BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA
[Candidatus Liberibacter asiaticus str. psy62]
         (731 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 731

 Score = 1509 bits (3907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60
           MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH
Sbjct: 1   MKKRQLIPIEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAH 60

Query: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120
           AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK
Sbjct: 61  AFPDLARSEDPNGPLNKIGGEMNLSLFKVTHSIPTLSLEKIWNIEDLRKFITRIYRFWQK 120

Query: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180
           KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN
Sbjct: 121 KDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPTIPRVLSLN 180

Query: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240
           IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV
Sbjct: 181 IPEIIEVRGEVYISKNDFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDITRYLNFFV 240

Query: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300
           HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID
Sbjct: 241 HGLGKTSEIFAKGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMKSIRSTLPYDID 300

Query: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360
           GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP
Sbjct: 301 GLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPVARLEP 360

Query: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420
           VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE
Sbjct: 361 VNIGGALITNATLHNEDYIKGLDASGKVMRGGRDIRVGDRVLVKRAGEVIPKVVDIIVNE 420

Query: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480
           RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA
Sbjct: 421 RHPDAQPFSFPSFCPICQSRVVRDLNPKTGKLVAAHRCTGGLACSAQQLERLKHFVSRDA 480

Query: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540
           FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD
Sbjct: 481 FNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYD 540

Query: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600
           SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR
Sbjct: 541 SINKRRNISLERFIFSLGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIR 600

Query: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660
           VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK
Sbjct: 601 VPLVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQK 660

Query: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720
           IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ
Sbjct: 661 IQRHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMNEEQFLFLLQQ 720

Query: 721 YNTTLRIHDDD 731
           YNTTLRIHDDD
Sbjct: 721 YNTTLRIHDDD 731


>gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 119

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + +LS  +A  E+  L +   +H   YY+   P+  D  YD +  R DA+   FP+L   
Sbjct: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF-- 108

Query: 69  EDPNGPLNKIG 79
            D + P N +G
Sbjct: 109 -DEDHPWNTVG 118


>gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 119

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68
           + +LS  +A  E+  L +   +H   YY+   P+  D  YD +  R DA+   FP+L   
Sbjct: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELF-- 108

Query: 69  EDPNGPLNKIG 79
            D + P N +G
Sbjct: 109 -DEDHPWNTVG 118


>gi|254780767|ref|YP_003065180.1| lipid-A-disaccharide synthase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 383

 Score = 31.2 bits (69), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 54/108 (50%), Gaps = 11/108 (10%)

Query: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662
           L GD+I +++ E    P N+  V        PS+   ++ + S  +  +L   G +Q + 
Sbjct: 18  LAGDLI-KSLKEMVSYPINLVGVGG------PSL--QKEGLVSLFDFSELSVIGIMQVV- 67

Query: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710
           RH  Q ++ ++   V  I+S K D++++ DNP      A+++  K+ N
Sbjct: 68  RHLPQ-FIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPN 114


>gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 361

 Score = 30.0 bits (66), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 17/139 (12%)

Query: 242 GLGKTSEIFA-KGQYEMLQKMRCLGFPVNNGVRQANTFHGIVSYYNEMK-SIRSTLPYDI 299
           G  K SE FA +  YE+++KM            ++N FH   +Y  E +      +P  +
Sbjct: 236 GFQKFSEQFASRSFYEIIKKMSF--------SNKSNIFH---NYRAETQFYFLIVIPLML 284

Query: 300 DGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRTGILTPV-ARL 358
             +       SL+     R+  PR ++++          ++ I    G++GIL PV A L
Sbjct: 285 VAMTLIAASVSLE---FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341

Query: 359 EPVNIGGALITNATLHNED 377
            PV +  +L     L  ED
Sbjct: 342 IPVILTISLSILILLQKED 360


>gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 343

 Score = 25.4 bits (54), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 401 VLVKRAGEVIPKVVDIIVNERHPDAQPF 428
           V++++ GEV+    ++I    H DA PF
Sbjct: 250 VVLQKIGEVLAHSTEVISIRGHTDASPF 277


>gi|254780397|ref|YP_003064810.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 343

 Score = 24.6 bits (52), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 170 IPTIPRVLSLNIPEIIEVRGEVYISKNDFLALNDEMIAV-GRKPYANPRNAASGI 223
           I  I R+LS     IIE    VY +   +  +N+  IA+ G  P+A   NA  GI
Sbjct: 176 IADICRILSTK--RIIETSDTVYNAMKKYFGINNPRIAISGLNPHAG-ENATIGI 227


>gi|254781203|ref|YP_003065616.1| hypothetical protein CLIBASIA_05550 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 478

 Score = 24.3 bits (51), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 15/29 (51%)

Query: 44  LDSEYDALKRRCDAIAHAFPDLARSEDPN 72
           L + +DA +   D +AH    L R E P+
Sbjct: 272 LHTSFDAYEAHTDTLAHGVDSLVRGEYPH 300


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.138    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 467,407
Number of Sequences: 1233
Number of extensions: 2016