BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781174|ref|YP_003065587.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter asiaticus str. psy62] (271 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781174|ref|YP_003065587.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 550 bits (1418), Expect = e-159, Method: Compositional matrix adjust. Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREV 60 MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREV Sbjct: 1 MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREV 60 Query: 61 YEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEY 120 YEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEY Sbjct: 61 YEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEY 120 Query: 121 ITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARF 180 ITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARF Sbjct: 121 ITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARF 180 Query: 181 YVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVAL 240 YVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVAL Sbjct: 181 YVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVAL 240 Query: 241 ALMDEAREVVSLIQERYPQGYWARYVETLVK 271 ALMDEAREVVSLIQERYPQGYWARYVETLVK Sbjct: 241 ALMDEAREVVSLIQERYPQGYWARYVETLVK 271 >gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Score = 23.5 bits (49), Expect = 3.9, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 71 QNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFV 103 QNF K +N CS+ A +A L S ++ Sbjct: 484 QNFVKDIRRWNNCSKKMDPAPIANMILEQSGYM 516 >gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 22.7 bits (47), Expect = 6.3, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 117 GEEYITQYPESKNVDYVYYLVGM 139 G+ + +YP+ ++DYV ++G+ Sbjct: 88 GDVVVFRYPKDPSIDYVKRVIGL 110 >gi|254781061|ref|YP_003065474.1| putative iron-sulfur cluster assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 428 Score = 22.7 bits (47), Expect = 7.1, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 7/43 (16%) Query: 129 NVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTN 171 N +++YYL M R + +Q + L +MS IVE + Sbjct: 368 NPEHLYYL-------MARGISKNQACSMLSHAFMSEIVEDLND 403 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.135 0.393 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 155,028 Number of Sequences: 1233 Number of extensions: 5754 Number of successful extensions: 22 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 8 length of query: 271 length of database: 328,796 effective HSP length: 73 effective length of query: 198 effective length of database: 238,787 effective search space: 47279826 effective search space used: 47279826 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)