RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781178|ref|YP_003065591.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] (304 letters) >d1b25a1 a.110.1.1 (A:211-619) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 409 Score = 27.2 bits (60), Expect = 1.8 Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 5/67 (7%) Query: 191 ILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGI--IIKLPEEKFDVA 248 + +Y +R++ V K+ + ++ +R + L +G L E+K+D Sbjct: 313 YKAADRVYSLIRAYWVR---EFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDEL 369 Query: 249 IAKILEL 255 +++ + Sbjct: 370 LSEYYRI 376 >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Score = 25.9 bits (56), Expect = 3.8 Identities = 12/78 (15%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Query: 119 IFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVI 178 I +++ + L + + R+ P T L R+ + + + G Sbjct: 261 ILSRDLELVARPLDFLGVNYYAPVRVAPGTGT--LPVRYLPPEGPATAMGWEVYPEGLYH 318 Query: 179 TAFNHVRFAYLPILIGEN 196 R P+ + EN Sbjct: 319 LLKRLGREVPWPLYVTEN 336 >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Score = 25.9 bits (56), Expect = 4.4 Identities = 5/21 (23%), Positives = 13/21 (61%) Query: 251 KILELQNKYQILDRDISVIDM 271 K+ E+Q ++ ++V+D+ Sbjct: 9 KLDEIQQSDKLFKPGMTVVDL 29 >d1qtma2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} Length = 409 Score = 25.4 bits (54), Expect = 6.0 Identities = 19/108 (17%), Positives = 38/108 (35%), Gaps = 8/108 (7%) Query: 156 RHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAG--- 212 P L GYV T F R+ +++ +A + G Sbjct: 277 SFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAA 336 Query: 213 -ITK--FVKAYNWIAERRWD--LHLHNGIIIKLPEEKFDVAIAKILEL 255 + K VK + + E L +H+ ++++ P+E+ + E+ Sbjct: 337 DLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEV 384 >d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 110 Score = 24.9 bits (54), Expect = 9.2 Identities = 12/60 (20%), Positives = 23/60 (38%) Query: 54 VILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLN 113 ++LA + + + K I DS GF + ++ +E DI + L+ Sbjct: 50 ILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLD 109 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.329 0.145 0.437 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,228,823 Number of extensions: 61551 Number of successful extensions: 177 Number of sequences better than 10.0: 1 Number of HSP's gapped: 177 Number of HSP's successfully gapped: 12 Length of query: 304 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 219 Effective length of database: 1,240,546 Effective search space: 271679574 Effective search space used: 271679574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 53 (24.9 bits)