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
             + L  ++   +  YY   +P + D+EYD L R    +    PDL     P+ P  ++G
Sbjct: 16  RAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFRELQQLESDHPDLV---TPDSPTQRVG 72

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEPK 133
           G +      V H  P LSL   +  +D+  F  R+     K  D      + + +  E K
Sbjct: 73  GAVASGFTPVVHDAPMLSLNNGFADDDIVAFDKRVADALGKTTDLAGSVTDPVEYACELK 132

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
            DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP  L  +  P +++VRGEV 
Sbjct: 133 FDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGDRVPAVLDVRGEVL 192

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EIF 250
           + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G       
Sbjct: 193 MFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMPM 252

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                 +L     LG PVN          G++ ++ ++   R +LPYDIDG+VYKV+   
Sbjct: 253 PDTHSALLDWYEALGLPVNRERAVVYGAQGLLDFFRKVGEKRESLPYDIDGVVYKVNRRD 312

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q +LG  +R+PR+ ++HKF  ++A T+L+ I +Q+GRTG +TPVARLEPV +GGA +TN
Sbjct: 313 EQDRLGFVSRAPRFALAHKFPAQEALTKLVAIGVQVGRTGAITPVARLEPVFVGGATVTN 372

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F  
Sbjct: 373 ATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGAVLDRRPADAAEFVM 421

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++ 
Sbjct: 422 PTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEKI 475

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +L
Sbjct: 476 IDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTTL 525

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RFI++LGIRHVG   A+ LAK++ S                     L+ V  VG I+A+
Sbjct: 526 ARFIYALGIRHVGESTAKDLAKHFGSLDPIMNAT----------IDELLEVNDVGPIVAE 575

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +I +F+    N   +E L      +        K     +  K +V TGTL  + R  A+
Sbjct: 576 SIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDDAK 635

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           E +   GA V+  +S+KTD +I G   GSKL KA+ LG+ +++E+    LL+
Sbjct: 636 EMLEAAGAKVAGSVSKKTDYVIAGAEAGSKLAKAEALGIPVLDEDGLHQLLE 687


>gi|325529285|gb|EGD06234.1| NAD-dependent DNA ligase [Burkholderia sp. TJI49]
          Length = 691

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 254/715 (35%), Positives = 384/715 (53%), Gaps = 52/715 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    P+      P+ P  ++
Sbjct: 15  ARAAWLRDQLQQANYAYYVLDQPDLPDAEYDRLFAELQQLEADHPEFV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE+      V H  P LSL   +  +D+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEVASGFTPVVHDAPMLSLNNGFADDDIVAFDKRVADALGKAVDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE+G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYERGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGADVPAVLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L     LG PVN      +   G++ ++ ++   R  LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSGLLDWYETLGLPVNRERAVVHGADGLLGFFRKVGEKRDGLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A T+L+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTKLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGAVLDRRPADAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
             RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 RARFIYGLGIRHVGESTAKDLAKHFGSLDPIMNA----------SIDELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           +E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++EE    LL+ +
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEEGLHQLLEGH 689


>gi|317049042|ref|YP_004116690.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
 gi|316950659|gb|ADU70134.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
          Length = 672

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 251/712 (35%), Positives = 399/712 (56%), Gaps = 49/712 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++  ++++++L   + +H+  Y+    P + D+EYD L  +   +  A P+L     P+ 
Sbjct: 1   MKSVQEQITALRTTLRHHEYLYHVMDTPEVPDAEYDRLMAQLRELESAHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+  ++      F  R+    +  DD  + +  E K
Sbjct: 58  PTQRVGAAPLAAFEQVRHEVPMLSLDNTFDEAGFLAFNKRVQDRLKSSDD--LTYCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G  V AA RGDG +GE+++A +R I  IP  L  +  P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEDGLLVSAATRGDGTTGENITANVRTIHAIPLRLHGDNIPARVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           ++++ F  LN++    G K +ANPRNAA+G LR+L+P     R L FF +GLG       
Sbjct: 176 MTESGFEKLNEDARRTGAKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGLGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
                  LQ+ +  G PV++ +R AN    ++++Y E++  R TL +DIDG+V KVD  +
Sbjct: 236 PASHLGRLQQFKAWGLPVSDRIRLANNADDVLAFYREVEEARPTLGFDIDGVVIKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEQLGFVARAPRWAVAFKFPAQEQMTVVRDVEFQVGRTGAITPVARLEPVQVAGVVVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I  L            +R+GD+V+++RAG+VIP+VV+++ +ER  D +   F
Sbjct: 356 ATLHNADEIARL-----------GLRIGDKVVIRRAGDVIPQVVNVVESERPEDTREIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           PS CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A +++G+G + 
Sbjct: 405 PSHCPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRALDVDGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L         K+  +   G  S  N+ D++ K +  +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKFTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++   +               D  +LI V  VG ++A 
Sbjct: 509 PRFLYALGIREVGEATAANLANHFGELEKVMDA----------DLDALIAVQDVGQVVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHE----KNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F     N   +  L +E+     + E      + S    K +V TG+L ++ R  A
Sbjct: 559 HVRNFMDEESNREVIRELTQEMGVHWPQVEVVNAAEIDSPFAGKTVVLTGSLSQMNRDDA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL
Sbjct: 619 KARLTALGAKVSGSVSKKTDLLIAGEAAGSKLAKAQELGIAVIDEAEMIRLL 670


>gi|37525354|ref|NP_928698.1| NAD-dependent DNA ligase LigA [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81416713|sp|Q7MBH2|DNLJ_PHOLL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|36784781|emb|CAE13691.1| DNA ligase (polydeoxyribonucleotide synthase [NAD+]) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 672

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 238/714 (33%), Positives = 389/714 (54%), Gaps = 49/714 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   +++  L   + +H+  Y+    P I D+EYD L +    +   +P+L  S   + 
Sbjct: 1   MKSTAQQIEKLRTTLRHHEYLYHVMDAPEIPDAEYDRLMQELQDLEEQYPELITS---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  +IG     +  +V H IP LSL+ +++ E    F  R+      K+   +    E K
Sbjct: 58  PTQRIGAAPLAAFEQVRHEIPMLSLDNVFDEESYLAFDKRVRDRL--KETQDLVVCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE G+ V AA RGDG +GE++++ IR I  IP  L     P  IE+RGEV+
Sbjct: 116 LDGLAVSLLYENGELVRAATRGDGTTGENITSNIRTIGAIPLRLFGENIPARIEIRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           + +  F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MPQKGFEKLNEEARRTGAKVFANPRNAAAGSLRQLDPRITAKRPLAFFCYGVGILEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               YE L + +  G PV++ V+       ++ +Y+++ + RS L +DIDG+V K++   
Sbjct: 236 PASHYERLIQFKKWGLPVSDKVKVCTDSQQVIDFYHDIVNQRSALGFDIDGVVVKINSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+ LG  AR+PRW  + KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQEILGFVARAPRWATAFKFPAQEQMTIVRDVEFQVGRTGAITPVARLEPVQVSGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GD V+++RAG+VIP+VV ++   R  D+    F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDTVIIRRAGDVIPQVVGVLEERRPQDSNVVVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP+C + + R          A  RCTGGL C AQ+ E L+HFVSR A +++G+G++ 
Sbjct: 405 PEHCPVCGADIERIEGE------AVARCTGGLVCGAQRKEALRHFVSRRAMDVDGMGEKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D     E     ++ PAD+F L         K+  +   G  S  N+ D++ K +  + 
Sbjct: 459 IDQLVDKE----YVKTPADLFRLTA------GKLTGLDRMGPKSAQNVVDALEKAKKTTF 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++                   D  +L  V  VG+++A+
Sbjct: 509 ARFLYALGIREVGEATAANLAAHFGELDKLRSA----------DEEALKEVQDVGEVVAK 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGR----HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +V F+  P N   ++ L+ ++  +         + + S    K +V TG+L ++ R +A
Sbjct: 559 HVVNFFIEPHNQTVIDDLIDDIGINWEPVVVTRAEKIDSPFSGKTVVLTGSLHQLSRDEA 618

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +  +  LGA V+  +S+KTD++I G+  GSKL KA +L + +++EE+ + LL +
Sbjct: 619 KAKLVALGAKVTGSVSKKTDLVIAGEAAGSKLAKANELNIPVIDEEEMIRLLGE 672


>gi|172060972|ref|YP_001808624.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MC40-6]
 gi|254781273|sp|B1YSH2|DNLJ_BURA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|171993489|gb|ACB64408.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MC40-6]
          Length = 691

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 257/713 (36%), Positives = 383/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    PDL     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFGELQQLETDHPDLV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE+      V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEVAGGFTPVVHDAPMLSLNNGFADEDIAAFDKRVADALGKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGAHVPALLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L      G PVN          G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESFGLPVNRERAVVYGADGLLGFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A TRL+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTRLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  ++  R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLERRPDDAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        K     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWPEGPPAPKAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|293391716|ref|ZP_06636050.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952250|gb|EFE02369.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 671

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 246/708 (34%), Positives = 392/708 (55%), Gaps = 45/708 (6%)

Query: 16  QARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPL 75
             ++++  L + + +H+  Y+    P I DSEYD L  +  A+    P+L  +   + P 
Sbjct: 4   SIQQQIDDLRKTLRHHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELVTA---DSPT 60

Query: 76  NKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKID 135
            ++G        ++ H IP LSL+  ++ E+   F+ RI           + F  EPK+D
Sbjct: 61  QRVGARPLSEFAQIRHEIPMLSLDNAFSNEEFFAFVKRIQDRLALVP-EPLTFCCEPKLD 119

Query: 136 GTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVL-SLNIPEIIEVRGEVYIS 194
           G  ++I Y  G    AA RGDG +GED++  IR I  IP  L + N P  +EVRGEV++ 
Sbjct: 120 GLAVSILYVNGVLTQAATRGDGTTGEDITQNIRTIRNIPLQLLTDNPPARLEVRGEVFMP 179

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNF-FVHGLGKTS-EIFAK 252
              F  LN+  +  G K +ANPRNAA+G LR+L+P   ++       + +G         
Sbjct: 180 HAGFERLNERALQHGEKTFANPRNAAAGSLRQLDPKITSQRPLMLNAYSIGIAEGVELPP 239

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
             +E LQ ++ +G PVNN ++  +    ++++Y  + + RS+L YDIDG V K+++ +LQ
Sbjct: 240 THFERLQWLKSVGIPVNNEIQLCDGIENVLNFYRTIMAKRSSLGYDIDGAVLKINDIALQ 299

