RPSBLAST alignment of GI: 254781172 and protein with PDBid: 1z00

>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Length = 89
 Score = 52.3 bits (125), Expect = 3e-07
 Identities = 12/82 (14%), Positives = 25/82 (30%), Gaps = 12/82 (14%)

Query: 540 DSI-NKRRNISLERFIFSL-GIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLS 597
           D +  K     + R    L  ++ V    +++L   + S +                   
Sbjct: 3   DLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQL----------IAASRED 52

Query: 598 LIRVPLVGDIIAQAIVEFYQNP 619
           L   P +G   A+ + +    P
Sbjct: 53  LALCPGLGPQKARRLFDVLHEP 74