BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781182|ref|YP_003065595.1| hypothetical protein
CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62]
         (94 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781182|ref|YP_003065595.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040859|gb|ACT57655.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 94

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
          MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD
Sbjct: 1  MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60

Query: 61 ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
          ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG
Sbjct: 61 ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94


>gi|315122553|ref|YP_004063042.1| hypothetical protein CKC_04025 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495955|gb|ADR52554.1| hypothetical protein CKC_04025 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 246

 Score = 91.2 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 70/93 (75%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           + DDQG+ I+F     L ++ + L++ NLI  E++EWSN +R+ GNKAVHEG++ IE+++
Sbjct: 154 ITDDQGKAIDFSNNINLKNKIKSLREQNLITRELYEWSNHIRLAGNKAVHEGEAHIEDAN 213

Query: 61  ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           EC EFV+LFC I+FTLPALI++ K  + ++S +
Sbjct: 214 ECFEFVHLFCHILFTLPALIEQNKLINSDKSTE 246


>gi|123442587|ref|YP_001006564.1| hypothetical protein YE2343 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089548|emb|CAL12396.1| hypothetical phage protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 197

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLE 64
           G+  N E+   LS R   L     I E++ +W++ VRI+ N AVH  +  + +E++E + 
Sbjct: 116 GEESNKEQ---LSQRISMLYGKGKITEQMKDWAHIVRIDSNGAVHSDEAFTKDEAEEVIG 172

Query: 65  FVNLFCDIVFTLPALIKEKKSTHPN 89
           F  +F    FTLP ++  K++    
Sbjct: 173 FTEVFLIYSFTLPEMVTAKQNASRE 197


>gi|218782532|ref|YP_002433850.1| hypothetical protein Dalk_4704 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763916|gb|ACL06382.1| conserved hypothetical protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 233

 Score = 83.9 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL 63
           ++ + +N      L  R  +L  +  + E + + S  +R +GN   H G  + E++++ L
Sbjct: 142 EEAEGLNGRVVRSLGYRLPWLFDNGYLPEGLRDLSTCLREDGNDGAHAGNLTHEDAEDLL 201

Query: 64  EFVNLFCDIVFTLPALIK---EKKSTHPN 89
           EF  +  + ++T P  ++   E+++   N
Sbjct: 202 EFTTILLERIYTEPEKLRLAQERRNARRN 230


>gi|218688916|ref|YP_002397128.1| hypothetical protein ECED1_1107 [Escherichia coli ED1a]
 gi|218426480|emb|CAR07308.1| hypothetical protein ECED1_1107 [Escherichia coli ED1a]
          Length = 224

 Score = 83.9 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVNLFCDIV 73
             LS R + + +  LI E++ EW++ VRI+ NKAVH  +  +  E+ + L F  +F    
Sbjct: 144 ESLSQRIQMIYKKGLITEQMKEWAHIVRIDANKAVHTDEVFTPIEASQILSFTEMFLVYA 203

Query: 74  FTLPALIKEKKSTHPNQS 91
           FTLPA+++ ++    + S
Sbjct: 204 FTLPAMVEARREQKRSDS 221


>gi|218663727|ref|ZP_03519657.1| hypothetical protein RetlI_32940 [Rhizobium etli IE4771]
          Length = 233

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 35/76 (46%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           E  G L+ + + L    ++   + +W++ +RI GN   H+   + E+      F + F  
Sbjct: 157 ELGGTLAGKIKALVSQGVLPASLGDWADEIRIVGNDGAHDDGVNREDLKAARMFCDSFLR 216

Query: 72  IVFTLPALIKEKKSTH 87
            + TLP  I+ ++   
Sbjct: 217 YLITLPKEIELRRQQI 232


>gi|260845531|ref|YP_003223309.1| hypothetical protein ECO103_3438 [Escherichia coli O103:H2 str.
           12009]
 gi|257760678|dbj|BAI32175.1| hypothetical protein ECO103_3438 [Escherichia coli O103:H2 str.
           12009]
          Length = 209

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----LEFVN 67
           E    ++D  + L +   +   I + ++  RI GN+AVH G+ S+E+  +      + +N
Sbjct: 115 EPGKNINDDIKSLVEKG-LPPRIQQAADICRIVGNQAVHPGEISLEDDPQLTHGLFKLLN 173