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           ++LG  +++PRW I++KF  ++  T L +++ Q+GRTG +TPVA+L+PV + G  ++NAT
Sbjct: 300 QRLGFISKAPRWAIAYKFPAQEELTELNEVEFQVGRTGAITPVAKLKPVFVAGVTVSNAT 359

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN D I+ L           +I +GD V+++RAG+VIP+++ ++ + R  DA+   FP+
Sbjct: 360 LHNGDEIERL-----------NIAIGDTVIIRRAGDVIPQIIGVVHDRRPADARQIVFPT 408

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP+C S +VR          A  RCTGGL C+AQ+ E LKHFVSR A +I+G+G + ++
Sbjct: 409 ECPVCGSLIVRIEGE------AVARCTGGLFCAAQRKEALKHFVSRKAMDIDGVGGKLIE 462

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
                E     I  PAD+F L        T +  +   G  S  N   S+ K +N +L R
Sbjct: 463 QLVDRE----LIHTPADLFKL------DLTTLSRLERMGPKSAENALTSLEKAKNTTLAR 512

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
           FIF+LGIR VG   A +LA ++ + +               D   L +VP VG+++A  I
Sbjct: 513 FIFALGIRDVGEATALNLANHFKTLEALQNA----------DLEQLQQVPDVGEVVANRI 562

Query: 613 VEFYQNPRNICAVEALLKEVS-PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
             F+    N+  VE L+ +         ++   +  + K +V TGTL ++ R+ A+  + 
Sbjct: 563 FVFWHEAHNVAVVEDLIAQGVHWETVDVQEVKENPFKGKTVVLTGTLSQMGRNDAKALLQ 622

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           QLGA VS  +S KTD +I G+  GSKL KA +LGV++++EE+FL  + 
Sbjct: 623 QLGAKVSGSVSAKTDYVIAGEAAGSKLSKAAELGVQVLSEEEFLGWIN 670


>gi|269138493|ref|YP_003295193.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|267984153|gb|ACY83982.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|304558517|gb|ADM41181.1| DNA ligase [Edwardsiella tarda FL6-60]
          Length = 675

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 259/716 (36%), Positives = 397/716 (55%), Gaps = 52/716 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           ++     ++L  L   + +H+  YY   +P + D+EYD L  +   +    P L  +   
Sbjct: 1   MTP-TIEQQLEQLRDALRHHEYQYYVLDEPQVTDAEYDRLMAQLKQLEAEHPALVTA--- 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG    +  +V H +P LSL+ +++ E  + F  R++     K    + F  E
Sbjct: 57  DSPSQRVGGAPLAAFGQVHHEVPMLSLDNVFDEESYQAFDKRLHERL--KSGEPLTFCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE+G  V AA RGDG +GED++A ++ I  IP  L    IP  IEVRGE
Sbjct: 115 PKLDGLAVSLLYEQGMLVRAATRGDGSTGEDITANVKTIRAIPLRLQGVAIPARIEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEI 249
           V++ ++ F A+N+E    G K +ANPRNAA+G LR+L+P     R L F+ +G G     
Sbjct: 175 VFMPQDGFEAMNEEARRRGAKIFANPRNAAAGSLRQLDPRITAQRPLTFYCYGSGLLEGG 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 Y+ LQ+ +  G PV+  V+       +++YY + +  R  L +DIDG+V KVD+
Sbjct: 235 TLPDSHYQCLQRFKSWGLPVSERVKLCCGSAEVLAYYRQTEQDRPGLGFDIDGVVIKVDD 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            ++Q++LG  AR+PRW  + KF  ++  TRL  ++ Q+GRTG +TPVARLEPV + G  +
Sbjct: 295 IAIQERLGFVARAPRWATAFKFPAQEQMTRLNGVEFQVGRTGAITPVARLEPVQVAGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I+ L           D+R+GD V+V+RAG+VIP+VV ++   R  DA   
Sbjct: 355 SNATLHNADEIERL-----------DLRIGDTVIVRRAGDVIPQVVGVVEAMRPRDALEI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FP+ CP+C S V R          A  RC+GGL C+AQ+ E LKHFVSR A ++EG+G 
Sbjct: 404 GFPTHCPVCGSEVERTEGE------AVARCSGGLICAAQRKESLKHFVSRRAMDVEGMGD 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD++ L      S  K+  +   G  S T L  ++ + R  
Sbjct: 458 KVIEQLVDKE----YVATPADLYRL------SAGKLTGLERMGPKSATKLIAALERSRET 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF+F+LGIR VG   A +LA ++ S Q               D  SL RVP VG+++
Sbjct: 508 TLARFLFALGIREVGEATAANLASHFGSLQALRAA----------DLESLKRVPEVGEVV 557

Query: 609 AQAIVEFYQNPRNICAVEALLK-EVSP-----SIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           A  IV F     N   ++ L+  EV       +  +    + S    K +V TG+L  + 
Sbjct: 558 ASHIVHFLSEAHNRQVIDELISDEVGIRWPEGAPAQSAPAIDSPFAGKTVVLTGSLSVLS 617

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           R +A++ +T LGA VS  +S+KTD++I G+  GSKL KA  LG+++++E Q L +L
Sbjct: 618 RDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKANALGIEVIDEAQMLRML 673


>gi|315180839|gb|ADT87753.1| DNA ligase [Vibrio furnissii NCTC 11218]
          Length = 669

 Score =  574 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 249/710 (35%), Positives = 385/710 (54%), Gaps = 47/710 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           ++   + L+ L+  + YH   YY    P I D+EYD L R    +    P+L     P+ 
Sbjct: 1   MQNVEQRLTELKDTLHYHAIRYYVEDDPTIPDAEYDRLMRELLDLEARHPELV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++GG       +VTH IP LSL+  ++ ++L  F  R+             F  EPK
Sbjct: 58  PSQRVGGAPLAGFEQVTHEIPMLSLDNAFDDDELNSFHRRMGDRVLAAKTAK--FCCEPK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGEVY 192
           +DG  +++ Y  G  V AA RGDG +GE+++  +R I +IP  L     P  IEVRGEV+
Sbjct: 116 LDGLAVSLLYVDGVLVQAATRGDGTTGENITENVRTIKSIPLRLQGTGWPTRIEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEIF- 250
           + K  F  +N E +  G K + NPRNAA+G LR+L+      R L F+ + +G       
Sbjct: 176 MPKAGFEKMNAEALKKGEKVFVNPRNAAAGSLRQLDSRITAKRPLAFYAYSVGVIQGGTL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               YE   +++  G P++   ++  +   +  YY ++ + RS LPY+IDG+V KVD+ +
Sbjct: 236 VDSHYERFLQLKGWGLPMSPETKRVASLDEVKVYYQDIMTRRSELPYEIDGVVIKVDDIA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  ++N
Sbjct: 296 LQEQLGFVARAPRWAIAYKFPAQEEMTVLNDVEFQVGRTGAITPVAKLEPVFVGGVTVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GD V+++RAG+VIP++V ++   R   A+   F
Sbjct: 356 ATLHNADEIERL-----------GVKIGDTVVIRRAGDVIPQIVSVVNELRPETAREILF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+CQS V R          A  RC+GGL C AQ+ E LKHFVSR A +++GLG + 
Sbjct: 405 PAQCPVCQSDVERIEGE------AVARCSGGLVCQAQRKEALKHFVSRKALDVDGLGDKV 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           ++     E     +  PAD+F L+        ++  +   G  S  N+ +++N  +  +L
Sbjct: 459 IEQLVDKE----MVSTPADLFRLRA------GELTVLERMGPKSAQNIVNALNTAKATTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF++SLGIR VG   A +LA ++L+     +               LI VP VG I+A 
Sbjct: 509 PRFLYSLGIREVGEATAMNLAHHFLTLDAIREAT----------IEQLIEVPDVGTIVAS 558

Query: 611 AIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQE 668
            +  F+   RN   VE L+       +I     +    +  K +V TGTL ++ R  A+ 
Sbjct: 559 HVHAFFAQERNQKVVEELIALGIHWQAIAPKTDDEPQPLAGKVVVLTGTLSQLSRSDAKA 618

Query: 669 YVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
            +  LGA V+  +S+ TDI+  G+  GSKL KAQ+LG++I +EE  + ++
Sbjct: 619 ALQALGAKVTGSVSKNTDILFAGEAAGSKLAKAQELGIEICDEEDLIAMI 668


>gi|91784125|ref|YP_559331.1| NAD-dependent DNA ligase [Burkholderia xenovorans LB400]
 gi|123358676|sp|Q13XB0|DNLJ_BURXL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91688079|gb|ABE31279.1| NAD-dependent DNA ligase [Burkholderia xenovorans LB400]
          Length = 688

 Score =  574 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 258/722 (35%), Positives = 391/722 (54%), Gaps = 49/722 (6%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
            P+   +     +  + L  E+   +  YY   +P + D+EYD L +  ++I    PDL 
Sbjct: 4   TPVSPPATSAPAERAAWLRAELERANYAYYVLDQPDLPDAEYDRLFKELESIETEHPDLI 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS- 125
               P+ P  ++GGE       V H  P LSL   +  ED+  F  R+     K      
Sbjct: 64  V---PDSPTQRVGGEAASGFEPVVHEQPMLSLNNGFADEDIVAFDKRVGDALGKNASEPP 120

Query: 126 --IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-P 182
             + +  E K DG  I++RY  G FV A+ RGDG +GE+V+  +R I +IP  L     P
Sbjct: 121 VPVEYAAELKFDGLAISLRYVDGVFVQASTRGDGTTGENVTENVRTIRSIPLRLKGKRVP 180

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
            +++VRGEV + K DF  LN+   A  +K +ANPRNAA+G LR+L+      R L+FF +
Sbjct: 181 HVLDVRGEVLMFKRDFERLNERQRAAEQKEFANPRNAAAGSLRQLDSKITAQRPLSFFSY 240

Query: 242 GLGK-TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           G+G            E+L   + LG PVN      +   G++ +++ +   R  LPYDID
Sbjct: 241 GIGVLEGMDMPATHSELLDWYKELGLPVNGERAVVHGAEGLLGFFHAVGEKREKLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKV+    Q+ LG  +R+PR+ ++HKF  ++A TRL+ ID+Q+GRTG +TPVARLEP
Sbjct: 301 GVVYKVNRRDEQEALGFVSRAPRFALAHKFPAQEALTRLVAIDVQVGRTGAVTPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ 
Sbjct: 361 VFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSALLDR 409

