RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus str. psy62] (731 letters) >gnl|CDD|30621 COG0272, Lig, NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]. Length = 667 Score = 682 bits (1762), Expect = 0.0 Identities = 284/711 (39%), Positives = 434/711 (61%), Gaps = 48/711 (6%) Query: 11 ALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSED 70 A S+ +A++E+ L + ++ HD YY P + D+EYD L R + P+L Sbjct: 1 AWSMAEAQEEIEELRELLNKHDYRYYVLDAPSVSDAEYDQLYRELQELEEKHPELIT--- 57 Query: 71 PNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTL 130 P+ P ++G + KV H +P LSL+ ++ E+LR F RI +F +S+ + + Sbjct: 58 PDSPTQRVGAAPLNAFKKVRHPVPMLSLDNAFDEEELRAFDRRIRKFL----GDSVEYVV 113 Query: 131 EPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGE 190 EPKIDG I++ YE GK V AA RGDG +GED++A +R I +IP L P ++EVRGE Sbjct: 114 EPKIDGLAISLVYENGKLVRAATRGDGTTGEDITANVRTIRSIPLKLP-GAPAVLEVRGE 172 Query: 191 VYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT-RYLNFFVHGLGKTSEI 249 V++ K DF ALN+E G KP+ANPRNAA+G LR+L+P R L FF++ +G E Sbjct: 173 VFMPKEDFEALNEEREEEGEKPFANPRNAAAGSLRQLDPKITAKRKLGFFIYAVGDGEEG 232 Query: 250 -FAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDE 308 A Q E L ++ GFPVN R ++++Y E + R++LPYDIDG+V KV++ Sbjct: 233 LLADTQSERLAFLKAWGFPVNPYTRLCKNADEVLAFYEEWEKKRASLPYDIDGVVIKVND 292 Query: 309 FSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEPVNIGGALI 368 +LQ++LG +++PRW I++KF ++A T+LLDI++Q+GRTG +TPVARLEPV + G + Sbjct: 293 LALQRELGFTSKAPRWAIAYKFPAEEAVTKLLDIEVQVGRTGAITPVARLEPVELAGVTV 352 Query: 369 TNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQPF 428 + ATLHN D IK DIR+GD V+V++AG+VIP+VV +++ +R + +P Sbjct: 353 SRATLHNVDEIKRK-----------DIRIGDTVVVRKAGDVIPQVVGVVLEKRPGNEKPI 401 Query: 429 SFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDAFNIEGLGK 488 FP+ CP+C S +VR + RCT GL C AQ ERL HFVSR+A +I+GLG+ Sbjct: 402 PFPTHCPVCGSELVR------EEGEVVIRCTNGLNCPAQLKERLIHFVSRNALDIDGLGE 455 Query: 489 QQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKRRNI 548 + ++ F+ I+ AD++TL + ++ GFG+ S NL ++I K + Sbjct: 456 KIIEQLFEKG----LIKDIADLYTLTEED------LLSLEGFGEKSAENLLNAIEKSKKQ 505 Query: 549 SLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDII 608 L RF+++LGIRHVG A+SLA+++ + + ++A + ++ S +P +G+++ Sbjct: 506 PLARFLYALGIRHVGETTAKSLARHFGTLE-------ALLAASEEELAS---IPGIGEVV 555 Query: 609 AQAIVEFYQNPRNICAVEALLKE-VSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQ 667 A++I+EF+ N N ++ LL V +S + K V TGTL+ + R +A+ Sbjct: 556 ARSIIEFFANEENRELIDELLAAGVKWEEEEKISIETSPLAGKTFVLTGTLEGMSRDEAK 615 Query: 668 EYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLL 718 + LGA VS +S+KTD ++ G+N GSKL KAQ+LGVKI++EE+FL LL Sbjct: 616 ALLEALGAKVSGSVSKKTDYVVAGENAGSKLAKAQELGVKIIDEEEFLALL 666 >gnl|CDD|29013 cd00114, LIGANc, NAD+ dependent DNA ligase adenylation domain. DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor, but using the same basic reaction mechanism. The enzyme reacts with the cofactor to form a phosphoamide-linked AMP with the amino group of a conserved Lysine in the KXDG motif, and subsequently transfers