RPSBLAST alignment for GI: 254781172 and conserved domain: PRK08097

>gnl|CDD|181228 PRK08097, ligB, NAD-dependent DNA ligase LigB; Reviewed. Length = 562
 Score =  148 bits (377), Expect = 4e-36
 Identities = 144/642 (22%), Positives = 245/642 (38%), Gaps = 157/642 (24%)

Query: 13  SIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           S  +A++E+++L+Q+++  DD Y++  K  + D  YD L+ R       F         +
Sbjct: 26  SPARAQEEIAALQQQLAQWDDAYWRQGKSEVDDEVYDQLRARLTQWQRCFGGPE---PRD 82

Query: 73  GPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEP 132
            PL  + G       KV H +    ++K+ + + L +++      W           ++P
Sbjct: 83  VPLPPLNG-------KVLHPVAHTGVKKLADKQALARWMAGRSDLW-----------VQP 124

Query: 133 KIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVY 192
           K+DG  +T+ Y  GK V A  RG+G  GED +A  R IP IP+ L   +  ++ ++GE++
Sbjct: 125 KVDGVAVTLVYRDGKLVQAISRGNGLKGEDWTAKARLIPAIPQQLPGALANLV-LQGELF 183

Query: 193 ISKNDFLALNDEMIAV--GRKPYANPRNAASGILRRLNPTDITRYLNFFV----HGLGKT 246
                 L     +     G     N R   +G++ R +P+     +  FV     G    
Sbjct: 184 ------LRREGHIQQQMGG----INARAKVAGLMMRKDPSPTLNQIGVFVWAWPDG---- 229

Query: 247 SEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVS----------YYNEMKSIRSTLP 296
                    E L ++   GFP+     Q  T H + +          +Y      R+ LP
Sbjct: 230 ----PASMPERLAQLATAGFPLT----QRYT-HPVKNAEEVARWRERWY------RAPLP 274

Query: 297 YDIDGLVYKVDEFSLQKQLGE--RARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTP 354
           +  DG+V +      ++  G   +     W ++ K+   Q    +  +   +GRTG +T 
Sbjct: 275 FVTDGVVVR----QAKEPPGRYWQPGQGEWAVAWKYPPVQQVAEVRAVQFAVGRTGKITV 330

Query: 355 VARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGR-DIRVGDRVLVKRAGEVIPKV 413
           V  LEPV +    ++   +            G V R  + DI  GD+VLV  AG+ IP++
Sbjct: 331 VLELEPVMLDDKRVSRVNI------------GSVRRWQQWDIAPGDQVLVSLAGQGIPRL 378

Query: 414 VDII--VNERH----PDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQ 467
             ++    ER     PDA  F   S C                   A+        C  Q
Sbjct: 379 DKVVWRGAERTKPTPPDADRFHSLS-C-----------------FRASP------GCQEQ 414

Query: 468 QLERLKHFVSRDAFNIEGLGK---QQL---DFFFKSEDPAFSIRIPADIF---TLQRRQQ 518
            L RL     +    ++G+G+   + L     F               +F    L   Q 
Sbjct: 415 FLARLVWLSGKQGLGLDGIGEGTWRALHQTGLF-------------EHLFSWLALTPEQ- 460

Query: 519 TSTTKIENILGFGDVSVTNLYDSINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQ 578
                + N  G G      L+   N  R     R++ +LGI    A +     +   S+Q
Sbjct: 461 -----LANTPGIGKARAEQLWHQFNLARQQPFSRWLKALGIPLPQAALNALDDR---SWQ 512

Query: 579 NFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPR 620
                       +   W  L   P +G+  A+ ++ F Q+P 
Sbjct: 513 QLLS-------RSEQQWQQL---PGIGEGRARQLIAFLQHPE 544