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ F  P+ CP+C S + R  +       A  RCTGGL C AQ+ + L HF  R A
Sbjct: 410 RPDDAREFVMPTHCPVCGSNIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRA 463

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +I+GLG++ +D   +       +R PAD+F L          +  +  F + S  NL D
Sbjct: 464 LDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFATLAELDRFAEKSAQNLLD 513

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           S+ K ++ +L RFI++LGIRHVG   A+ LAK++ S                    +L+ 
Sbjct: 514 SLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMDA----------SVEALLE 563

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGT 657
           V  VG ++A++I +F+    N   +E L      +        K     +  K +V TGT
Sbjct: 564 VNDVGPVVAESIHQFFAEEHNRTVIEQLRAPGRVTWPEGPPAPKAPQGVLAGKTVVLTGT 623

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           L  + R +A+E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    L
Sbjct: 624 LPSLAREEAKEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGMRKL 683

Query: 718 LQ 719
           L+
Sbjct: 684 LE 685


>gi|308050127|ref|YP_003913693.1| DNA ligase, NAD-dependent [Ferrimonas balearica DSM 9799]
 gi|307632317|gb|ADN76619.1| DNA ligase, NAD-dependent [Ferrimonas balearica DSM 9799]
          Length = 685

 Score =  574 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 250/726 (34%), Positives = 386/726 (53%), Gaps = 54/726 (7%)

Query: 6   LIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDL 65
           L P   +S  QA+  +  L Q ++ ++  YY    P + D+EYD L R   A+    P L
Sbjct: 4   LPPKNDMS--QAKDRIEQLSQLLNDYNHQYYVLDNPSVPDAEYDRLMRELQALEAEHPAL 61

Query: 66  ARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS 125
                P+ P  ++GG        V H  P LSL+   N E+   F  R+           
Sbjct: 62  ---RQPDSPTQRVGGAPAGQFQSVAHLKPMLSLDNAMNEEEFSAFHQRLADRLG---SGD 115

Query: 126 IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEI 184
           I +  EPK+DG  +++ Y  G    AA RGDG +GE+++  +R I ++P  LS    P +
Sbjct: 116 IQYCAEPKLDGIAVSLIYRDGLLERAATRGDGTTGEEITTNVRTIKSVPLRLSGKGYPAL 175

Query: 185 IEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGL 243
           +EVRGE ++ K  F A+N + +A G K + NPRNAA+G LR+L+      R L F+ + +
Sbjct: 176 LEVRGEAFMPKAGFEAMNAKAMAAGEKTFVNPRNAAAGSLRQLDSRITANRPLAFYAYAV 235

Query: 244 GK---TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           G         A      L ++   G PV+  V  A      + Y+  +   R  LPY+ID
Sbjct: 236 GVVEGIDTAMADSHSGQLAQLAQWGLPVSPIVETAAGEAAALDYFRRIGQQRPDLPYEID 295

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+V KVD  + Q+QLG  AR+PRW I+ KF  ++  T L D++ Q+GRTG +TPVARLEP
Sbjct: 296 GVVIKVDSLAQQEQLGFVARAPRWAIACKFPAQEEMTLLKDVEFQVGRTGAVTPVARLEP 355

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GG  ++NATLHN D I  L            +++GD V+++RAG+VIP++V ++   
Sbjct: 356 VFVGGVTVSNATLHNADEIARL-----------GVKIGDTVIIRRAGDVIPQIVSVVAER 404

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+   FPS CP+C S+V R          A  RC+GGL C AQ+ E +KHF SR A
Sbjct: 405 RPDDARDIEFPSACPVCASKVERFEGE------AVARCSGGLFCEAQRKEAIKHFASRKA 458

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +++GLG + ++     E     +  PAD+FTL      S +++  +   G  S  NL  
Sbjct: 459 LDVDGLGDKLVELMVDRE----LVATPADLFTL------SASRLTMLPRMGTKSAQNLVA 508

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           ++++ R  +L RF+++LGIR VG   A +LA+++ + +               D  +LI 
Sbjct: 509 ALDQARTTTLPRFLYALGIREVGEATAANLARHFQTLEALMAA----------DTDALIE 558

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALL----KEVSPSIGRHEKNVSSEIENKKLVFTG 656
           V  VG+++A+ +  F++ P N+  ++AL       V           +  ++ +  V TG
Sbjct: 559 VDDVGEVVAKHVYYFFRQPHNLEVIQALTDTEGANVHWPAIEAVAEEAQPLKGQTWVLTG 618

Query: 657 TLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLF 716
           TL ++ R +A+  +  LGA VS  +S+ TD ++ G+  GSKL KA  LGV +++E+  + 
Sbjct: 619 TLSQMGRSEAKAALEALGAKVSGSVSKNTDTLVAGEKAGSKLTKATDLGVPVLDEDGLVA 678

Query: 717 LLQQYN 722
           LL QYN
Sbjct: 679 LLAQYN 684


>gi|53803401|ref|YP_114852.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
 gi|81681278|sp|Q604U8|DNLJ_METCA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|53757162|gb|AAU91453.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
          Length = 673

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 254/713 (35%), Positives = 387/713 (54%), Gaps = 47/713 (6%)

Query: 12  LS-IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70
           +S   +  ++   L +EI +H+  YY+   P+I D+EYD L     AI   +P+L     
Sbjct: 1   MSVPAEVVEKARKLREEIEFHNVRYYRLDDPLITDAEYDRLMAELLAIEARYPELV---T 57

Query: 71  PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130
           P+ P  ++G     +  +V H +P LSLE  ++ EDL  F  R+ +   +   +++ +  
Sbjct: 58  PDSPTQRVGAPPVEAFTEVRHEVPMLSLENAFSEEDLTAFDRRVRKELSR---DTLEYVA 114

Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRG 189
           EPK+DG  + + Y+ G  V AA RGDG  GEDV+  +RA+  IP  L   + P+  E RG
Sbjct: 115 EPKLDGLAVNLLYQDGVLVRAATRGDGEVGEDVTHNVRAVRAIPLRLKGEDFPDRFEARG 174

Query: 190 EVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG-KTS 247
           EV++ K  FLALN+     G K + NPRNAA+G LR+L+     +R L+F+ +G+G    
Sbjct: 175 EVFMPKRGFLALNERARRSGEKTFVNPRNAAAGSLRQLDARVTASRPLSFYAYGIGAFPD 234

Query: 248 EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVD 307
                 Q+E+L+ ++  G PV+   R      G + YY  +   R  LPYDIDG+VYKVD
Sbjct: 235 ARLPATQHELLESLQRWGLPVSPEYRVVRGAAGCLEYYRSLGERRHDLPYDIDGVVYKVD 294

Query: 308 EFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGAL 367
           +   Q  LG  +R+PRW I+HKF  ++A TR++ ID+Q+GRTG+LTPVARLEPV +GG  
Sbjct: 295 DLKAQAGLGFVSRAPRWAIAHKFPAEEARTRVVGIDVQVGRTGVLTPVARLEPVFVGGVT 354

Query: 368 ITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427
           +TNATLHN D I+            +D+R GD V+V+RAG+VIP++V ++   R P A+P
Sbjct: 355 VTNATLHNADEIRR-----------KDVRPGDTVIVRRAGDVIPEIVRVVPELRKPGAEP 403

Query: 428 FSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLG 487
           F  P  CP C S V  +            RC+GGL C AQ  E +KHF SR A +IEGLG
Sbjct: 404 FRMPEVCPECGSAVEAEPGE------VLARCSGGLYCPAQHKESIKHFASRRAMDIEGLG 457

Query: 488 KQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRN 547
            + +D     +     I   AD++ L   +         +   G+ S  NL  ++ + + 
Sbjct: 458 DKLVDQLVGRK----LIATVADLYRLDLDRLAG------LDRMGEKSAANLLAALERSKR 507

Query: 548 ISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDI 607
            +L RF+++LGIR VG   A+ L++++ S +   +               L+ V  VG +
Sbjct: 508 TTLARFLYALGIRDVGEVTAKVLSEHFGSLEALMEATE----------EELLAVADVGPV 557

Query: 608 IAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667
           +++ I  F+  P N   +  LL                 ++    V TGTL  + R +A+
Sbjct: 558 VSRHIRLFFAQPHNREVISQLLACGVSWEKPAPAPRKLPLQGLVFVLTGTLASMSRDEAR 617

Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
             +  LGA  +  +SR T  ++ G  PGSKL+KA +LGV +++E+ FL LL++
Sbjct: 618 ARLEALGAKCTGSVSRNTSFVVAGSEPGSKLDKASELGVPVLDEKGFLDLLER 670


>gi|297616809|ref|YP_003701968.1| DNA ligase, NAD-dependent [Syntrophothermus lipocalidus DSM 12680]
 gi|297144646|gb|ADI01403.1| DNA ligase, NAD-dependent [Syntrophothermus lipocalidus DSM 12680]
          Length = 668

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 244/710 (34%), Positives = 377/710 (53%), Gaps = 47/710 (6%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E  R+    L +EI  HD  YY   +P+I D+EYD L R    +  A+PDL     P+ 
Sbjct: 1   METPRERAEKLREEIRKHDYHYYVLDQPLISDAEYDRLFRELVELEQAYPDLV---TPDS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++GGE+      V H +P LSL+  +N  +LR F  R+        D ++ +  E K
Sbjct: 58  PTQRVGGEVLKGFTPVQHRVPLLSLDNAFNERELRDFNRRLKERLG---DEAVAYVCELK 114

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYI 193
           IDG  I + Y+ G  +  A RGDG  GEDV+A IR I ++P  L+  +P  +EVRGEVY+
Sbjct: 115 IDGVSIALVYQDGVLMSGATRGDGIVGEDVTANIRTIKSLPLRLTYPLP-RVEVRGEVYM 173

Query: 194 SKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAK 252
            K  F  LN E    G K +ANPRNAA+G +R+L+P     R L   V+ +         
Sbjct: 174 PKEAFARLNREREDRGEKTFANPRNAAAGSIRQLDPKVTAGRTLGLLVYDILHLEGKEID 233

Query: 253 GQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQ 312
            Q E L+ +  LGFPV+   R   +   ++ Y  E +  R  LPY+IDG+V K++    +
Sbjct: 234 SQRETLEFLSELGFPVDRNFRWCASLDEVLEYCEEWQGRRHELPYEIDGVVVKLNSLPAR 293

Query: 313 KQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNAT 372
           + LG  A+SPRW I++KF  ++  T+++ I++ +GRTG++TP A +EPV++ G  ++ A+
Sbjct: 294 QLLGATAKSPRWAIAYKFPAEEKETKIVAIELNVGRTGVITPTAVMEPVSLAGTTVSRAS 353