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 174 IIVDDRITRPKEIEAMFQSMPEGPRQG 200


>gi|283788456|ref|YP_003368321.1| hypothetical protein ROD_49471 [Citrobacter rodentium ICC168]
 gi|282951910|emb|CBG91628.1| hypothetical protein ROD_49471 [Citrobacter rodentium ICC168]
          Length = 209

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----LEFVN 67
           E    ++D  + L +   +   I + ++  RI GN+AVH G+ S+++  +      + +N
Sbjct: 115 EPGKNINDDIKSLVEKG-LPPRIQQAADICRIVGNQAVHPGEISLDDDPQLTHGLFKLLN 173

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 174 IIVDDRITRPKEIEAMFQSMPEGPRQG 200


>gi|206577454|ref|YP_002236657.1| hypothetical protein KPK_0785 [Klebsiella pneumoniae 342]
 gi|206566512|gb|ACI08288.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 210

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E    ++   + L +   +   I + ++  RI GN+AVH G+ S+++    +    + +N
Sbjct: 115 EPGNNINADIKSLVEKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLAHGLFKLLN 173

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 174 IIVDDRITRPKEIEAMFQSMPEGPRQG 200


>gi|256024627|ref|ZP_05438492.1| hypothetical protein E4_14714 [Escherichia sp. 4_1_40B]
          Length = 213

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----LEFVN 67
           E    ++   + L +   +   I + ++  RI GN+AVH G+ S+++  +      + +N
Sbjct: 119 EPGNNINADIKSLVEKG-LPPRIQQAADVCRIVGNQAVHPGEISLDDDPQLTHGLFKLLN 177

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 178 IIVDDRITRPKEIEAMFQSMPEGPRQG 204


>gi|254503691|ref|ZP_05115842.1| hypothetical protein SADFL11_3730 [Labrenzia alexandrii DFL-11]
 gi|222439762|gb|EEE46441.1| hypothetical protein SADFL11_3730 [Labrenzia alexandrii DFL-11]
          Length = 242

 Score = 81.2 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 39/72 (54%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
           +   L  R   L+   +I + + +W++ +RI+GN A HEG    E   E + F+ LF DI
Sbjct: 169 ENRKLISRINDLRDQGVITQGLADWAHHIRIDGNLAAHEGVGDQEAVREYIGFLRLFLDI 228

Query: 73  VFTLPALIKEKK 84
           VF LP  I  ++
Sbjct: 229 VFALPERIAARR 240


>gi|309793931|ref|ZP_07688356.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308122338|gb|EFO59600.1| conserved hypothetical protein [Escherichia coli MS 145-7]
          Length = 219

 Score = 80.8 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E    ++   R L Q   +   I + ++  RI GN+AVH G+ S+++    +    + +N
Sbjct: 117 EPGENINKDIRSLVQKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLAHGLFKLLN 175

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 176 IIVDDRITRPKEIEAMFQSMPEGPRQG 202


>gi|187734081|ref|YP_001881654.1| hypothetical protein SbBS512_E3301 [Shigella boydii CDC 3083-94]
 gi|187431073|gb|ACD10347.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
          Length = 212

 Score = 80.8 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E    ++   R L Q   +   I + ++  RI GN+AVH G+ S+++    +    + +N
Sbjct: 110 EPGNNINADIRSLVQKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLAHGLFKLLN 168

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +      T P  I+    + P   R G
Sbjct: 169 IIVTEQITRPKEIEAMFQSMPEGPRQG 195


>gi|114777354|ref|ZP_01452351.1| hypothetical protein SPV1_13679 [Mariprofundus ferrooxydans PV-1]
 gi|114552136|gb|EAU54638.1| hypothetical protein SPV1_13679 [Mariprofundus ferrooxydans PV-1]
          Length = 212

 Score = 80.4 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 37/86 (43%), Gaps = 5/86 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ----SSIEESDECLEFVN 67
           E    +++    L +   +   + +  + VR+ GN+AVH G        E +      VN
Sbjct: 121 ESGKNINNDIAALVKKG-LNPTLQKSLDVVRVIGNEAVHPGTIDLNDEPETAIALFNLVN 179

