BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 148 bits (373), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKL 60 MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKL Sbjct: 1 MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKL 60 Query: 61 KPRGRVIFADD 71 KPRGRVIFADD Sbjct: 61 KPRGRVIFADD 71 >gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 34.7 bits (78), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 21/26 (80%) Query: 26 QKVTVDQINNAIASLIPEERRDLQDR 51 QK+TVDQI+N+I L PE+R++L R Sbjct: 46 QKLTVDQIDNSIMFLYPEQRQELAKR 71 >gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 28.5 bits (62), Expect = 0.024, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 22/30 (73%) Query: 23 EEPQKVTVDQINNAIASLIPEERRDLQDRM 52 +EP+K+ DQ+ +A+ L EE+++LQ ++ Sbjct: 22 DEPKKLNPDQLCDAVCRLTLEEQKELQTKV 51 >gi|254780832|ref|YP_003065245.1| putative potassium uptake transport system protein [Candidatus Liberibacter asiaticus str. psy62] Length = 628 Score = 21.2 bits (43), Expect = 3.0, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 13 LVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTR 58 L+ N + I Q + + IN A IP+E+R + ++++++ +R Sbjct: 497 LLQNIKHNRILHEQNIIL-TINTANQPRIPKEKRFVCEKISEHFSR 541 >gi|254780805|ref|YP_003065218.1| chromosome partitioning protein B [Candidatus Liberibacter asiaticus str. psy62] Length = 300 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 26 QKVTVDQINNAIASLIPEERRDLQDRMAKYS 56 Q + V I+N + +I ERR +MA S Sbjct: 77 QPLIVRAIDNGLYKIIAGERRFRAAKMASLS 107 >gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 11/12 (91%) Query: 32 QINNAIASLIPE 43 ++NNA+A LIP+ Sbjct: 229 KVNNAVAMLIPK 240 >gi|254780185|ref|YP_003064598.1| glutamine synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Score = 20.8 bits (42), Expect = 4.1, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 19 LTEIEEPQKVTVDQINNAIASLIPEERR 46 LT+ + P K+T N++ + IP E + Sbjct: 317 LTDSQSPTKLTYSTHNHSASCRIPYENK 344 >gi|255764514|ref|YP_003065586.2| DNA repair protein RecN [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 20.0 bits (40), Expect = 7.0, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 32 QINNAIASLIPEERRDLQDRM 52 +I +A L P+ERR+ RM Sbjct: 513 RIETYVAVLTPQERREEIARM 533 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.129 0.353 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,303 Number of Sequences: 1233 Number of extensions: 1312 Number of successful extensions: 13 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 31 (16.5 bits)