Query: 373 LHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPS 432
           LHN D I+            +DIRVGD V+V +AG++IP+VV  +  +R      F  P 
Sbjct: 354 LHNYDLIR-----------EKDIRVGDMVVVHKAGDIIPEVVRSLPEKRTGKEIEFKMPD 402

Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLD 492
            CP C SRVVR           A+RC   + C A+  E L  F SR+A +IEGLG   ++
Sbjct: 403 KCPACGSRVVRFSGE------VAYRCDN-INCPARLKESLIFFASREAMDIEGLGPALVE 455

Query: 493 FFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLER 552
                      +   AD++ L+  +         +   G  S  NL  ++ + +   L R
Sbjct: 456 QLVDR----GMVSNVADLYYLRAEELAG------LERMGQKSAANLIRALEQSKGRPLHR 505

Query: 553 FIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAI 612
            + +LGIR+VG + AR LA++Y   + F          ++ D   L+ +P +G+ IA+++
Sbjct: 506 LLNALGIRYVGLKTARILAEHYRDIERF----------SDIDREELMSIPEIGEKIAESV 555

Query: 613 VEFYQNPRNICAVEALLKEVSPSIGRH-EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
             F+  PRN  ++  L K    ++         S+   K  V TG L+ + R++A + + 
Sbjct: 556 TAFFAEPRNWDSIHKLKKAGVNTVEPEFSMAQDSQFAGKTFVLTGALESMTRNEATKAIE 615

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
             G  V+  +SRKTD ++ G +PGSK +KA  LGV +++E QFL LL + 
Sbjct: 616 DRGGKVTNSVSRKTDFVVAGRDPGSKYDKAVALGVTVLDENQFLQLLGRQ 665


>gi|115352108|ref|YP_773947.1| DNA ligase [Burkholderia ambifaria AMMD]
 gi|122322835|sp|Q0BE10|DNLJ_BURCM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115282096|gb|ABI87613.1| DNA ligase, NAD-dependent [Burkholderia ambifaria AMMD]
          Length = 691

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/713 (35%), Positives = 384/713 (53%), Gaps = 52/713 (7%)

Query: 19  KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78
              + L  ++   +  YY   +P + D+EYD L      +    PDL     P+ P  ++
Sbjct: 15  ARAAWLRDQLERANYAYYVLDQPDLPDAEYDRLFGELQQLETDHPDLV---TPDSPTQRV 71

Query: 79  GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDD------NSIFFTLEP 132
           GGE+      V H  P LSL   +  ED+  F  R+     K  D      + + +  E 
Sbjct: 72  GGEVAGGFTPVVHDAPMLSLNNGFADEDIAAFDKRVADALGKTTDLAGSVTDPVEYACEL 131

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEV 191
           K DG  I++RYE G FV A+ RGDG +GEDV+  +R I +IP  L     P +++VRGEV
Sbjct: 132 KFDGLAISLRYEHGVFVQASTRGDGTTGEDVTENVRTIRSIPLKLKGAHVPALLDVRGEV 191

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTS-EI 249
            + K DF  LN+   A  ++ +ANPRNAA+G LR+L+P     R L+FF +G+G      
Sbjct: 192 LMFKRDFARLNERQRAAEQREFANPRNAAAGSLRQLDPKITAQRPLSFFAYGIGVLDGMP 251

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
                  +L      G PVN          G++ ++ ++   R +LPYDIDG+VYKV+  
Sbjct: 252 MPDTHSALLDWYESFGLPVNRERAVVYGADGLLGFFRKVGEKRESLPYDIDGVVYKVNRR 311

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
             Q +LG  +R+PR+ ++HKF  ++A TRL+ ID+Q+GRTG +TPVARLEPV +GGA +T
Sbjct: 312 DEQDRLGFVSRAPRFALAHKFPAQEALTRLVAIDVQVGRTGAITPVARLEPVFVGGATVT 371

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
           NATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ R  DA  F 
Sbjct: 372 NATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVGALLDRRPDDAAEFV 420

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP+C S++ R  +       A  RCTGGL C AQ+ + L HF  R A +I+GLG++
Sbjct: 421 MPTECPVCGSKIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRALDIDGLGEK 474

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            +D   +       +R PAD+F L          +  +  F + S  NL DS+ K ++ +
Sbjct: 475 IIDQLVE----LNLVRTPADLFNL------GFATLAELDRFAEKSAQNLLDSLEKAKHTT 524

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI+ LGIRHVG   A+ LAK++ S                     L+ V  VG I+A
Sbjct: 525 LARFIYGLGIRHVGESTAKDLAKHFGSLTPIMDA----------SIEELLEVNDVGPIVA 574

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           ++I +F+    N   +E L      +        +     +  K +V TGTL  + R  A
Sbjct: 575 ESIHQFFAEEHNRTVIEQLRAPGKVTWAEGPPAPRAPQGVLAGKTVVLTGTLPNLTRDAA 634

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +E +   GA V+  +S+KTD ++ G + GSKL KA++LG+ +++E+    LL+
Sbjct: 635 KEMLEAAGAKVAGSVSKKTDYVVAGADAGSKLAKAEELGIPVLDEDGLHQLLE 687


>gi|220931078|ref|YP_002507986.1| DNA ligase, NAD-dependent [Halothermothrix orenii H 168]
 gi|254781343|sp|B8D122|DNLJ_HALOH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219992388|gb|ACL68991.1| DNA ligase, NAD-dependent [Halothermothrix orenii H 168]
          Length = 670

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/708 (36%), Positives = 387/708 (54%), Gaps = 49/708 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
            +  +E+  L ++I YH+  YY    P I D+E+D L +R   +    P L     P+ P
Sbjct: 3   SKVEQEIRDLREKIRYHEYRYYVLDDPEISDAEFDELIQRLIDLEEKHPGLV---TPDSP 59

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++GGE      KV H +P LSL   +N  DL  F  RIYR     D   I F +E KI
Sbjct: 60  TQRVGGEPLDKFDKVEHRVPMLSLGNAFNEGDLTNFARRIYRLL---DTGKIDFVVEHKI 116

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG    + Y+ G+ +  A RG+G  GEDV+A I+ IP++P  L  ++   IEVRGEVYI 
Sbjct: 117 DGLSAILTYQGGRLIRGATRGNGVVGEDVTANIKTIPSVPLRLKKDV--DIEVRGEVYIK 174

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
           K+DF  LN+  +  G +P+ANPRNAA+G +R+L+P     R L+F  + +        + 
Sbjct: 175 KDDFSKLNERRLKKGEEPFANPRNAAAGSIRQLDPRLAAARPLSFIAYDVVAYEGEGLQT 234

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
               L+ +R LGF   N  R+ +    +V+   +    R  LP++IDG+V KV+E  L++
Sbjct: 235 HVGALELLRELGFK-VNWYRKCDDITEVVNICKDWVDKREELPFEIDGMVIKVNELGLRE 293

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
           QLG  A+SPRW I++KF  +Q +T + DI I +GRTG LTP A LEPV + G+ ++ ATL
Sbjct: 294 QLGATAKSPRWAIAYKFPAQQKTTVVKDIIISVGRTGALTPTAVLEPVEVDGSTVSRATL 353

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HNED I+            +D+R+GD VLV++AG+VIP+VV +I ++R    Q F  P  
Sbjct: 354 HNEDEIRR-----------KDVRIGDHVLVQKAGDVIPEVVKVIKSKRDGSEQIFHMPET 402

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP C   VVR+         A  RC     C AQ+ E + HFVSR+A NI+G+G   +D 
Sbjct: 403 CPACGGEVVREEGE------AVLRCVNVTGCPAQRREGILHFVSRNAMNIDGVGPALIDQ 456

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
             +       I   AD++ L++           +   G+ S TN  ++I   ++  L R 
Sbjct: 457 LLEK----GLIEDYADLYYLKKEDLI------PLERMGEKSATNAIEAIRASKDRPLFRV 506

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           IF+LGIRHVG  +AR L + Y S  +  +               L+ +  +G  IA++I+
Sbjct: 507 IFALGIRHVGLGVARVLTEKYRSLSDLMRASG----------EELVAIDEIGPTIARSII 556

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRH--EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVT 671
           EF++ P N   +  L +       +   ++  +  +  K  VFTG L    R +A++ V 
Sbjct: 557 EFFKEPHNREVINKLKEAGVRLEEKENGKEEQNLYLSGKTFVFTGKLDGFTRSEARDKVI 616

Query: 672 QLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
             G  V++ +SRKTD ++VGD+PGSK +KA++LGV I++E++F  +L+
Sbjct: 617 AAGGKVTSSVSRKTDYVVVGDSPGSKYDKARELGVTILDEDKFKEVLK 664


>gi|225181787|ref|ZP_03735225.1| DNA ligase, NAD-dependent [Dethiobacter alkaliphilus AHT 1]
 gi|225167561|gb|EEG76374.1| DNA ligase, NAD-dependent [Dethiobacter alkaliphilus AHT 1]
          Length = 667

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 253/709 (35%), Positives = 387/709 (54%), Gaps = 45/709 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  +QA + +  L QEI  H+  Y+   +P I D+E+D L ++ +A+   FPDL     P
Sbjct: 1   MDRQQALETVEKLRQEIDDHNYRYHVLDEPQISDAEFDDLMQKLEAMEAQFPDLV---TP 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG+      ++TH +P LSL    NIEDLR F+ R  R   +     + F +E
Sbjct: 58  DSPTQRVGGKPLEGFEQITHRVPMLSLSNALNIEDLRDFVRRAIRLVPEA---ELEFVVE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEV 191
            K+DG  ++++YE+G+FV  A RGDG  GED++  +R + +IP  L L  P  +EVRGEV
Sbjct: 115 LKVDGLAVSLQYEEGRFVRGATRGDGEVGEDITHNLRTVQSIP--LRLRKPLTLEVRGEV 172

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIF 250
           Y+ ++ FL LN+E  A G+  +ANPRNAA+G LR+L+P     R L+   +GLG +S++ 
Sbjct: 173 YMPRSSFLKLNEERQAQGQPLFANPRNAAAGSLRQLDPKVAAERNLDMVSYGLGYSSDVT 232

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               Y+ L  ++ LG  +N  V        +VSY    +  R  LP+DIDGLV K+++ S
Sbjct: 233 PSSHYDALMTLKELGMRINPHVVVLRELEDVVSYCESWREKRYELPFDIDGLVIKINDRS 292

