Query gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 71 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 05:47:10 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781180.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK11873 arsM arsenite S-adeno 34.2 16 0.00042 19.3 0.8 33 33-70 147-179 (258) 2 COG0220 Predicted S-adenosylme 31.4 21 0.00053 18.8 1.0 28 44-71 138-165 (227) 3 PTZ00098 phosphoethanolamine N 24.9 49 0.0013 16.7 1.9 19 52-70 138-156 (263) 4 PHA00407 phage lambda Rz1-like 21.3 24 0.00061 18.5 -0.3 15 23-43 57-71 (84) 5 pfam02390 Methyltransf_4 Putat 20.2 49 0.0013 16.8 1.2 28 44-71 111-138 (199) 6 pfam05491 RuvB_C Holliday junc 18.8 58 0.0015 16.4 1.3 34 35-68 28-65 (75) 7 pfam11460 DUF3007 Protein of u 18.3 88 0.0022 15.4 2.1 42 11-52 60-102 (104) 8 TIGR02348 GroEL chaperonin Gro 17.2 1.1E+02 0.0028 14.8 2.7 29 28-56 342-371 (528) 9 pfam11304 DUF3106 Protein of u 16.5 1.1E+02 0.0027 15.0 2.2 36 21-56 22-57 (107) 10 KOG1715 consensus 16.0 1.2E+02 0.003 14.7 3.4 48 6-53 35-83 (187) No 1 >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Probab=34.24 E-value=16 Score=19.32 Aligned_cols=33 Identities=36% Similarity=0.683 Sum_probs=22.4 Q ss_pred HHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCEEECC Q ss_conf 66578862713677599998653200037565367416 Q gi|254781180|r 33 INNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFAD 70 (71) Q Consensus 33 innaiaslipeerrdlqdrmakystrklkprgrvifad 70 (71) |.|..-.|+|+..+-|.. --|-|||-||+.+.| T Consensus 147 iSncVlnl~pDk~~vl~E-----~~RVLKPGGRl~ISD 179 (258) T PRK11873 147 ISNCVINLSPDKERVFRE-----AFRVLKPGGRFAISD 179 (258) T ss_pred EECCEEECCCCHHHHHHH-----HHHHCCCCCEEEEEE T ss_conf 882467607987999999-----999628897899997 No 2 >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Probab=31.38 E-value=21 Score=18.78 Aligned_cols=28 Identities=46% Similarity=0.596 Sum_probs=24.6 Q ss_pred HHHHHHHHHHHHHHHCCCCCCCEEECCC Q ss_conf 6775999986532000375653674169 Q gi|254781180|r 44 ERRDLQDRMAKYSTRKLKPRGRVIFADD 71 (71) Q Consensus 44 errdlqdrmakystrklkprgrvifadd 71 (71) .||=+|....+--.++|||.|.+-||.| T Consensus 138 KRRl~~~~fl~~~a~~Lk~gG~l~~aTD 165 (227) T COG0220 138 KRRLTQPEFLKLYARKLKPGGVLHFATD 165 (227) T ss_pred CCCCCCHHHHHHHHHHCCCCCEEEEEEC T ss_conf 3214788999999997268978999726 No 3 >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Probab=24.87 E-value=49 Score=16.75 Aligned_cols=19 Identities=26% Similarity=0.478 Sum_probs=14.7 Q ss_pred HHHHHHHCCCCCCCEEECC Q ss_conf 8653200037565367416 Q gi|254781180|r 52 MAKYSTRKLKPRGRVIFAD 70 (71) Q Consensus 52 makystrklkprgrvifad 70 (71) +.+--.|-|||.|+++|+| T Consensus 138 l~~e~~RvLKPGG~llitD 156 (263) T PTZ00098 138 LFEKCYKWLKPNGILLITD 156 (263) T ss_pred HHHHHHHHCCCCCEEEEEE T ss_conf 9999999846887899975 No 4 >PHA00407 phage lambda Rz1-like protein Probab=21.31 E-value=24 Score=18.46 Aligned_cols=15 Identities=80% Similarity=0.935 Sum_probs=10.9 Q ss_pred HCCCCCCHHHHHHHHHHHCCH Q ss_conf 161001098866578862713 Q gi|254781180|r 23 EEPQKVTVDQINNAIASLIPE 43 (71) Q Consensus 23 eepqkvtvdqinnaiaslipe 43 (71) -||||+||| |||.