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRD 93
           +    + T P +I+    + P++ R+
Sbjct: 180 IITQAMITQPKMIESLYESLPDEKRN 205


>gi|300947579|ref|ZP_07161753.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300452830|gb|EFK16450.1| conserved hypothetical protein [Escherichia coli MS 116-1]
          Length = 210

 Score = 80.4 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE----CLEFVN 67
           E    ++   + L +   +   I + ++  RI GN+AVH G+ S+++  +      + +N
Sbjct: 115 EPGENINKDIKSLVEKG-LPPRIQQAADICRIVGNQAVHPGEISLDDDPQLTHGLFKLLN 173

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRD 93
           +  D   T P  I+    + P   R 
Sbjct: 174 IIVDDRITRPKEIEAMFQSMPEGPRQ 199


>gi|91783377|ref|YP_558583.1| hypothetical protein Bxe_A2440 [Burkholderia xenovorans LB400]
 gi|91687331|gb|ABE30531.1| hypothetical protein Bxe_A2440 [Burkholderia xenovorans LB400]
          Length = 235

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 40/84 (47%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL 63
           D+   +N +    L  R  ++ ++N++   + + +  V+ +GN   H+G  S  ++++  
Sbjct: 140 DETPGLNAQGRRSLGLRMNWMFENNILPAALQDLAQCVKDDGNDGAHDGTLSAVDAEDLQ 199

Query: 64  EFVNLFCDIVFTLPALIKEKKSTH 87
           EF     + ++T P  ++  K   
Sbjct: 200 EFTFELLERLYTEPKRLEIAKERR 223


>gi|288576378|ref|ZP_05978685.2| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
 gi|288565657|gb|EFC87217.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
          Length = 233

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 38/87 (43%), Gaps = 4/87 (4%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E+   ++   R L +  ++  ++ + ++ +RI GN AVH GQ   E+    + +  + +N
Sbjct: 124 EEGKNINTDIRSLVKKEVLSGQVVKVADTLRITGNNAVHPGQIVDEDFDKVAAKMFDLIN 183

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
                  T P  + E     P  +R  
Sbjct: 184 FIVKKAITEPKELDELYQLMPENARTA 210


>gi|260856986|ref|YP_003230877.1| hypothetical protein ECO26_3952 [Escherichia coli O26:H11 str.
           11368]
 gi|257755635|dbj|BAI27137.1| hypothetical protein ECO26_3952 [Escherichia coli O26:H11 str.
           11368]
          Length = 174

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E    ++   R L Q   +   I + ++  RI GN+AVH G+ S+++    +    + +N
Sbjct: 72  EPGENINKDIRSLVQKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLAHGLFKLLN 130

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 131 IIVDDRITRPKEIEAMFQSMPEGPRQG 157


>gi|78485663|ref|YP_391588.1| hypothetical protein Tcr_1319 [Thiomicrospira crunogena XCL-2]
 gi|78363949|gb|ABB41914.1| hypothetical protein Tcr_1319 [Thiomicrospira crunogena XCL-2]
          Length = 232

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + + +N      L  R  +L    ++ E + + S  ++ +GN   HEG  S E++++ L+
Sbjct: 143 EEEGLNARVKRNLGLRLPWLFDKGVLPEALRDLSGCIKDDGNDGAHEGTLSEEDAEDLLD 202

Query: 65  FVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
           F ++  + ++T P  ++  K     + R G
Sbjct: 203 FTSVLLERIYTEPERLRLAKERR--EKRRG 230


>gi|213022360|ref|ZP_03336807.1| hypothetical protein Salmonelentericaenterica_06794 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 217

 Score = 78.5 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 11  FEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFV 66
            E    ++   R L +   +   I + ++  RI GN+AVH G+ ++++    +    + +
Sbjct: 114 KEPGENINTDIRSLVKKG-LPVRIQQAADICRIVGNQAVHPGEINLDDDPKLAHGLFKLL 172

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRDG 94
           N+  D   T P  +++   + P   R G
Sbjct: 173 NIIVDDQITRPKELEDMFLSMPEGPRQG 200