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  A+SPRW I++KF  +QA TR+  I +Q+GR G LTP+A LEPV + G ++  
Sbjct: 293 LQEELGTTAKSPRWAIAYKFPAEQAVTRVKAITVQVGRIGTLTPLAELEPVTLAGTVVKR 352

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           A+LHNED ++            +D+RVGD V+V++AG++IP+VV+++ ++R    +PF  
Sbjct: 353 ASLHNEDILR-----------EKDVRVGDHVIVQKAGDIIPEVVEVVKSKRTGAEEPFEM 401

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P  CP C S   R       +            C AQ +ER+ HF SR A +IEG+G   
Sbjct: 402 PKHCPACGSDATRLPGEVALR-------CFNPVCPAQVMERITHFASRSAMDIEGMGPAV 454

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +         A  I   ADI++L  +++     + ++   G+ SV NL  +I K +   L
Sbjct: 455 VLQLLD----AGLIADVADIYSLPDKKE----ALLSLERMGEKSVENLLAAIEKSKKQPL 506

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            R ++ LGIR VG   AR L +++ S +                   L  V  VG  IAQ
Sbjct: 507 WRLLYGLGIRFVGDRTARLLVEHFNSMEKLMAA----------SAEELEAVDEVGPKIAQ 556

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           ++ EF+  P +   +E L            +     ++ K  V TGTL    R +A E +
Sbjct: 557 SVTEFFSLPESGELIERLRAAGLKLKEEEAEAKDLPLQGKTFVLTGTLPTYSRDEAAELI 616

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
              G  V+  +S+KTD ++ G+  GSKLEKA++L V I++EE    LL 
Sbjct: 617 EDAGGRVTGSVSKKTDYVVAGEKAGSKLEKAEKLAVTILDEEGLQSLLN 665


>gi|253689765|ref|YP_003018955.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756343|gb|ACT14419.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 681

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 252/710 (35%), Positives = 394/710 (55%), Gaps = 51/710 (7%)

Query: 20  ELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIG 79
            ++ L + + +H+  Y+    P I D EYD L +   A+    P+L  S   + P  ++G
Sbjct: 14  RVAELRRVLRHHEYKYHVEDAPEIPDVEYDKLMQELKALEADHPELVTS---DSPTQRVG 70

Query: 80  GEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMI 139
                +  +V H +P LSL+ +++ E    F  RI      K+ + + F  E K+DG  +
Sbjct: 71  AAPLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRL--KNGDDLTFCCELKLDGLAV 128

Query: 140 TIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVYISKNDF 198
           ++ YE G  V AA RGDG +GE++++ IR +  IP  L     P  +EVRGEV++  + F
Sbjct: 129 SLLYEDGVLVQAATRGDGTTGENITSNIRTVAAIPLRLEGENIPRRVEVRGEVFMKHSGF 188

Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIFAKGQYE 256
             LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G           +E
Sbjct: 189 EKLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPASHWE 248

Query: 257 MLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLG 316
            L + +  G PV++ ++       ++ +Y  ++  RS+L +DIDG+V KVD   LQ++LG
Sbjct: 249 RLMQFKAWGLPVSDKIKLCTGPAEVLDFYRHVEQTRSSLGFDIDGVVVKVDSLELQERLG 308

Query: 317 ERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNE 376
             AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++NATLHN 
Sbjct: 309 FVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGVIVSNATLHNA 368

Query: 377 DYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPI 436
           D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    QP  FPS CP+
Sbjct: 369 DEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVQPIVFPSACPV 417

Query: 437 CQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFK 496
           C S V R          A  RCTGGL C AQ+ E LKHFVSR A ++EG+G + +D   +
Sbjct: 418 CGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRALDVEGMGDKIIDQLVE 471

Query: 497 SEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFS 556
            E     ++ PAD+F L      S   +  +   G  S TNL +++ K ++ +L RF+++
Sbjct: 472 KE----YVKTPADLFRL------SAGIMTGLDRMGPKSATNLVNALEKAKSTTLARFLYA 521

Query: 557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY 616
           LGIR VG   A +LA ++ S +               D  +L+ VP VG ++A  +  F 
Sbjct: 522 LGIRDVGESTAANLAAHFGSLEALFAA----------DEETLLAVPDVGKVVAAHVRHFL 571

Query: 617 QNPRNICAVEALLKEVSPSI------GRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYV 670
           +   N   +  L      +I          + + S    K +V TG+L  + R +A++ +
Sbjct: 572 EEEHNQTVIRELTDPAGINIHWPEVVVVKAEEIDSPFAGKTVVLTGSLTILSRDEAKDRL 631

Query: 671 TQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL +
Sbjct: 632 TALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLLGE 681


>gi|229542656|ref|ZP_04431716.1| DNA ligase, NAD-dependent [Bacillus coagulans 36D1]
 gi|229327076|gb|EEN92751.1| DNA ligase, NAD-dependent [Bacillus coagulans 36D1]
          Length = 668

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 247/702 (35%), Positives = 381/702 (54%), Gaps = 53/702 (7%)

Query: 23  SLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKIGGEM 82
            L + ++ +   YY   +P + D+EYD L R    I +A P+L     P+ P  ++GGE 
Sbjct: 12  ELRKLLNQYSYEYYVLDRPSVPDAEYDRLLRELQEIENAHPELI---TPDSPTQRVGGEP 68

Query: 83  NLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIR 142
                KV H  P LSL   +N  DLR F  R+     +       +  E KIDG  I+++
Sbjct: 69  LSGFAKVVHDTPMLSLANAFNEADLRDFDRRVR----ETAGYRYEYVCELKIDGLAISLK 124

Query: 143 YEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDFLALN 202
           YE G FV  + RGDG  GED++A +R + +IP  L+  +   IE RGE ++ K  F ALN
Sbjct: 125 YENGLFVQGSTRGDGTIGEDITANLRTVRSIPLRLNEPV--TIEARGECFMPKKSFEALN 182

Query: 203 DEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIFAKGQYEMLQKM 261
                 G +P+ANPRNAA+G LR+L+P    +R L+ F++ +G T+ +      E L  +
Sbjct: 183 RIKEENGEEPFANPRNAAAGSLRQLDPKIAASRNLDTFMYAIGDTTGLDISAHSEGLAYL 242

Query: 262 RCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARS 321
           + LG  VN   R       ++ +  E    R  LPY+IDG+V KV++++ +  LG   +S
Sbjct: 243 KRLGLKVNKETRICRDIGEVLKFIAEWTEKRPALPYEIDGIVIKVNDYAQEAALGTTVKS 302

Query: 322 PRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKG 381
           PRW I++KF  ++  T+L  I++++GRTG++TP A L PV + G  +  ATLHNED I+ 
Sbjct: 303 PRWAIAYKFPAEEVVTKLTGIEVKVGRTGVVTPTAILNPVRVAGTTVQRATLHNEDLIR- 361

Query: 382 LDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSFCPICQSRV 441
                      +DIR+GD V+VK+AG++IP+VV  I   R  + Q FS PS CP C S +
Sbjct: 362 ----------EKDIRIGDYVVVKKAGDIIPEVVRPIPERRTGEEQAFSMPSHCPDCGSEL 411

Query: 442 VRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDFFFKSEDPA 501
           VR  +        A RC     C AQ  E L HFVSR+A NIEGLG++ +   F  E   
Sbjct: 412 VRLEDE------VALRCINP-NCPAQIREGLIHFVSRNAMNIEGLGEKVISQLFAHE--- 461

Query: 502 FSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRH 561
             I   ADI+ L++       ++  +   G+ SV+NL  +I   +  SLE+ +F LGIRH
Sbjct: 462 -LIHNVADIYRLKKE------ELLQLERMGEKSVSNLLAAIEASKKNSLEKLLFGLGIRH 514

Query: 562 VGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN 621
           VGA+ A+ LA ++ + +  ++               L  +P +G+ +A +I  +++N   
Sbjct: 515 VGAKAAKILAAHFETMERLSKATR----------EELEAIPDIGEKMADSIAAYFENEEA 564

Query: 622 ICAVEALLKEVSPSIGR-----HEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAV 676
           +  V  L       + +      ++N  S    K +V TG L  + R++A+E +  LGA 
Sbjct: 565 LGLVRELAALGVNMVYKGPKRAEKRNADSPFAGKTVVLTGKLVNMTRNEAKEKLEALGAN 624

Query: 677 VSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           V+  +S+ TD++I G++ G+KL KA+QLG+++ +E  FL  L
Sbjct: 625 VTGSVSKNTDLVIAGEDAGTKLTKAEQLGIEVWDEAAFLERL 666


>gi|50122504|ref|YP_051671.1| NAD-dependent DNA ligase LigA [Pectobacterium atrosepticum
           SCRI1043]
 gi|81644069|sp|Q6D165|DNLJ_ERWCT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49613030|emb|CAG76481.1| DNA ligase [Pectobacterium atrosepticum SCRI1043]
          Length = 681

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 251/719 (34%), Positives = 397/719 (55%), Gaps = 51/719 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +      ++ L + + +H+  Y+    P I D EYD L +   A+    P+L  S   + 
Sbjct: 1   MNAVALRVAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEADHPELVTS---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+ +++ E    F  RI      K+ + + F  E K
Sbjct: 58  PTQRVGAAPLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRL--KNGDDLTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G  V AA RGDG +GE++++ IR +  IP  L     P  +EVRGEV+
Sbjct: 116 LDGLAVSLLYEEGILVQAATRGDGTTGENITSNIRTVGAIPLRLEGENIPRRVEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F  LN+E    G K +ANPRNAA+G LR+L+P     R L FF +G+G       
Sbjct: 176 MKHGGFEKLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGEL 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
               +E L + +  G PV++ ++       ++ +Y +++  RS+L +DIDG+V KVD  +
Sbjct: 236 PASHWERLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSSLGFDIDGVVVKVDSLA 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
           LQ++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 LQERLGFVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVARLEPVAVAGVIVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +++GDRV+V+RAG+VIP++V I+ +ER    QP  F
Sbjct: 356 ATLHNADEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIVESERPETVQPIVF 404

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVSR A ++EG+G + 
Sbjct: 405 PAACPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVSRRALDVEGMGDKI 458

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D   + E     ++ PAD+F L      S   +  +   G  S  NL +++ K ++ +L
Sbjct: 459 IDQLVEKE----YVKTPADLFRL------SAGIMTGLDRMGPKSAMNLVNALEKAKSTTL 508

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGIR VG   A +LA ++ S +               D  +L+ VP VG I+A 
Sbjct: 509 ARFLYALGIRDVGESTAANLAAHFGSLETLFAA----------DEDALLEVPDVGKIVAA 558

