RPSBLAST alignment of GI: 254781172 and protein with PDBid: 3ef1

>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442
 Score = 51.4 bits (122), Expect = 7e-07
 Identities = 17/112 (15%), Positives = 43/112 (38%), Gaps = 7/112 (6%)

Query: 606 DIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEI-ENKKLVFTGTL---QKI 661
            ++      +Y+   +I +     K    ++G     +  ++ +  +L+F+G +     +
Sbjct: 313 KVLKDIHAVYYEEENDISSRSGNHKH--ANVGLIIPKMKQKVLKGCRLLFSGVIPLGVDV 370

Query: 662 QRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLG-VKIMNEE 712
                 ++    GA V    S     +I       K++KA  +G +K++   
Sbjct: 371 LSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLN 422