>gi|171779682|ref|ZP_02920638.1| hypothetical protein STRINF_01519 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281784|gb|EDT47218.1| hypothetical protein STRINF_01519 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 244

 Score = 78.1 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNL 68
           +   L+++  YL +  +   EI +  + VR+ GN AVH GQ  +++    +   L FVNL
Sbjct: 154 EGKDLNNKIGYLVRQGM-PIEIQQMLDSVRVVGNNAVHPGQIDLKDNKELAASLLTFVNL 212

Query: 69  FCDIVFTLPALIKEKKSTHPNQSRDG 94
             D   + P  IK    + P   R  
Sbjct: 213 IVDNRISQPKKIKSVYDSLPESYRKA 238


>gi|295688019|ref|YP_003591712.1| hypothetical protein Cseg_0582 [Caulobacter segnis ATCC 21756]
 gi|295429922|gb|ADG09094.1| hypothetical protein Cseg_0582 [Caulobacter segnis ATCC 21756]
          Length = 237

 Score = 78.1 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 4   DQGQRINFEK-CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDE 61
           D G +I F    G L  +   L   + I   + EW++ VR+ GN   H+    + +++  
Sbjct: 137 DLGLKIRFPDLKGDLYKKVDKLASDHEIPLSLAEWAHEVRVIGNDGAHDLDGCNTDDAQA 196

Query: 62  CLEFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
             +FV+     +F+LP +I  ++    ++  +
Sbjct: 197 AHDFVDAVLRYLFSLPGMIAARRRIETSEETE 228


>gi|188533144|ref|YP_001906941.1| Hypothetical protein, probable Cecropin family protein [Erwinia
           tasmaniensis Et1/99]
 gi|188028186|emb|CAO96044.1| Hypothetical protein, probable Cecropin family protein [Erwinia
           tasmaniensis Et1/99]
          Length = 232

 Score = 78.1 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECLEFVNLFCDIVFT 75
           L  R   LK+  +I +E++EW++ VR++GN+  H E +   + +   L F   F    FT
Sbjct: 156 LQKRIEKLKEKGVITKEMYEWADIVRLDGNEQTHSEDEFDPQSAKAVLAFTETFLLYAFT 215

Query: 76  LPALIKEKKS 85
           LP +++EK+ 
Sbjct: 216 LPEMVREKRK 225


>gi|157375342|ref|YP_001473942.1| hypothetical protein Ssed_2205 [Shewanella sediminis HAW-EB3]
 gi|157317716|gb|ABV36814.1| conserved hypothetical protein [Shewanella sediminis HAW-EB3]
          Length = 219

 Score = 77.7 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           EK   +++  R L  +N +   + + ++ VRI GN AVH G+ S ++    + +  E +N
Sbjct: 125 EKGDNINEDIRALASNNTLPPLVVKVADTVRITGNNAVHPGEMSDDDFDHIASKMFELLN 184

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRD 93
                  T P  +    S  P   R 
Sbjct: 185 FIVKKGITEPNELMALYSMTPEGPRK 210


>gi|212703623|ref|ZP_03311751.1| hypothetical protein DESPIG_01668 [Desulfovibrio piger ATCC 29098]
 gi|212672953|gb|EEB33436.1| hypothetical protein DESPIG_01668 [Desulfovibrio piger ATCC 29098]
          Length = 104

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
           +   L DR   L +  +I   + EW++ +R  GN+A H+ + S +E+ E + F  +F   
Sbjct: 29  EGKSLYDRIDNLYKKGVITASLKEWASIIRRAGNEAAHDMEGSPDEAGELVAFTRIFLQF 88

Query: 73  VFTLPALIKEKKSTH 87
            F LP +I   +   
Sbjct: 89  TFELPDIISRTRVAR 103


>gi|289583327|ref|YP_003481737.1| hypothetical protein Nmag_3626 [Natrialba magadii ATCC 43099]
 gi|289532825|gb|ADD07175.1| conserved hypothetical protein [Natrialba magadii ATCC 43099]
          Length = 213

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 38/96 (39%), Gaps = 4/96 (4%)