-| T Consensus 57 ~ep~k~TVD------aSLMVe 71 (84) T PHA00407 57 VEPQKVTVD------ASLMVE 71 (84) T ss_pred CCCCCCEEE------EEEEEC T ss_conf 996421332------024547 No 5 >pfam02390 Methyltransf_4 Putative methyltransferase. This is a family of putative methyltransferases. The aligned region contains the GXGXG S-AdoMet binding site suggesting a putative methyltransferase activity. Probab=20.22 E-value=49 Score=16.76 Aligned_cols=28 Identities=43% Similarity=0.509 Sum_probs=23.3 Q ss_pred HHHHHHHHHHHHHHHCCCCCCCEEECCC Q ss_conf 6775999986532000375653674169 Q gi|254781180|r 44 ERRDLQDRMAKYSTRKLKPRGRVIFADD 71 (71) Q Consensus 44 errdlqdrmakystrklkprgrvifadd 71 (71) .||=++......-.+.|||.|.+.|+.| T Consensus 111 KRRli~~~fl~~~~~~Lk~gG~l~~~TD 138 (199) T pfam02390 111 KRRLLQPEFLKEYARVLKPGGVLHLATD 138 (199) T ss_pred CCCCCCHHHHHHHHHHCCCCCEEEEEEC T ss_conf 4000799999999996388989999828 No 6 >pfam05491 RuvB_C Holliday junction DNA helicase ruvB C-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family consists of the C-terminal region of the RuvB protein which is thought to be helicase DNA-binding domain. Probab=18.83 E-value=58 Score=16.38 Aligned_cols=34 Identities=32% Similarity=0.587 Sum_probs=26.5 Q ss_pred HHHHHHCCHHHHHHHHHHHHHHHH----CCCCCCCEEE Q ss_conf 578862713677599998653200----0375653674 Q gi|254781180|r 35 NAIASLIPEERRDLQDRMAKYSTR----KLKPRGRVIF 68 (71) Q Consensus 35 naiaslipeerrdlqdrmakystr----klkprgrvif 68 (71) ++||+.+-|++..+.|-.--|--+ +-.||||++- T Consensus 28 ~tla~~l~e~~~TiE~viEPyLi~~G~i~RTprGR~~T 65 (75) T pfam05491 28 DTLAAALGEERDTIEDVIEPYLIQIGFIQRTPRGRVAT 65 (75) T ss_pred HHHHHHHCCCHHHHHHHHHHHHHHHCCHHCCCCHHHHH T ss_conf 99999986874089998439999954432088548866 No 7 >pfam11460 DUF3007 Protein of unknown function (DUF3007). This is a family of uncharacterized proteins found in bacteria and eukaryotes. Probab=18.26 E-value=88 Score=15.39 Aligned_cols=42 Identities=24% Similarity=0.331 Sum_probs=33.3 Q ss_pred CCCCCCHHHHHHHCCC-CCCHHHHHHHHHHHCCHHHHHHHHHH Q ss_conf 2222420110001610-01098866578862713677599998 Q gi|254781180|r 11 CDLVNNEQLTEIEEPQ-KVTVDQINNAIASLIPEERRDLQDRM 52 (71) Q Consensus 11 cdlvnneqlteieepq-kvtvdqinnaiaslipeerrdlqdrm 52 (71) -+..-++|+...|+.. +++-+++.+-..+|-|||...|+... T Consensus 60 g~MTy~~Qrk~Ye~a~~~~~~~~lqkR~e~ls~eE~~~L~~ei 102 (104) T pfam11460 60 GKMTYMQQRRDYREAYDALTNEELQKRFDSLSPEELEALQAEL 102 (104) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH T ss_conf 8775899999999999987689999999859999999999986 No 8 >TIGR02348 GroEL chaperonin GroL; InterPro: IPR012723 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism. Folding of newly synthesised polypeptides in the crowded cellular environment requires the assistance of molecular chaperone proteins, such as the large bacterial chaperonins GroEL and GroES. GroEL and GroES prevent aggregation by encapsulating individual chains within the so-called Anfinsen cage provided by the GroELGroES complex, where they can fold in isolation from one another . GroEL consists of two heptameric rings of identical ATPase