RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Score = 29.4 bits (66), Expect = 0.19 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQE+ + YK Y LI Sbjct: 51 NRQRQEVCQSYKSLYGKDLIA 71 Score = 28.7 bits (64), Expect = 0.30 Identities = 5/21 (23%), Positives = 11/21 (52%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQ++ + +K + L+ Sbjct: 394 NVQRQQIRQTFKSHFGRDLMT 414 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 29.6 bits (65), Expect = 0.19 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 11/35 (31%) Query: 35 QKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELA 69 +KQA AS KL D D++ P LA Sbjct: 18 EKQALKKLQASLKLYAD--DSA-----P----ALA 41 >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Score = 28.7 bits (64), Expect = 0.30 Identities = 5/21 (23%), Positives = 11/21 (52%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 E+R+EL ++++ I Sbjct: 34 AEERKELRTQFQDTTGLEFIA 54 >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Score = 28.4 bits (63), Expect = 0.36 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQ++AK +K ++ L Sbjct: 53 NTQRQQIAKSFKAQFGKDLTE 73 >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Score = 28.0 bits (62), Expect = 0.47 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 EQR + K Y E Y + L+ Sbjct: 48 AEQRNLIRKTYAETYGEDLLK 68 >1axn_A Annexin III; annexin family; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Score = 27.6 bits (61), Expect = 0.61 Identities = 7/21 (33%), Positives = 9/21 (42%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQ + K Y+ Y L Sbjct: 50 NAQRQLIVKEYQAAYGKELKD 70 >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix bundle, heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Score = 27.7 bits (61), Expect = 0.66 Identities = 6/21 (28%), Positives = 10/21 (47%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQ++A Y+ + L Sbjct: 34 NAQRQDIAFAYQRRTKKELAS 54 >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Score = 27.2 bits (60), Expect = 1.00 Identities = 7/21 (33%), Positives = 11/21 (52%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQE+A +K + L+ Sbjct: 46 NAQRQEIASAFKTLFGRDLVD 66 >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 26.8 bits (59), Expect = 1.2 Identities = 6/24 (25%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Query: 64 QRQELAKRYKEKYNDVLIHL--PD 85 R+ + KR + ++ I L P+ Sbjct: 3 TRESIDKRAGRRGPNLNIVLTCPE 26 >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Score = 26.9 bits (59), Expect = 1.3 Identities = 3/21 (14%), Positives = 8/21 (38%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 P Q + + + ++ L Sbjct: 41 PNQLRNMQRTFQAITGTFLDA 61 >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra attenuata} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Score = 26.1 bits (57), Expect = 2.0 Identities = 5/21 (23%), Positives = 8/21 (38%) Query: 62 PEQRQELAKRYKEKYNDVLIH 82 QRQ++ Y + L Sbjct: 44 NAQRQQIKTDYTTLFGKHLED 64 >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Score = 24.8 bits (54), Expect = 5.3 Identities = 5/29 (17%), Positives = 10/29 (34%) Query: 53 IDNSIMFLYPEQRQELAKRYKEKYNDVLI 81 ID + P ++A + + I Sbjct: 33 IDLRGIVSRPRLLSQVADILFQTAQNAGI 61 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 24.5 bits (53), Expect = 6.0 Identities = 6/21 (28%), Positives = 11/21 (52%), Gaps = 6/21 (28%) Query: 2 HQPS--FL----VSYPLVAVV 16 + P +L +S PL+ V+ Sbjct: 224 NTPDKDYLLSIPISCPLIGVI 244 Score = 24.5 bits (53), Expect = 6.5 Identities = 15/77 (19%), Positives = 27/77 (35%), Gaps = 24/77 (31%) Query: 5 SFLVSYP---LVAVVIRLILKNFGCPL----------KRIVKVQKQ---------AKSLA 42 + +VS P L + L L+ P +R +K + + L Sbjct: 376 NLVVSGPPQSLYGLN--LTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLV 433 Query: 43 NASQKLTVDQIDNSIMF 59 AS + D + N++ F Sbjct: 434 PASDLINKDLVKNNVSF 450 >1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Length = 394 Score = 24.4 bits (52), Expect = 6.8 Identities = 5/22 (22%), Positives = 11/22 (50%) Query: 63 EQRQELAKRYKEKYNDVLIHLP 84 +++E+ + YKE + L Sbjct: 250 LKKREIYEWYKEFLGEYFSFLD 271 >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xmp_A* Length = 416 Score = 24.1 bits (52), Expect = 8.5 Identities = 11/48 (22%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 38 AKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVL-IHLP 84 K+ NA Q ++ + LY +E +K D + +H P Sbjct: 88 TKTFHNALQGNESLKLTEEMKELYLNVNRENSKFIDLSSFDYVLVHDP 135 >3kx6_A Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, glycolysis, lyase, structural genomics; HET: CIT; 2.10A {Babesia bovis} Length = 379 Score = 24.1 bits (52), Expect = 8.9 Identities = 10/48 (20%), Positives = 21/48 (43%), Gaps = 12/48 (25%) Query: 31 IVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYND 78 +KV K ++ N ++++ +D LA+R ++ YN Sbjct: 123 GIKVDKGLVTIPNTDEEVSTTGLDG------------LAERCQKYYNA 158 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.137 0.387 Gapped Lambda K H 0.267 0.0598 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 672,450 Number of extensions: 23648 Number of successful extensions: 147 Number of sequences better than 10.0: 1 Number of HSP's gapped: 147 Number of HSP's successfully gapped: 30 Length of query: 85 Length of database: 5,693,230 Length adjustment: 53 Effective length of query: 32 Effective length of database: 4,408,298 Effective search space: 141065536 Effective search space used: 141065536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.3 bits)