it to the DNA substrate to yield adenylated DNA. This alignment contains members of the NAD+ dependent subfamily only.. Length = 307 Score = 315 bits (809), Expect = 2e-86 Identities = 130/313 (41%), Positives = 192/313 (61%), Gaps = 9/313 (2%) Query: 19 KELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGPLNKI 78 + ++ L + ++ HD YY +P + D+EYD L R A+ P+L P+ P ++ Sbjct: 1 ERIAELRELLNKHDYRYYVLDEPSVSDAEYDRLYRELRALEEEHPELKT---PDSPTQRV 57 Query: 79 GGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138 GG KV H +P LSL+ ++ E+LR F RI RF + +EPKIDG Sbjct: 58 GGTPLSGFKKVRHPVPMLSLDNAFDEEELRAFDERIKRFL----GEEPAYVVEPKIDGLS 113 Query: 139 ITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYISKNDF 198 I++RYE G V AA RGDG +GEDV+ +R I +IP L+ PE +EVRGEV++ K DF Sbjct: 114 ISLRYENGVLVQAATRGDGTTGEDVTENVRTIRSIPLTLA-GAPETLEVRGEVFMPKADF 172 Query: 199 LALNDEMIAVGRKPYANPRNAASGILRRLNPTDI-TRYLNFFVHGLGKTSEIFAKGQYEM 257 ALN E G KP+ANPRNAA+G LR+L+P R L FF++GLG+ + K Q E Sbjct: 173 EALNKEREERGEKPFANPRNAAAGSLRQLDPKITAKRPLRFFIYGLGEAEGLGPKTQSEA 232 Query: 258 LQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGE 317 L ++ GFPV+ R ++++Y+E+++ R +LPY+IDG+V KVD+ +LQ++LG Sbjct: 233 LAFLKEWGFPVSPETRLCKNIEEVLAFYDEIEAKRDSLPYEIDGVVVKVDDLALQRELGF 292 Query: 318 RARSPRWMISHKF 330 +++PRW I++KF Sbjct: 293 TSKAPRWAIAYKF 305 >gnl|CDD|145016 pfam01653, DNA_ligase_aden, NAD-dependent DNA ligase adenylation domain. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilising either ATP or NAD(+) as a cofactor. This domain is the catalytic adenylation domain. The NAD+ group is covalently attached to this domain at the lysine in the KXDG motif of this domain. This enzyme- adenylate intermediate is an important feature of the proposed catalytic mechanism. Length = 315 Score = 305 bits (783), Expect = 3e-83 Identities = 130/320 (40%), Positives = 193/320 (60%), Gaps = 12/320 (3%) Query: 15 EQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARSEDPNGP 74 E+A++E++ L + I +D YY P + D+EYD L RR A+ FP+L P+ P Sbjct: 1 EEAQQEIARLRELIRQYDYHYYVLDNPEVPDAEYDRLYRRLQALEEKFPELIT---PDSP 57 Query: 75 LNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKI 134 ++G + KV H P LSL+ ++ ++L +I RI R + + +EPKI Sbjct: 58 TQRVGAPLLGDFKKVRHPAPMLSLDNAFDEDELAAWIRRIRRRLGNSEKA---YVVEPKI 114 Query: 135 DGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLNIPEIIEVRGEVYIS 194 DG +++ YE G V AA RGDG +GEDV+ ++ I IP L + P +EVRGEV++ Sbjct: 115 DGVAVSLTYEDGVLVRAATRGDGTTGEDVTQNVKTIRAIPLTLPGD-PARLEVRGEVFMP 173 Query: 195 KNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDIT--RYLNFFVHGLGKTSEIF-- 250 K DF ALN+E G KP+ANPRNAA+G LR+L+P +IT R L FFV+GLG + Sbjct: 174 KEDFEALNEEREEEGEKPFANPRNAAAGSLRQLDP-EITAKRKLRFFVYGLGLPEGLELG 232 Query: 251 AKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFS 310 + Q E L++++ LGFPV+ R ++ YY E + R LP++IDG+V KV+E Sbjct: 233 PQTQSEALKQLKSLGFPVSPHTRLCKNIDEVLDYYAEWEKKRDELPFEIDGVVVKVNELP 292 Query: 311 LQKQLGERARSPRWMISHKF 330 LQ++LG +++PRW I++KF Sbjct: 293 LQRELGFTSKAPRWAIAYKF 312 >gnl|CDD|145978 pfam03120, DNA_ligase_OB, NAD-dependent DNA ligase OB-fold domain. