RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781174|ref|YP_003065587.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >gnl|CDD|33862 COG4105, ComL, DNA uptake lipoprotein [General function prediction only]. Length = 254 Score = 160 bits (407), Expect = 3e-40 Identities = 85/244 (34%), Positives = 119/244 (48%), Gaps = 2/244 (0%) Query: 22 FALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFN 81 L + I + LV S E+Y + + L++ N+ +A +YF Sbjct: 1 KKLKLLLVIGLLLLVASTGCSGDKDKNG--VYNLPASELYNEGLTELQKGNYEEAIKYFE 58 Query: 82 QCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSY 141 PF+ + ++ L A+ Y G+Y A + + +I YP N DY YYL G+SY Sbjct: 59 ALDSRHPFSPYSEQAQLDLAYAYYKNGEYDLALAYIDRFIRLYPTHPNADYAYYLKGLSY 118 Query: 142 AQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYL 201 I DV DQ A + +V+RY NS Y A+ + + LA E+ I RYYL Sbjct: 119 FFQIDDVTRDQSAARAAFAAFKELVQRYPNSRYAPDAKARIVKLNDALAGHEMAIARYYL 178 Query: 202 KRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGY 261 KRG YVAAI RF+ VL NY D EA+ARL EAY AL L DEA++ ++ YP Sbjct: 179 KRGAYVAAINRFEEVLENYPDTSAVREALARLEEAYYALGLTDEAKKTAKVLGANYPDSQ 238 Query: 262 WARY 265 W + Sbjct: 239 WYKD 242 >gnl|CDD|31915 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 262 Score = 38.8 bits (90), Expect = 0.002 Identities = 22/93 (23%), Positives = 40/93 (43%), Gaps = 14/93 (15%) Query: 166 VERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEH 225 +++Y NS Y A ++ +G +G+Y A F V+ +Y + Sbjct: 168 IKKYPNSTYTPNAYYW--------------LGESLYAQGDYEDAAYIFARVVKDYPKSPK 213 Query: 226 AEEAMARLVEAYVALALMDEAREVVSLIQERYP 258 A +A+ +L + L DEA + + +RYP Sbjct: 214 APDALLKLGVSLGRLGNTDEACATLQQVIKRYP 246 Score = 34.2 bits (78), Expect = 0.037 Identities = 29/135 (21%), Positives = 46/135 (34%), Gaps = 22/135 (16%) Query: 101 AFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQ 160 A Y +G Y +A + +I +YP S YY +G S Y Q + Sbjct: 148 ALDLYKSGDYAEAEQAFQAFIKKYPNSTYTPNAYYWLGESL--------YAQGDYEDAAY 199 Query: 161 YMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANY 220 +R+V+ Y SP A + +G + + L Q V+ Y Sbjct: 200 IFARVVKDYPKSPKAPDA--LLKLGVSLGRLGNTDEACATL------------QQVIKRY 245 Query: 221 SDAEHAEEAMARLVE 235 + A+ A L Sbjct: 246 PGTDAAKLAKVALKA 260 Score = 32.7 bits (74), Expect = 0.11 Identities = 12/62 (19%), Positives = 26/62 (41%) Query: 66 LFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYP 125 + ++ A F + +D+P + A +LL G +A + ++ I +YP Sbjct: 187 SLYAQGDYEDAAYIFARVVKDYPKSPKAPDALLKLGVSLGRLGNTDEACATLQQVIKRYP 246 Query: 126 ES 127 + Sbjct: 247 GT 248 Score = 28.8 bits (64), Expect = 1.6 Identities = 17/77 (22%), Positives = 30/77 (38%) Query: 187 NQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEA 246 A K K G+Y A FQ + Y ++ + A L E+ A ++A Sbjct: 138 VSPATKLYNAALDLYKSGDYAEAEQAFQAFIKKYPNSTYTPNAYYWLGESLYAQGDYEDA 197 Query: 247 REVVSLIQERYPQGYWA 263 + + + + YP+ A Sbjct: 198 AYIFARVVKDYPKSPKA 214 >gnl|CDD|36573 KOG1359, KOG1359, KOG1359, Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism]. Length = 417 Score = 30.0 bits (67), Expect = 0.65 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 10/71 (14%) Query: 182 VTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYS------DAEHAEEAMARLVE 235 V +G +LA+K + LKRG YV + +V + A H EE + RL+E Sbjct: 349 VMLGDARLASK---MADELLKRGIYVIGF-SYPVVPKGKARIRVQISAAHTEEDIDRLIE 404 Query: 236 AYVALALMDEA 246 A+ + Sbjct: 405 AFSEVGRFLNV 415 >gnl|CDD|32776 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]. Length = 389 Score = 29.5 bits (66), Expect = 1.00 Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Query: 196 IGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQE 255 +GR L +G+Y A+ + VL + E+ E + L E Y L E + E Sbjct: 220 LGRVELAKGDYQKAVEALERVLEQ--NPEYLSEVLEMLYECYAQLGKPAEGLNFLRRAME 277 Query: 256 RYP 258 Sbjct: 278 TNT 280 >gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]. Length = 1018 Score = 29.6 bits (66), Expect = 1.0 Identities = 52/279 (18%), Positives = 86/279 (30%), Gaps = 46/279 (16%) Query: 3 AVLGRAICIFEAWAY----QLYKFALTI--------FFSIAVCFLVGWERQS-----SRD 45 A+LG+A + Y + YK AL I I CF + R Sbjct: 166 ALLGKARIAYNKKDYRGALKYYKKALRINPACKADVRIGIGHCFWKLGMSEKALLAFERA 225 Query: 46 VYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQY 105 + LD T V + E + F ++ K + + ++ VA + L + F Y Sbjct: 226 LQLDP-TCVSALVALGEVDLNFNDSDSYKKGVQLLQRAYKENNENPVA-LNHLANHF--Y 281 Query: 106 SAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRI 165 Y++ L E I +Y +G SY D + Sbjct: 282 FKKDYERVWHLAEHAIKNTENKSIKAESFYQLGRSYHAQ-----GDFEKAFKYYMESLKA 336 Query: 166 VERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEH 225 P V +G+ Y+KRG+ + F+ VL + Sbjct: 337 DNDNFVLPLVG-------------------LGQMYIKRGDLEESKFCFEKVLKQLPNNYE 377 Query: 226 AEEAMARLVEAYVALA-LMDEAREVVSLIQERYPQGYWA 263 + + L D+A V+ + E+ P A Sbjct: 378 TMKILGCLYAHSAKKQEKRDKASNVLGKVLEQTPVDSEA 416 >gnl|CDD|35763 KOG0543, KOG0543, KOG0543, FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]. Length = 397 Score = 27.6 bits (61), Expect = 3.5 Identities = 14/62 (22%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Query: 186 RNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLA-----NYSDAEHAEEAMARLVEAYVAL 240 R + A ++ E G K G++ A R++ ++ D E ++A A + ++ L Sbjct: 204 RLEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNL 263 Query: 241 AL 242 A Sbjct: 264 AA 265 Score = 27.6 bits (61), Expect = 3.5 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Query: 200 YLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQ 259 YLK EY AI VL + +A+ R +A +AL D AR+ + P Sbjct: 267 YLKLKEYKEAIESCNKVLELDPNNV---KALYRRGQALLALGEYDLARDDFQKALKLEPS 323 >gnl|CDD|37051 KOG1840, KOG1840, KOG1840, Kinesin light chain [Cytoskeleton]. Length = 508 Score = 27.2 bits (60), Expect = 5.2 Identities = 15/78 (19%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Query: 196 IGRYYLKRGEYVAAIPRFQLVLANY-----SDAEHAEEAMARLVEAYVALALMDEAREVV 250 + Y G+Y A+ ++ L D + L Y EA E Sbjct: 247 LALVYRSLGKYDEAVNLYEEALTIREEVFGEDHPAVAATLNNLAVLYYKQGKFAEAEEYC 306 Query: 251 SLIQERYPQGYWARYVET 268 E Y + A + E Sbjct: 307 ERALEIYEKLLGASHPEV 324 >gnl|CDD|36228 KOG1010, KOG1010, KOG1010, Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning]. Length = 920 Score = 27.3 bits (60), Expect = 5.3 Identities = 18/80 (22%), Positives = 34/80 (42%), Gaps = 3/80 (3%) Query: 68 LKEQNFSKAYEYFNQCSRDFPFAGVARKSLLM-SAFVQYSAGKYQQAASLGEEYITQYPE 126 LK++ K +Y N CSRD P + ++ + F Q + S E ++ Sbjct: 417 LKKEPSDKLEQYLNTCSRD-PTESILKRLKEIFEIFEQKFSAAEGSGNSCIEIASQRFKL 475 Query: 127 SKNVDYVYYLVGMSYAQMIR 146 ++ + Y L + A++ R Sbjct: 476 AERL-YYKVLEKILKAELKR 494 >gnl|CDD|63880 cd00788, KU70, Ku-core domain, Ku70 subfamily; Ku70 is a subunit of the Ku protein, which plays a key role in multiple nuclear processes such as DNA repair, chromosome maintenance, transcription regulation, and V(D)J recombination. The mechanism underlying the regulation of all the diverse functions of Ku is still unclear, although it seems that Ku is a multifunctional protein that works in the nuclei. In mammalian cells, the Ku heterodimer recruits the catalytic subunit of DNA-dependent protein kinase (DNA-PK), which is dependent on its association with the Ku70/80 heterodimer bound to DNA for its protein kinase activity.. Length = 287 Score = 26.8 bits (59), Expect = 6.1 Identities = 13/70 (18%), Positives = 26/70 (37%), Gaps = 13/70 (18%) Query: 112 QAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVP-------YDQRATKLMLQYMSR 164 Q L E P ++LV + +A IR +P + A+ ++ + Sbjct: 168 QEEELDEPDGQVLPP------GFHLVPLPFADDIRKLPSLLEENASAESASDELVDKAKQ 221 Query: 165 IVERYTNSPY 174 I+++ Y Sbjct: 222 IIKKLRLLSY 231 >gnl|CDD|132870 cd07232, Pat_PLPL, Patain-like phospholipase. Patatin-like phospholipase. This family consists of various patatin glycoproteins from plants and fungi. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have been found also in vertebrates. Length = 407 Score = 26.8 bits (60), Expect = 6.5 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Query: 121 ITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRAT--KL-MLQYMSRI 165 IT +P S D++ L + + R + Q+A KL ++ RI Sbjct: 352 ITIWPRSTLSDFLRILSDPTPEDLERMIHEGQQAAFPKLHFIKNRMRI 399 >gnl|CDD|107305 cd06310, PBP1_ABC_sugar_binding_like_2, Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis. Length = 273 Score = 26.4 bits (59), Expect = 7.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 102 FVQYSAGKYQQAASLGEEYITQYPE 126 QYS Y +A + E+ +T P+ Sbjct: 159 ATQYSDSDYAKALDITEDLLTANPD 183 >gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current. Length = 368 Score = 26.3 bits (58), Expect = 9.8 Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 95 KSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDV 148 KSLL + ++ S+ +E Q +N+D + S ++IR V Sbjct: 151 KSLLQNWPTRH---VITIINSIIDEVREQIKRLRNLDIKNIFILGSTEEIIRYV 201 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.135 0.393 Gapped Lambda K H 0.267 0.0781 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,251,511 Number of extensions: 166878 Number of successful extensions: 656 Number of sequences better than 10.0: 1 Number of HSP's gapped: 653 Number of HSP's successfully gapped: 31 Length of query: 271 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 179 Effective length of database: 4,275,709 Effective search space: 765351911 Effective search space used: 765351911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 57 (25.6 bits)