BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] gi|254040858|gb|ACT57654.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 160 bits (406), Expect = 5e-38, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFL 60 MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFL Sbjct: 1 MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFL 60 Query: 61 YPEQRQELAKRYKEKYNDVLIHLPD 85 YPEQRQELAKRYKEKYNDVLIHLPD Sbjct: 61 YPEQRQELAKRYKEKYNDVLIHLPD 85 >gi|195388634|ref|XP_002052984.1| GJ23582 [Drosophila virilis] gi|194151070|gb|EDW66504.1| GJ23582 [Drosophila virilis] Length = 196 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 18 RLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQ-IDNSIMFLYPEQRQELAKRYKEKY 76 RL L NFG P V +Q N+SQKL++ + + +++ P+ R+ + KR K+ Sbjct: 18 RLFLPNFGPPPSLAYLVHQQHSPRTNSSQKLSLKNLLGDGVLWAVPKHRRSVEKRLNRKF 77 >gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] gi|254040857|gb|ACT57653.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 35.0 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 21/26 (80%) Query: 46 QKLTVDQIDNSIMFLYPEQRQELAKR 71 QK+TVDQI+N+I L PE+R++L R Sbjct: 26 QKVTVDQINNAIASLIPEERRDLQDR 51 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.323 0.137 0.387 Lambda K H 0.267 0.0431 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 821,078,963 Number of Sequences: 14124377 Number of extensions: 25703982 Number of successful extensions: 77469 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 77467 Number of HSP's gapped (non-prelim): 3 length of query: 85 length of database: 4,842,793,630 effective HSP length: 55 effective length of query: 30 effective length of database: 4,065,952,895 effective search space: 121978586850 effective search space used: 121978586850 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 76 (33.8 bits)