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilising either ATP or NAD(+) as a cofactor. This family is a small domain found after the adenylation domain pfam01653 in NAD dependent ligases. OB-fold domains generally are involved in nucleic acid binding. Length = 82 Score = 118 bits (297), Expect = 7e-27 Identities = 45/93 (48%), Positives = 66/93 (70%), Gaps = 11/93 (11%) Query: 335 ASTRLLDIDIQIGRTGILTPVARLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRD 394 A T+LLDI++Q+GRTG++TPVA LEPV + G ++ ATLHNED I+ D Sbjct: 1 AVTKLLDIEVQVGRTGVITPVAILEPVELAGTTVSRATLHNEDEIEEK-----------D 49 Query: 395 IRVGDRVLVKRAGEVIPKVVDIIVNERHPDAQP 427 IR+GD V+V++AG+VIPK+V +++ +R D +P Sbjct: 50 IRIGDTVVVRKAGDVIPKIVGVVLEKRPGDTRP 82 >gnl|CDD|34872 COG5275, COG5275, BRCT domain type II [General function prediction only]. Length = 276 Score = 69.4 bits (169), Expect = 4e-12 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Query: 631 EVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIV 690 + + G + ++ K VFTG L+ + R A+ V G V+A+ S KT +++ Sbjct: 141 ATTQTPGSVPEGERECLKGKVFVFTGDLKTLSRDDAKTLVKVYGGRVTAVPSSKTTFLVL 200 Query: 691 GDNPG-SKLEKAQQLGVKIMNEEQFLFLL 718 GDN G SK+EK +QL +K ++EE F L+ Sbjct: 201 GDNAGPSKMEKIKQLKIKAIDEEGFDSLI 229 >gnl|CDD|28909 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain. The BRCT domain is found within many DNA damage repair and cell cycle checkpoint proteins. The unique diversity of this domain superfamily allows BRCT modules to interact forming homo/hetero BRCT multimers, BRCT-non-BRCT interactions, and interactions within DNA strand breaks.. Length = 72 Score = 54.6 bits (131), Expect = 1e-07 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Query: 649 NKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSK-LEKAQQLGVK 707 V TG L +R + +E + +LG V++ +S+KT +IVG + G K L KA +LG+ Sbjct: 1 GLTFVITGDLPSEERDELKELIEKLGGKVTSSVSKKTTHVIVGSDAGPKKLLKAIKLGIP 60 Query: 708 IMNEEQFLFLLQ 719 I+ E L L+ Sbjct: 61 IVTPEWLLDCLK 72 >gnl|CDD|144208 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain. The BRCT domain is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage. The BRCT domain of XRCC1 forms a homodimer in the crystal structure. This suggests that pairs of BRCT domains associate as homo- or heterodimers. BRCT domains are often found as tandem-repeat pairs. Structures of the BRCA1 BRCT domains revealed a basis for a widely utilized head-to-tail BRCT-BRCT oligomerisation mode. This conserved tandem BRCT architecture facilitates formation of the canonical BRCT phospho-peptide interaction cleft at a groove between the BRCT domains. Disease associated missense and nonsense mutations in the BRCA1 BRCT domains disrupt peptide binding by directly occluding this peptide binding groove, or by disrupting key conserved BRCT core folding determinants. Length = 77 Score = 52.8 bits (127), Expect = 4e-07 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 648 ENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPG-SKLEKAQQLGV 706 + K V TG L ++R + +E + +LG V+ LS+KT +IVG+N G KL KA LG+ Sbjct: 7 KGKTFVITG-LDSLEREELEELIEKLGGKVTDSLSKKTTHVIVGENAGTLKLLKAIALGI 65 Query: 707 KIMNEEQFLFLL 718 I+ EE L + Sbjct: 66 PIVTEEWLLDCI 77 >gnl|CDD|37179 KOG1968, KOG1968, KOG1968, Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]. Length = 871 Score = 42.0 bits (98), Expect = 6e-04 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Query: 650 KKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGS-KLEKAQQLGVKI 708 K TG L I A+ + + GA + LS KT +GD + KLEK ++L + + Sbjct: 177 IKFTPTGVLDDIGTGSAEPSLKEFGASKTESLSDKTVESCLGDEAIAKKLEKIKELEIPV 236 Query: 709 MNEEQF 714 + EE+ Sbjct: 237 LLEERK 242 >gnl|CDD|145977 pfam03119, DNA_ligase_ZBD, NAD-dependent DNA ligase C4 zinc finger domain. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilising either ATP or NAD(+) as a cofactor. This family is a small zinc binding motif that is presumably DNA binding. IT is found only in NAD dependent DNA ligases. Length = 27 Score = 36.3 bits (85), Expect = 0.031 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Query: 433 FCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSA 466 CP+C S +VR + G+ RCT G C A Sbjct: 1 HCPVCGSPLVR----EEGE--VDIRCTNGS-CPA 27 >gnl|CDD|143896 pfam00122, E1-E2_ATPase, E1-E2 ATPase. Length = 222 Score = 32.9 bits (76), Expect = 0.30 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 10/39 (25%) Query: 387 KVMRGG-------RDIRVGDRVLVKRAGEVIPKVVDIIV 418 V+R G ++ VGD VL+K G+ +P D + Sbjct: 37 TVIRDGKEEEIPADELVVGDIVLLK-PGDRVP--ADGRI 72 >gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane]. Length = 475 Score = 30.3 bits (68), Expect = 1.8 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 17/89 (19%) Query: 352 LTPVA-RLEPVNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRV-------GDRVLV 403 L PV R+E VNIGG L+ HN D GL+ + + +R R+ GDR Sbjct: 318 LKPVPGRMELVNIGGKLVIVDYAHNPD---GLEKALRAVRLHAAGRLIVVFGCGGDRDKS 374 Query: 404 KR--AGEVIPKVVDIIV----NERHPDAQ 426 KR G + ++ DI++ N R D Sbjct: 375 KRPDMGAIAEQLADIVIVTSDNPRSEDPA 403 >gnl|CDD|35834 KOG0614, KOG0614, KOG0614, cGMP-dependent protein kinase [Signal transduction mechanisms]. Length = 732 Score = 29.9 bits (67), Expect = 2.5 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Query: 84 LSLFKVTHSIPTLSLEKIWN-----IEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTM 138 L + K H + T E +++ +E FI R+YR + +D ++ +E + G + Sbjct: 450 LKILKKKHIVDTKQQEHVFSERNIMMECRSDFIVRLYRTF--RDSKYVYMLMEACLGGEL 507 Query: 139 ITIRYEKGKF 148 TI ++G F Sbjct: 508 WTILRDRGSF 517 >gnl|CDD|144965 pfam01565, FAD_binding_4, FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyses the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyses the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan. Length = 138 Score = 29.9 bits (68), Expect = 2.6 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 12/71 (16%) Query: 334 QASTRLLDIDIQIGRTGILTPV--ARLEPVNIGGALITNATLHN-------EDYIKGL-- 382 +A L D+ + G+L + P +GGA+ TN + D + L Sbjct: 68 EAGVTLGDLVRALAAKGLLLGLEPGSGIPGTVGGAIATNGGGYGSEKYGLTRDNVLSLEV 127 Query: 383 -DASGKVMRGG 392 A G+V+R Sbjct: 128 