Query: 3   DDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ----SSIEE 58
           +   Q +  ++   L      L     I E + +  + VR+ GN  VH G+       E 
Sbjct: 112 EKLTQDLTGKEGQSLYQNIGDLVDDGQIDERVQQALDSVRVTGNDYVHAGEIYNPDDREV 171

Query: 59  SDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +    E VN+  ++  T   LI+E  S  P   + G
Sbjct: 172 ALRLFELVNIIVELTITREKLIEEAYSDIPENKKKG 207


>gi|223934041|ref|ZP_03625994.1| conserved hypothetical protein [Streptococcus suis 89/1591]
 gi|223897298|gb|EEF63706.1| conserved hypothetical protein [Streptococcus suis 89/1591]
          Length = 239

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 5/82 (6%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCD 71
            L+ +   L    +   EI +  + VR+ GN AVH GQ  I++    +   L FVNL  D
Sbjct: 152 DLNKKIGNLVAKGM-PIEIQQMLDSVRVIGNNAVHPGQIEIQDNKELALSLLNFVNLITD 210

Query: 72  IVFTLPALIKEKKSTHPNQSRD 93
              + P  I E     P   + 
Sbjct: 211 SQISQPKKIAEIYGLLPESYKK 232


>gi|298369610|ref|ZP_06980927.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282167|gb|EFI23655.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 220

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 4/87 (4%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E+   ++   R L    +    + + ++ +RI GN AVH GQ S  +    + +  + +N
Sbjct: 121 EEGKNINTDIRSLVNKGVFSGRVVQVADTLRITGNNAVHPGQISDADFDKAAAKMFDLIN 180

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
                  T P  + E     P  +R+ 
Sbjct: 181 FIVKKAITEPKELDELYQLMPENARNA 207


>gi|301643791|ref|ZP_07243828.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|301077824|gb|EFK92630.1| conserved hypothetical protein [Escherichia coli MS 146-1]
          Length = 150

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----LEFVN 67
           E    ++   + L +   +   I + ++  RI GN+AVH G+ S+++  +      + +N
Sbjct: 55  EPGNNINADIKSLVEKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLTHGLFKLLN 113

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D   T P  I+    + P   R G
Sbjct: 114 IIVDDRITRPKEIEAMFQSMPEGPRQG 140


>gi|315181344|gb|ADT88257.1| conserved hypothetical protein [Vibrio furnissii NCTC 11218]
 gi|315182792|gb|ADT89705.1| hypothetical protein vfu_B01540 [Vibrio furnissii NCTC 11218]
          Length = 107

 Score = 75.0 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 13 KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNL 68
          K   ++D    L ++  +  +I +  + VR+ GN AVH G+ S+E+           +N+
Sbjct: 15 KGKNINDDIAVLVKNG-LPVKIQQALDVVRVVGNNAVHPGEISLEDHPQVVTALFNLINM 73

Query: 69 FCDIVFTLPALIKEKKSTHPNQSRDG 94
            D   T P  + E  +  P  ++  
Sbjct: 74 IVDNQITQPKQVAELFAFLPENAKSA 99


>gi|149004391|ref|ZP_01829131.1| hypothetical protein CGSSp14BS69_07031 [Streptococcus pneumoniae
           SP14-BS69]
 gi|149004569|ref|ZP_01829262.1| hypothetical protein CGSSp14BS69_06037 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147757543|gb|EDK64568.1| hypothetical protein CGSSp14BS69_06037 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147757640|gb|EDK64658.1| hypothetical protein CGSSp14BS69_07031 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 236

 Score = 74.6 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNL 68
           +   L+ +   L    +   EI +  + VR+ GN AVH GQ  I++    +   L F+NL
Sbjct: 146 QGKDLNTQIGSLVSKGM-PIEIQQMLDSVRVIGNNAVHPGQIDIKDNKELALSLLSFINL 204

Query: 69  FCDIVFTLPALIKEKKSTHPNQSRD 93
             D   T P  I +  +  P+  R+
Sbjct: 205 IVDNRITQPKKILDIYNLLPDSYRN 229


>gi|261252788|ref|ZP_05945361.1| hypothetical protein VIA_002812 [Vibrio orientalis CIP 102891]
 gi|260936179|gb|EEX92168.1| hypothetical protein VIA_002812 [Vibrio orientalis CIP 102891]
          Length = 225