Query: 611 AIVEFYQNPRNICAVEALLKEVSPSIG------RHEKNVSSEIENKKLVFTGTLQKIQRH 664
            +  F +   N   +  L      +I        + + + S    K +V TG+L  + R 
Sbjct: 559 HVRHFLEEEHNQTVIRELTDPAGINIYWPEVKVVNAEEIDSPFAGKTVVLTGSLSILSRD 618

Query: 665 KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQYNT 723
           +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E + + LL  +  
Sbjct: 619 EAKDRLTALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDEAEMIRLLNNHGD 677


>gi|254508455|ref|ZP_05120575.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus 16]
 gi|219548665|gb|EED25670.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus 16]
          Length = 669

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 255/712 (35%), Positives = 388/712 (54%), Gaps = 48/712 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +S +Q +++L+ L + + YH   YY    P I D+EYD L R    +    P+L      
Sbjct: 1   MS-QQIQEKLNQLRESLHYHGIKYYVEDAPEIPDAEYDRLMRELIELEAQNPNLI---SV 56

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GG        V H IP LSL+  ++ ++L  F  R+          +  F  E
Sbjct: 57  DSPSQRVGGAPLDGFTPVAHEIPMLSLDNAFDDDELNAFHKRMLDRVAGSSVEA--FCCE 114

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ YE G  V AA RGDG +GE+++  +R I  IP  L     P  IEVRGE
Sbjct: 115 PKLDGLAVSLLYENGVLVQAATRGDGATGENITENVRTIKAIPLKLCGEGWPARIEVRGE 174

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           V++ K  F  LN+  +  G K + NPRNAA+G LR+L+      R L+F+ + +G     
Sbjct: 175 VFMPKAGFEKLNEHALKKGEKVFVNPRNAAAGSLRQLDSRITAKRPLSFYAYSVGVVEGA 234

Query: 250 F-AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
             ++  YE   +++  G P+    RQ  +   + +YY ++   R  L Y+IDG+V KVD 
Sbjct: 235 ALSESHYERFLQLKSWGLPMCPETRQVESLDDVKAYYKDILQRRDQLAYEIDGVVIKVDS 294

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
             LQ++LG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 295 IELQERLGFVARAPRWAIAYKFPAQEEITLLNDVEFQVGRTGAITPVAKLEPVFVGGVTV 354

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I  L            +++GD V+++RAG+VIP++V ++   R  DA+  
Sbjct: 355 SNATLHNADEIARL-----------GVKIGDSVVIRRAGDVIPQIVSVVAERRPDDAREI 403

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            FPS CP+C S+V R          A  RC+GGL C AQ+ E LKHFVSR A +++GLG 
Sbjct: 404 VFPSQCPVCNSQVERVEGE------AVARCSGGLVCQAQRKEALKHFVSRKALDVDGLGV 457

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   I  +   G  S  N+ D++ K +  
Sbjct: 458 KVIEQLVDRE----MVETPADLFKL------SAGIITVLDRMGPKSAQNVVDALAKAKQT 507

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA ++ +        +            LI VP +GDI+
Sbjct: 508 TLARFLYSLGIREVGEATAANLALHFKTLDAIKAASH----------EQLIAVPDIGDIV 557

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A  I  F+    N   ++ L+ +    P I    ++V   +  K +V TG+L ++ R+ A
Sbjct: 558 ASHITAFFAQDNNQSVIDDLIAQGICWPDIEEKGEDVPQPLAGKTVVLTGSLSQLSRNDA 617

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           +  +  LGA V+  +S+KTDI+  G+N GSKL KAQ+LGV+I  E+  + LL
Sbjct: 618 KAALQNLGAKVTGSVSKKTDILFAGENAGSKLSKAQELGVEIRTEQDLIDLL 669


>gi|148263373|ref|YP_001230079.1| DNA ligase, NAD-dependent [Geobacter uraniireducens Rf4]
 gi|190359259|sp|A5GA98|DNLJ_GEOUR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146396873|gb|ABQ25506.1| DNA ligase, NAD-dependent [Geobacter uraniireducens Rf4]
          Length = 672

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 256/709 (36%), Positives = 377/709 (53%), Gaps = 44/709 (6%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +  + A + +  L +EI+ H+  YY   +P I D+EYD L R    +  A+PDL  +   
Sbjct: 1   MDKQAAERRIQELHKEINRHNYLYYVEDRPEINDAEYDLLLRELQQLEKAYPDLVTA--- 57

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++G        +VTH +P LSLE  +N E++  F  RI RF      + I +  E
Sbjct: 58  DSPTQRVGAAPLEKFSQVTHRMPMLSLENAFNEEEMHDFDERIKRFLGLAAGDEIEYVCE 117

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEI-IEVRGE 190
           PK+DG  + + YE G F   + RGDG+ GEDV+  +R + TIP  L++  P    EVRGE
Sbjct: 118 PKMDGLAVELVYENGDFTVGSTRGDGYVGEDVTQNLRTVKTIPLSLAIATPPRLFEVRGE 177

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNFFVHGLGKTSEI 249
           VY+    F  LN E    G  P+ANPRNAA+G LR+L+      R L+ F +  G     
Sbjct: 178 VYLGLAPFQKLNVEREEAGDPPFANPRNAAAGSLRQLDSRITARRPLSIFCYAAGSLEGH 237

Query: 250 FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEF 309
               Q ++L  +   G PVN  +R+ +   G+++YY+EM   R +LPY+IDG+V KVD F
Sbjct: 238 EFTSQSDLLNTIPGWGLPVNPLIRKVSGIGGVLAYYHEMSEKRESLPYEIDGVVVKVDSF 297

Query: 310 SLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALIT 369
            LQ++LGE+ RSPRW I+ KF  +QA T + +I  Q+GRTG++TPVA L PV + G +++
Sbjct: 298 DLQRELGEKTRSPRWAIAWKFPPRQAVTVVEEIVPQVGRTGVITPVAHLRPVEVSGVMVS 357

Query: 370 NATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFS 429
            ATLHN + ++            +DIR GD V+V+RAG+VIP VV +I  +R  D QP  
Sbjct: 358 RATLHNWEEMEK-----------KDIRKGDTVVVERAGDVIPAVVKVITEKRKGDEQPLP 406

Query: 430 FPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQ 489
            P+ CP C S VV+       +         GL+C AQ  E + HF SR A +I+G+G +
Sbjct: 407 IPANCPECGSEVVKIPGEVAVR-------CLGLSCPAQIRETIIHFASRHAMDIDGMGDK 459

Query: 490 QLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNIS 549
            ++   K       ++  AD++ L++               GD    NL  +I   +   
Sbjct: 460 YIEQLLK----LGLVKNVADLYYLKKDDFMRF------ERMGDKLAENLLGAIETSKQRE 509

Query: 550 LERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIA 609
           L RFI++LGIRHVG   A+ LA  + S +N                  L+ +  VG  +A
Sbjct: 510 LSRFIYALGIRHVGEHTAKLLANAFGSMENLEHASE----------EELLSIREVGPQVA 559

Query: 610 QAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEY 669
           Q+I  F+ N  NI  ++ +           EK V      K  VFTG L +  R  A+  
Sbjct: 560 QSIRTFFHNRNNIEVIDRMFNAGV-KPSVEEKRVGGRFTGKTFVFTGALTRFTRDDAKRM 618

Query: 670 VTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718
           V   G   +  +S+KTD ++ G   GSKL+KA+QLGVK++ E++FL +L
Sbjct: 619 VENEGGHAAGSVSKKTDFVVAGAEAGSKLDKARQLGVKVLTEDEFLAML 667


>gi|332982281|ref|YP_004463722.1| DNA ligase, NAD-dependent [Mahella australiensis 50-1 BON]
 gi|332699959|gb|AEE96900.1| DNA ligase, NAD-dependent [Mahella australiensis 50-1 BON]
          Length = 665

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 242/708 (34%), Positives = 375/708 (52%), Gaps = 48/708 (6%)

Query: 15  EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74
           E   + ++ L Q I +H+  YY    P I D+EYDAL R  + +   +P++     P+ P
Sbjct: 5   EDVIQRVNELRQIIEHHNYMYYVLDSPEISDAEYDALMRELEQLESKYPEII---TPDSP 61

Query: 75  LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134
             ++GG+++     V HS+P LSL  +++  ++R F  R+        +  + + LE KI
Sbjct: 62  TQRVGGQVSGQFQPVVHSVPLLSLNDVFSESEIRDFDRRVRAAL----NEDVQYVLEVKI 117

Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194
           DG  + + Y+ G F+  A RGDG  GEDV+A +R I +IP  L L +P  +EVRGEV++ 
Sbjct: 118 DGLSVALTYQDGLFIRGATRGDGFVGEDVTANLRTIRSIP--LRLKMPINVEVRGEVFMP 175

Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSEIFAKG 253
           K  F  LN++    G   +ANPRNAA+G +R+L+P     R+L+ FV  L +      + 
Sbjct: 176 KKYFYKLNEQREKDGLPLFANPRNAAAGSVRQLDPAITAQRHLDIFVFNLQRIEGYAFET 235

Query: 254 QYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQK 313
             E L  ++  GF +   +   +T    +      +  R  LPY+IDGLV KV+    ++
Sbjct: 236 HVESLMFLKEQGFKIMPYLIPCDTIDEAIEQCRLWEGKRYELPYEIDGLVIKVNSLRQRE 295

Query: 314 QLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATL 373
            LG  +++PRW +++KF  ++  + +  I +Q+GRTG+LTP A LEPV + G  ++ ATL
Sbjct: 296 ILGNTSKTPRWAVAYKFPAERKESIIKHIVVQVGRTGVLTPTAVLEPVRLAGTTVSRATL 355

Query: 374 HNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSFPSF 433
           HNEDYIK            +DIR+GD VLV++AG++IP+VV +I  +R  D + F  P  
Sbjct: 356 HNEDYIK-----------EKDIRIGDHVLVQKAGDIIPEVVSVIKEKRTGDERIFEMPDK 404

Query: 434 CPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQLDF 493
           CP+C +  VR          AA RCTG  +C AQ    L HF SRDA +IEGLG   +  
Sbjct: 405 CPVCGADAVRIDGE------AARRCTGV-SCPAQVERGLIHFASRDAMDIEGLGPAVVRQ 457

Query: 494 FFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISLERF 553
               +     IR  ADI+ L+            +   G  S  NL ++I   ++  L R 
Sbjct: 458 LLNKK----LIRDEADIYYLKYEDLVK------LERMGPKSAQNLINAIQASKDRGLARL 507