VLADGEVVRLS 138 >gnl|CDD|144385 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain. Length = 117 Score = 29.4 bits (67), Expect = 3.3 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 14/56 (25%) Query: 687 IIIVGDNPGS------KLEKAQQLGVK--------IMNEEQFLFLLQQYNTTLRIH 728 +I+VGD+P S K + A++LG++ + EE+ L L+++ N +H Sbjct: 34 VILVGDDPASQVYVRSKRKAAEELGIESELIRLPEDITEEELLALIEKLNADPSVH 89 >gnl|CDD|33643 COG3853, TelA, Uncharacterized protein involved in tellurite resistance [Inorganic ion transport and metabolism]. Length = 386 Score = 29.5 bits (66), Expect = 3.8 Identities = 20/114 (17%), Positives = 43/114 (37%), Gaps = 2/114 (1%) Query: 567 ARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFYQNPRN-ICAV 625 S+ + + YQ +I+ II + L R + +++ + E++++ I A Sbjct: 129 KSSIQEIFSKYQTIGAQIDRIIESLSKGKDELTRDNKMLELLYEKNREYFEHLEKYIAAG 188 Query: 626 EALLKEVSPSIGRH-EKNVSSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVS 678 E +E+ I + S + I R + + Y L +V+ Sbjct: 189 ELKDEELETEIIPELKTKAESGNQMDVQQVNELTLFINRLEQRVYDLLLARMVA 242 >gnl|CDD|32399 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism]. Length = 713 Score = 29.0 bits (65), Expect = 4.2 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Query: 394 DIRVGDRVLVKRAGEVIPKVVDIIV 418 +++VGD VLV R GE IP VD +V Sbjct: 229 EVQVGDIVLV-RPGERIP--VDGVV 250 >gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only]. Length = 304 Score = 28.5 bits (63), Expect = 6.5 Identities = 12/98 (12%), Positives = 29/98 (29%), Gaps = 8/98 (8%) Query: 640 EKNVSSEIENKKLVFTGTLQKIQRH---KAQEYVTQLGAVVSAILSRKTDIIIVGDNPGS 696 SE + L +Q ++ + + G + + P Sbjct: 19 SFGWISEDGAESLEVA--IQCLEAAFGFRRDDVDRAEGTTLLDSFESAERHPVEILTPEE 76 Query: 697 KLEKAQQL---GVKIMNEEQFLFLLQQYNTTLRIHDDD 731 A+ L G K+M + + + +Y + + + Sbjct: 77 DKALAESLKNEGNKLMKNKDYQEAVDKYTEAIELDPTN 114 >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 293 Score = 28.3 bits (64), Expect = 7.0 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Query: 381 GLDASGKVMRGG---RDIRVGDRVLV 403 GL+ SG V R G ++VGDRV+ Sbjct: 32 GLECSGIVTRVGSGVTGLKVGDRVMG 57 >gnl|CDD|109652 pfam00604, Flu_PB2, Influenza RNA-dependent RNA polymerase subunit PB2. PB2 can bind 5' end cap structure of RNA. Length = 759 Score = 27.9 bits (62), Expect = 9.3 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Query: 635 SIGRHE-KNVS-SEIENKKLVFTGTLQ--KIQRHKAQEYVTQLGAVVSAILSRKT 685 S G K +S S ++ ++ V G LQ KI+ + E T +G +AIL + T Sbjct: 324 SFGGFTLKRISGSGVKREEEVLIGNLQTLKIRIWEGYEEFTMVGKRATAILRKAT 378 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.400 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 8,965,741 Number of extensions: 496663 Number of successful extensions: 1246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1223 Number of HSP's successfully gapped: 23 Length of query: 731 Length of database: 6,263,737 Length adjustment: 101 Effective length of query: 630 Effective length of database: 4,081,228 Effective search space: 2571173640 Effective search space used: 2571173640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 61 (27.2 bits)