 Score = 74.2 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 39/86 (45%), Gaps = 5/86 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           EK   ++   + L +   +   + +  + +RI GN AVH G+ ++++      +  + +N
Sbjct: 130 EKGDNINQDIKNLVKKG-LNPLVQKSLDSLRITGNNAVHPGEINLDDEPQRVLKLFDLLN 188

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRD 93
                + T P  I+      P+ +++
Sbjct: 189 FIATKMITEPKEIESFYDDLPDPAKE 214


>gi|323154740|gb|EFZ40938.1| hypothetical protein ECEPECA14_3348 [Escherichia coli EPECa14]
          Length = 108

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 12 EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
          E    ++   R L Q   +   I + ++  RI GN+AVH G+ S+++    +    + +N
Sbjct: 6  EPGENINKDIRSLVQKG-LPVRIQQAADICRIVGNQAVHPGEISLDDDPQLAHGLFKLLN 64

Query: 68 LFCDIVFTLPALIKEKKSTHPNQSRDG 94
          +  D   T P  I+    + P   R G
Sbjct: 65 IIVDDRITRPKEIEAMFQSMPEGPRQG 91


>gi|193212757|ref|YP_001998710.1| hypothetical protein Cpar_1103 [Chlorobaculum parvum NCIB 8327]
 gi|193086234|gb|ACF11510.1| conserved hypothetical protein [Chlorobaculum parvum NCIB 8327]
          Length = 247

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           EK   ++   + L     +   + +  + +RI GN AVH G+ ++ E      +    +N
Sbjct: 152 EKGENINSDIKSLVAKG-LNPLVQKSLDALRITGNNAVHPGEINLSEEPDRVLKLFGLIN 210

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
              D + T P  I+      P+ + D 
Sbjct: 211 FIADKMITEPKEIESFYDDLPSGALDA 237


>gi|289676802|ref|ZP_06497692.1| hypothetical protein PsyrpsF_26208 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 148

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE----CLEFVN 67
           E  G +    + L     + E I +  + VR+ GN AVH G+ + ++  E      E +N
Sbjct: 56  EVTGSIDKDIKSLVAKG-LPEGIQQALDVVRVVGNNAVHPGELTADDIAEVSVSLFELIN 114

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
              +     P  ++      P  +R+ 
Sbjct: 115 AIVEERIARPKALEALYLRLPEGARNA 141


>gi|282901658|ref|ZP_06309574.1| hypothetical protein CRC_03078 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193421|gb|EFA68402.1| hypothetical protein CRC_03078 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 322

 Score = 73.1 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVNLFCD 71
           + G L ++ + +K+  +I + +++W++ +R+  N  VH+       ++   + F     D
Sbjct: 241 EAGSLENKLKKMKEQEIIDQNLYDWADRLRVTENDFVHKNITFGATDAQYIINFTYTVID 300

Query: 72  IVFTLPALIKE-KKSTHPNQS 91
            +FT     ++ K  + P   
Sbjct: 301 YIFTYRKKFEQFKYKSKPEGK 321


>gi|239629139|ref|ZP_04672170.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239519285|gb|EEQ59151.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 330

 Score = 72.7 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           G LSD    L +   I +   +  + +RI GNKAVHEG  +  ++++      L    V+
Sbjct: 53  GDLSDTIDQLYEGQWINKATKDNYHTIRILGNKAVHEGDDAAYDANQAY---QLLTQEVY 109

Query: 75  TLPALIKEKKSTHPNQSRDG 94
                    +S+ P+Q+  G
Sbjct: 110 VFANEFSGGRSSRPSQASRG 129


>gi|152993002|ref|YP_001358723.1| hypothetical protein SUN_1415 [Sulfurovum sp. NBC37-1]
 gi|151424863|dbj|BAF72366.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 260

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           E    L++    L     +   + +  + VR+ GN++VH G   + +    +    + VN
Sbjct: 166 ESGENLNEDIAALVSAG-LNPIVQKSLDVVRVIGNESVHPGSIDLNDDKNTAVRLFDLVN 224

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  D + T P  ++E     P   R  
Sbjct: 225 IIADQMITQPKHVEELYEKLPESKRKA 251