subunits stacked back to back, containing a cage in each ring. Each subunit consists of three domains. The equatorial domain contains the nucleotide binding site and is connected by a flexible intermediate domain with the apical domain. The latter presents several hydrophobic amino-acid side chains at the top of the ring, orientated towards the cavity of the cage. These side chains are involved in binding either a partially folded polypeptide chain or a single molecule of GroES. This family consists of GroEL, found in bacteria, organelles derived from bacteria, and occasionally in archaeal species. The bacterial GroEL/GroES group I chaperonin is replaced by a group II chaperonin, usually called the thermosome in archaeal species, and CCT (chaperone-containing TCP) in eukaryotes. GroEL, thermosome subunits, and CCT subunits all fall under the scope of IPR002423 from INTERPRO.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding. Probab=17.19 E-value=1.1e+02 Score=14.83 Aligned_cols=29 Identities=34% Similarity=0.544 Sum_probs=19.6 Q ss_pred CCHHHHHHHHHHHCCH-HHHHHHHHHHHHH Q ss_conf 1098866578862713-6775999986532 Q gi|254781180|r 28 VTVDQINNAIASLIPE-ERRDLQDRMAKYS 56 (71) Q Consensus 28 vtvdqinnaiaslipe-errdlqdrmakys 56 (71) --|.||..-|..---+ +|-.||.||||.+ T Consensus 342 ~Rv~qIk~qi~~t~SdYDrEKL~ERLAKL~ 371 (528) T TIGR02348 342 ARVAQIKAQIEETTSDYDREKLQERLAKLA 371 (528) T ss_pred HHHHHHHHHHHHCCCCCCHHHHHHHHHHHH T ss_conf 999999999862046200678998878760 No 9 >pfam11304 DUF3106 Protein of unknown function (DUF3106). Some members in this family of proteins are annotated as transmembrane proteins however this cannot be confirmed. Currently no function is known. Probab=16.54 E-value=1.1e+02 Score=14.97 Aligned_cols=36 Identities=25% Similarity=0.477 Sum_probs=28.1 Q ss_pred HHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHH Q ss_conf 001610010988665788627136775999986532 Q gi|254781180|r 21 EIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYS 56 (71) Q Consensus 21 eieepqkvtvdqinnaiaslipeerrdlqdrmakys 56 (71) .+.+.|+--.-.|.....++-||++.-++.||..++ T Consensus 22 ~l~~~qr~kwl~~A~r~~~mspeeq~rl~~Rm~~W~ 57 (107) T pfam11304 22 SLSPEQRQKWLRIAERYPKMSPEEQKRLQERMTRWA 57 (107) T ss_pred CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH T ss_conf 599899999999987630199999999999999998 No 10 >KOG1715 consensus Probab=16.03 E-value=1.2e+02 Score=14.67 Aligned_cols=48 Identities=27% Similarity=0.262 Sum_probs=30.6 Q ss_pred CCCCCCCCCCCHHHHHH-HCCCCCCHHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 04454222242011000-1610010988665788627136775999986 Q gi|254781180|r 6 QSTNSCDLVNNEQLTEI-EEPQKVTVDQINNAIASLIPEERRDLQDRMA 53 (71) Q Consensus 6 qstnscdlvnneqltei-eepqkvtvdqinnaiaslipeerrdlqdrma 53 (71) ++-++|.---+--+..+ ..|.---+.+|-+-|+||-.+|.+||-+-.- T Consensus 35 ~~~~~~~~~~~~~~~~~~~~~~~~KI~~iv~eIssLtLlE~s~L~~~Lk 83 (187) T KOG1715 35 SSKSSTLSHRATPLPPIAAVPPPPKISKIVDEISSLTLLETSDLVDLLK 83 (187) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH T ss_conf 6666544466677885345688777999999998557999999999999 Done!