RPSBLAST alignment of GI: 254781172 and protein with PDBid: 3bac

>3bac_A DNA ligase; adenylation domain, DNA damage, DNA repair, DNA replication, NAD; HET: DNA 3B9; 3.00A {Haemophilus influenzae} Length = 270
 Score =  200 bits (508), Expect = 1e-51
 Identities = 93/257 (36%), Positives = 146/257 (56%), Gaps = 4/257 (1%)

Query: 88  KVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGK 147
           ++ H IP LSL+  ++  +   F+ RI           + F  EPK+DG  ++I Y  G+
Sbjct: 9   QIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKP-LTFCCEPKLDGLAVSILYVNGE 67

Query: 148 FVYAALRGDGHSGEDVSACIRAI-PTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMI 206
              AA RGDG +GED++A IR I     ++L+ N P  +EVRGEV++    F  LN   +
Sbjct: 68  LTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYAL 127

Query: 207 AVGRKPYANPRNAASGILRRLNPTD-ITRYLNFFVHGLGKTSEI-FAKGQYEMLQKMRCL 264
               K +ANPRNAA+G LR+L+P     R L    +G+G    +      Y  LQ ++ +
Sbjct: 128 EHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVGLPTTHYARLQWLKSI 187

Query: 265 GFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRW 324
           G PVN  +R  N    ++ +Y ++++ RS+L YDIDG V K+++ +LQ +LG  +++PRW
Sbjct: 188 GIPVNPEIRLCNGADEVLDFYQDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRW 247

Query: 325 MISHKFAEKQASTRLLD 341
            I++KF  ++  T L D
Sbjct: 248 AIAYKFPAQEELTLLND 264