Query: 554 IFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIV 613
           +++LGI  VG   A  LA+ +       +           D   L  +P +G  IA+++V
Sbjct: 508 LYALGIPLVGTRAASILAERFGDIYELMKA----------DQAQLTAIPEIGPKIAESVV 557

Query: 614 EFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQL 673
            F++  +    ++ L           ++  ++ +     V TGTL K  R +A E +  L
Sbjct: 558 TFFKQEQTKDLIKRLETAGVRLTADKKQKGNAPLAGLTFVLTGTLSKYTREQATEIIEGL 617

Query: 674 GAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQY 721
           G  V+  +S+KTD +I GD PGSKL+KA QLGVK+++E +F +L+ Q 
Sbjct: 618 GGKVTGSVSKKTDYVIAGDGPGSKLDKALQLGVKVIDENEFEWLIGQE 665


>gi|296158912|ref|ZP_06841740.1| DNA ligase, NAD-dependent [Burkholderia sp. Ch1-1]
 gi|295890787|gb|EFG70577.1| DNA ligase, NAD-dependent [Burkholderia sp. Ch1-1]
          Length = 688

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 257/722 (35%), Positives = 393/722 (54%), Gaps = 49/722 (6%)

Query: 7   IPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLA 66
            P+   +     +  + L  E+   +  YY   +P + D+EYD L +  ++I    PDL 
Sbjct: 4   TPVSPPATSAPAERAAWLRAELERANYAYYVLDQPDLPDAEYDRLFKELESIETEHPDLI 63

Query: 67  RSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNS- 125
               P+ P  ++GGE       V H  P LSL   +  ED+  F  R+     K      
Sbjct: 64  V---PDSPTQRVGGEAASGFEPVVHEQPMLSLNNGFADEDIVAFDKRVGDALGKNASEPP 120

Query: 126 --IFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-P 182
             + +  E K DG  I++RY  G FV A+ RGDG +GE+V+  +R I +IP  L     P
Sbjct: 121 VPVEYAAELKFDGLAISLRYVDGVFVQASTRGDGTTGENVTENVRTIRSIPLRLKGKRVP 180

Query: 183 EIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVH 241
           ++++VRGEV + K DF  LN+   A  +K +ANPRNAA+G LR+L+      R L+FF +
Sbjct: 181 QVLDVRGEVLMFKRDFERLNERQRAAEQKEFANPRNAAAGSLRQLDSKITAQRPLSFFSY 240

Query: 242 GLGK-TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           G+G            E+L   + LG PVN      +   G++ +++ +   R  LPYDID
Sbjct: 241 GIGVLEGMDMPATHSELLDWYKELGLPVNGERAVVHGAEGLLGFFHAVGEKREKLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           G+VYKV+    Q+ LG  +R+PR+ ++HKF  ++A TRL+ ID+Q+GRTG +TPVARLEP
Sbjct: 301 GVVYKVNRRDEQEALGFVSRAPRFALAHKFPAQEALTRLVAIDVQVGRTGAITPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           V +GGA +TNATLHNED ++            +DIR+GD V+V+RAG+VIP+VV  +++ 
Sbjct: 361 VFVGGATVTNATLHNEDEVRR-----------KDIRIGDTVIVRRAGDVIPEVVSALLDR 409

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           R  DA+ F  P+ CP+C S + R  +       A  RCTGGL C AQ+ + L HF  R A
Sbjct: 410 RPDDAREFVMPTHCPVCGSNIERLPDE------AIARCTGGLFCPAQRKQALWHFAQRRA 463

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
            +I+GLG++ +D   +       +R PAD+F L          +  +  F + S  NL D
Sbjct: 464 LDIDGLGEKIIDQLVEQN----LVRTPADLFNL------GFATLAELDRFAEKSAQNLLD 513

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           S+ K ++ +L RFI++LGIRHVG   A+ LAK++ S     +              +L+ 
Sbjct: 514 SLEKAKHTTLARFIYALGIRHVGESTAKDLAKHFGSLDPIMEA----------SVEALLE 563

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGR---HEKNVSSEIENKKLVFTGT 657
           V  VG ++A++I +F+    N   +E L      +        +     +  K +V TGT
Sbjct: 564 VNDVGPVVAESIHQFFAEEHNRTVIEQLRAPGRVTWPEGPPAPRAPQGVLAGKTVVLTGT 623

Query: 658 LQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFL 717
           L  + R +A+E +   GA V+  +S+KTD ++ G   GSKL KA++LG+ +++E+    L
Sbjct: 624 LPSLAREEAKEMLEAAGAKVAGSVSKKTDYVVAGAEAGSKLAKAEELGIPVLDEDGMRKL 683

Query: 718 LQ 719
           L+
Sbjct: 684 LE 685


>gi|312796238|ref|YP_004029160.1| NAD-dependent DNA ligase [Burkholderia rhizoxinica HKI 454]
 gi|312168013|emb|CBW75016.1| NAD-dependent DNA ligase (EC 6.5.1.2) [Burkholderia rhizoxinica HKI
           454]
          Length = 681

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 263/724 (36%), Positives = 399/724 (55%), Gaps = 52/724 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           M +    P    S ++  +  + L  E+   +  YY   +P I D+EYD L +  + I  
Sbjct: 1   MSRMMFPP----SADRPAERAAWLRTELDRANHAYYVLDRPEIPDAEYDKLFKELEQIEA 56

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             PDL     P+ P  ++GG +      + H +P LSL   +   D+  F  R+    Q 
Sbjct: 57  DHPDLI---TPDSPTQRVGGAVAEGFAPIVHDVPMLSLNNGFEDSDVDAFDKRVSDVLQ- 112

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
                + +  E K DG  I++RYE G+FV A+ RGDG +GEDV+A +R I ++P  L+ N
Sbjct: 113 --HGDVEYACELKFDGLAISLRYENGRFVQASTRGDGTTGEDVTANVRTIRSLPLTLNGN 170

Query: 181 -IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLN-PTDITRYLNF 238
            +P++I+VRGEV + K DF  LN      G++ +ANPRNAA+G LR+L+      R L+F
Sbjct: 171 AVPKVIDVRGEVLMFKRDFERLNARQREAGQREFANPRNAAAGSLRQLDSRITAKRPLSF 230

Query: 239 FVHGLGKTS-EIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
           F +G+G             +L     +G PVN          G++ ++  + + R++LPY
Sbjct: 231 FAYGIGVLDGVPMPDTHSALLDWYVNMGLPVNKERAVVRGAAGLLVFFRGVGARRASLPY 290

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+VYKV+    Q +LG  +R+PR+ ++HKF  ++A TRLL I++Q+GRTG +TPVAR
Sbjct: 291 DIDGVVYKVNRRDEQDRLGFVSRAPRFALAHKFPAEEALTRLLAIEVQVGRTGAITPVAR 350

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           LEP+ +GGA +TNATLHNED ++            +DI +GD V+V+RAG+VIP+VV  I
Sbjct: 351 LEPIFVGGATVTNATLHNEDEVRR-----------KDILIGDTVIVRRAGDVIPEVVGAI 399

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
              R  DA+PF+ P+ CP+C S + R  +       A  RCTGGL C+AQ+ + L HF  
Sbjct: 400 KERRPVDARPFTMPTHCPVCGSAIERLPDE------AIARCTGGLVCAAQRKQALWHFAQ 453

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R A +I+GLG++ +D   +       IR PAD+F+L          +  +  F D S  N
Sbjct: 454 RRALDIDGLGEKIIDQLVEQS----LIRTPADLFSL------GFATVAQLDRFADKSAQN 503

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           L DS+ + R+ +L RFI++LGIRHVG   AR LA+++ S                    +
Sbjct: 504 LIDSLERARHTTLPRFIYALGIRHVGEATARDLARHFGSLNALIDASE----------EA 553

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFT 655
           L+ V  VG ++A+AI  F+  P N   +E L       P      +  +  +    +V T
Sbjct: 554 LLEVNDVGPVVAEAIRHFFSEPHNRMVIEQLRAAGVQWPEGPPAPRKPAGPLAGMTVVLT 613

Query: 656 GTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFL 715
           GTL  + R  A+E +   GA V+  +S+KT+ ++ G + GSKL KA++LG+ I++EE   
Sbjct: 614 GTLPTLSREAAKERLEAAGAKVAGSVSKKTNYVVAGADAGSKLTKAEELGIPIVDEEGMR 673

Query: 716 FLLQ 719
            LL+
Sbjct: 674 RLLE 677


>gi|227114832|ref|ZP_03828488.1| NAD-dependent DNA ligase LigA [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 684

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 255/727 (35%), Positives = 403/727 (55%), Gaps = 54/727 (7%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           MK  +  P E   +  A   ++ L + + +H+  Y+    P I D EYD L +   A+  
Sbjct: 1   MKPVKKEPAE---VNAAALRVAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEA 57

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
             P+L  S   + P  ++G     +  +V H +P LSL+ +++ E    F  RI      
Sbjct: 58  DHPELVTS---DSPTQRVGAAPLAAFEQVRHEVPMLSLDNVFDEESYLAFSKRIGDRL-- 112

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
           K+ + + F  E K+DG  +++ YE G  V AA RGDG +GE++++ IR +  IP  L  +
Sbjct: 113 KNGDDLTFCCELKLDGLAVSLLYENGVLVQAATRGDGTTGENITSNIRTVAAIPLRLEGD 172

Query: 181 I-PEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNF 238
             P  +EVRGEV++  + F  LN+E    G K +ANPRNAA+G LR+L+P     R L F
Sbjct: 173 NIPRRVEVRGEVFMKHSGFEKLNEEARRTGSKVFANPRNAAAGSLRQLDPRITAKRPLTF 232

Query: 239 FVHGLGK-TSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPY 297
           F +G+G           +E L + +  G PV++ ++       ++ +Y +++  RS+L +
Sbjct: 233 FCYGVGLLEGGELPASHWERLMQFKAWGLPVSDRIKLCTGPAEVLDFYRQVEQTRSSLGF 292

Query: 298 DIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVAR 357
           DIDG+V KVD   LQ++LG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVAR
Sbjct: 293 DIDGVVVKVDSLELQERLGFVARAPRWAVAFKFPAQEQLTWVRDVEFQVGRTGAITPVAR 352

Query: 358 LEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDII 417
           LEPV + G +++NATLHN D I+ L            +++GDRV+V+RAG+VIP++V I+
Sbjct: 353 LEPVAVAGVIVSNATLHNADEIERL-----------GLQIGDRVIVRRAGDVIPQIVGIV 401

