RPSBLAST alignment of GI: 254781172 and protein with PDBid: 2cok

>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113
 Score = 62.3 bits (151), Expect = 4e-10
 Identities = 10/80 (12%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 644 SSEIENKKLVFTGTLQKIQRHKAQEYVTQLGAVVSAILSRKTDIIIVGD---NPGSKLEK 700
              + N K++  G L +  + + +  + +LG  ++   ++ +  I           K+E+
Sbjct: 8   DKPLSNMKILTLGKLSR-NKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEE 66

Query: 701 AQQLGVKIMNEEQFLFLLQQ 720
            ++  +++++E+    +   
Sbjct: 67  VKEANIRVVSEDFLQDVSAS 86