Query: 418 VNERHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVS 477
            +ER    +P  FP+ CP+C S V R          A  RCTGGL C AQ+ E LKHFVS
Sbjct: 402 ESERPETVRPIVFPAACPVCGSDVERVEGE------AVTRCTGGLICGAQRKEALKHFVS 455

Query: 478 RDAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTN 537
           R A ++EG+G + +D   + E     ++ PAD+F L      S   +  +   G  S TN
Sbjct: 456 RRALDVEGMGDKIIDQLVEKE----YVKTPADLFRL------SAGIMTGLDRMGPKSATN 505

Query: 538 LYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           L +++ K ++ +L RF+++LGIR VG   A +LA ++ S +               D  +
Sbjct: 506 LVNALEKAKSTTLARFLYALGIRDVGESTAANLAAHFGSLEALFAA----------DEDA 555

Query: 598 LIRVPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSI------GRHEKNVSSEIENKK 651
           L+ VP VG ++A  +  F +   N   +  L      +I        + + + S    K 
Sbjct: 556 LLEVPDVGKVVAAHVRHFLEEEHNQTVIRELTDPAGINIHWPEVQVVNAEEIDSPFAGKT 615

Query: 652 LVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNE 711
           +V TG+L  + R +A++ +T LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E
Sbjct: 616 VVLTGSLSILSRDEAKDRLTALGAKVSGSVSKKTDMVIAGEAAGSKLAKAQELGIPVIDE 675

Query: 712 EQFLFLL 718
            + + LL
Sbjct: 676 AEMIRLL 682


>gi|188533249|ref|YP_001907046.1| NAD-dependent DNA ligase LigA [Erwinia tasmaniensis Et1/99]
 gi|254781330|sp|B2VE40|DNLJ_ERWT9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|188028291|emb|CAO96149.1| DNA ligase [Erwinia tasmaniensis Et1/99]
          Length = 670

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 242/714 (33%), Positives = 397/714 (55%), Gaps = 51/714 (7%)

Query: 14  IEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNG 73
           +E  + +++ L   + +++  Y+    P + D+EYD L      +  A P+L  +   + 
Sbjct: 1   MESLQDKITHLRTLLRHYEYQYHVLDAPAVPDAEYDRLMGELRELEAAHPELLTT---DS 57

Query: 74  PLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPK 133
           P  ++G     +  +V H +P LSL+  ++ E  R F  R+    +  DD  + F  E K
Sbjct: 58  PTQRVGAAPLSAFEQVRHEVPMLSLDNAFDEESYRAFNKRVQDRLKSSDD--LTFCCELK 115

Query: 134 IDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNI-PEIIEVRGEVY 192
           +DG  +++ YE+G+ V AA RGDG +GE+++A +R I  IP  LS +  PE +EVRGEV+
Sbjct: 116 LDGLAVSLLYEQGELVRAATRGDGTTGENITANVRTIRAIPLRLSGDNIPERLEVRGEVF 175

Query: 193 ISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGK-TSEIF 250
           +    F  +N++    G+K +ANPRNAA+G LR+L+P     R L FF +GLG       
Sbjct: 176 MPLAGFEKMNEQARRGGQKIFANPRNAAAGSLRQLDPRITAKRPLTFFCYGLGLLEGGEM 235

Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310
            +     LQ+ +  G PV++ VR  ++   ++ +Y+++++ R  L +DIDG+V KVD   
Sbjct: 236 PRSHMARLQQFKAWGLPVSDRVRLCHSPSDVLDFYHQVEADRPALGFDIDGVVIKVDSLE 295

Query: 311 LQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITN 370
            Q+QLG  AR+PRW ++ KF  ++  T + D++ Q+GRTG +TPVARLEPV + G +++N
Sbjct: 296 QQEQLGFVARAPRWAVAFKFPAQEQITTVRDVEFQVGRTGAITPVARLEPVLVAGVMVSN 355

Query: 371 ATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPFSF 430
           ATLHN D I+ L            +R+GDRV+++RAG+VIP+V+ ++ +     A+   F
Sbjct: 356 ATLHNADEIERL-----------GLRIGDRVVIRRAGDVIPQVMSVVESA--EGARDVIF 402

Query: 431 PSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGKQQ 490
           P+ CP+C S V R             RCTGGL C AQ+   LKHFVSR A +I+G+G++ 
Sbjct: 403 PTHCPVCGSDVERVEGE------VVARCTGGLICGAQRKGALKHFVSRRALDIDGMGEKI 456

Query: 491 LDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNISL 550
           +D     E     ++ PA++F L         K+  +   G  S  N+ D++ K +  + 
Sbjct: 457 IDQLVDKE----YVKNPAELFELTA------GKLTGLDRMGPKSAQNVVDALAKAKQTTF 506

Query: 551 ERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQ 610
            RF+++LGI  VG   A +LA ++ + +               D  +LI VP VG ++A 
Sbjct: 507 ARFLYALGISEVGEATAANLAAHFGTLEALMAA----------DIDTLITVPDVGKVVAS 556

Query: 611 AIVEFYQNPRNICAVEALLKEVSPS----IGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
            +  F     N   +  L+++   +    +    + + S    K +V TG+L  + R  A
Sbjct: 557 HVRNFLDEESNREIIRLLVEKAGVNWPDVVVVKAEEIDSPFAGKTVVLTGSLSILSRDDA 616

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           +E +  LGA VS  +S+KTD++I G+  GSKL KAQ+LG+ +++E++ + LL +
Sbjct: 617 KERLQALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIDVIDEQEMMRLLGE 670


>gi|59712497|ref|YP_205273.1| NAD-dependent DNA ligase LigA [Vibrio fischeri ES114]
 gi|75353581|sp|Q5E3L1|DNLJ_VIBF1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|59480598|gb|AAW86385.1| DNA ligase, NAD(+)-dependent [Vibrio fischeri ES114]
          Length = 668

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 258/713 (36%), Positives = 401/713 (56%), Gaps = 50/713 (7%)

Query: 12  LSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDP 71
           +SIEQ    L  L+Q+++YH   YY    P + D+EYD + ++  +I    P+L      
Sbjct: 1   MSIEQT---LDELKQQLNYHAYRYYVEDSPELPDAEYDRMMQQLLSIESEHPELVTV--- 54

Query: 72  NGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLE 131
           + P  ++GGE      ++ H IP LSL+  ++ E+L  F  R+      K  +   F  E
Sbjct: 55  DSPSQRVGGEALDGFTQIQHEIPMLSLDNAFSDEELEAFEKRMNDRLISKPVS--LFCCE 112

Query: 132 PKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN-IPEIIEVRGE 190
           PK+DG  +++ Y  GK V A  RGDG +GE+++  +R I  IP  L     P  +EVRGE
Sbjct: 113 PKLDGLAVSLLYVDGKLVQAGTRGDGTTGENITENVRTIRCIPLTLQGEGWPTRLEVRGE 172

Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLGKTSE- 248
           V++ K  F ALN+  +  G KP+ANPRNAA+G LR+L+     TR L+F+ + +G     
Sbjct: 173 VFMPKAGFEALNERALKRGEKPFANPRNAAAGSLRQLDSKITATRPLSFYAYSVGVIEGG 232

Query: 249 IFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308
                 Y+   +++  G P+    +Q ++   + +YY ++   R  L Y+IDG+V KVD+
Sbjct: 233 ELETSHYQRFVQLKSWGLPMCEETKQCHSLTEVKAYYKDILERRDALKYEIDGVVIKVDD 292

Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368
            +LQ+QLG  AR+PRW I++KF  ++  T L D++ Q+GRTG +TPVA+LEPV +GG  +
Sbjct: 293 IALQEQLGFVARAPRWAIAYKFPAQEELTVLNDVEFQVGRTGAITPVAKLEPVFVGGVTV 352

Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           +NATLHN D I  L            + +GD V+++RAG+VIP++V ++   R  D++  
Sbjct: 353 SNATLHNADEIARL-----------GVHIGDTVIIRRAGDVIPQIVSVVEARRPTDSKAI 401

Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488
            +P  CP+C S + R          A  RC  GL C AQ+ E LKHFVSR A +++GLG 
Sbjct: 402 VYPIHCPVCGSNLERVEGE------AVTRCGAGLVCQAQRKEALKHFVSRKALDVDGLGD 455

Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548
           + ++     E     +  PAD+F L      S   +  +   G  S  N+ D++NK +  
Sbjct: 456 KVVEQLVDKE----MVETPADLFKL------SAGLLTVLERMGPKSAQNVVDALNKAKAT 505

Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608
           +L RF++SLGIR VG   A +LA ++ + +                +  LI V  VGDI+
Sbjct: 506 TLPRFLYSLGIREVGEATAANLAAHFYTLEAIQVAT----------FEQLIEVSDVGDIV 555

Query: 609 AQAIVEFYQNPRNICAVEALLKEVS--PSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKA 666
           A+ ++ F+  P N   +E L +     P I   +++V   +  K +V TGTL K++R++A
Sbjct: 556 AKHVLNFFAEPHNKTVIEDLQEMGIHWPEIKALDESVPQPLAGKVVVLTGTLHKLKRNEA 615

Query: 667 QEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQ 719
           +  + +LGA V+  +S+KTDI+  G+  GSKL KA++LGV++MNEEQ + LL 
Sbjct: 616 KAALQELGAKVTGSVSKKTDILFAGEAAGSKLAKAEELGVEVMNEEQLIELLN 668


>gi|166216287|sp|Q0HK31|DNLJ_SHESM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 688

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 248/713 (34%), Positives = 390/713 (54%), Gaps = 51/713 (7%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           +   A+  + +L Q ++ H+  YY    P I DSEYD L +R   +   +P    +   +
Sbjct: 19  TPHNAQPLMQALCQSLNEHNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAA---D 75

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            P  ++GG       ++TH  P LSL+  ++  D   F  R+           + F  EP
Sbjct: 76  SPTQRVGGMALAKFEQITHLKPMLSLDNAFDEADFSAFHKRVSDRVG-----EVSFCCEP 130

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSL-NIPEIIEVRGEV 191
           K+DG  ++I Y  G    AA RGDG  GED++  ++ I +IP  L   N PE++EVRGE 
Sbjct: 131 KLDGLAVSILYRNGVLERAATRGDGTVGEDITENVKTIKSIPLKLRGDNYPELVEVRGEA 190

Query: 192 YISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPT-DITRYLNFFVHGLG---KTS 247
           ++ K  F ALN+       K + NPRNAA+G L