>gi|229195090|ref|ZP_04321865.1| Type III restriction protein res subunit [Bacillus cereus m1293]
 gi|228588319|gb|EEK46362.1| Type III restriction protein res subunit [Bacillus cereus m1293]
          Length = 1068

 Score = 72.3 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECL-- 63
           + I         DR + L++  L+ +E+++  + +R +GN A HE G  +++E+   L  
Sbjct: 53  ENIKETYNTSQVDRIQTLRREGLLEKELYDMFDALRKKGNNAAHEAGYGTVKEAQALLLM 112

Query: 64  ------EFVNLFCDIVFTLPALIKEKKSTHPNQS 91
                  F+ ++ D  F  P  ++ +K    + S
Sbjct: 113 AFRLGIWFMEVYGDWDFEAPEYVEPEKEEKVDAS 146


>gi|42779916|ref|NP_977163.1| type I restriction enzyme EcoKI subunit R [Bacillus cereus ATCC
           10987]
 gi|42735834|gb|AAS39771.1| type I restriction-modification system, R subunit [Bacillus cereus
           ATCC 10987]
          Length = 1068

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECL-- 63
           + I         DR + L++  L+ +E+++  + +R +GN A HE G  +++E+   L  
Sbjct: 53  ENIKEAYNTSQVDRIQTLRREGLLEKELYDMFDALRKKGNNAAHEAGYGTVKEAQALLLM 112

Query: 64  ------EFVNLFCDIVFTLPALIKEKKSTHPNQS 91
                  F+ ++ D  F  P  ++ +K    + S
Sbjct: 113 SFRLGIWFMEVYGDWDFEAPEYVEPEKEEKVDAS 146


>gi|88857304|ref|ZP_01131947.1| hypothetical protein PTD2_02051 [Pseudoalteromonas tunicata D2]
 gi|88820501|gb|EAR30313.1| hypothetical protein PTD2_02051 [Pseudoalteromonas tunicata D2]
          Length = 146

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 5/86 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNL 68
               +++    L +   +   + +  +  R+ GN AVH G+  + +    ++     VNL
Sbjct: 56  PGNNINNDIASLVEAG-LPPLVQKSLDICRVVGNNAVHPGEIDLNDSPEIANHLFRLVNL 114

Query: 69  FCDIVFTLPALIKEKKSTHPNQSRDG 94
                 T P  ++E   + P  +R+ 
Sbjct: 115 IVQDRITRPREVEELYGSLPEGAREA 140


>gi|302345962|ref|YP_003814315.1| hypothetical protein HMPREF0659_A6258 [Prevotella melaninogenica
           ATCC 25845]
 gi|302149003|gb|ADK95265.1| conserved hypothetical protein [Prevotella melaninogenica ATCC
           25845]
          Length = 217

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 36/87 (41%), Gaps = 6/87 (6%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFV 66
           E    ++     L +   + + + +  + VR+ GNKAVH G  S +      +   +  +
Sbjct: 125 ETDRDINKNIGVLVKKG-LPQAVQQALDVVRVVGNKAVHPGVISFDVDDKGTATMLMRLL 183

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           N+  + + T P  I+      P   ++
Sbjct: 184 NIITERMITEPKEIESLYEGLPETVKE 210


>gi|114331358|ref|YP_747580.1| hypothetical protein Neut_1367 [Nitrosomonas eutropha C91]
 gi|114308372|gb|ABI59615.1| hypothetical protein Neut_1367 [Nitrosomonas eutropha C91]
          Length = 266

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----QSSIEESDECLEFVN 67
           EK   + D    L     +   + +  + VR+ GN+AVH G        + + + L  +N
Sbjct: 169 EKGKNIDDDIASLVSKG-LNPLVQKSLDIVRVIGNEAVHPGVIDLNDDRDTASQLLILIN 227

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
              D + + P  ++E     P   R+ 
Sbjct: 228 SIADQMISHPKKVEELYGKLPENKREA 254


>gi|295841072|dbj|BAJ06920.1| putative uncharacterized protein [uncultured bacterium]
          Length = 266

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----QSSIEESDECLEFVN 67
           EK   + D    L     +   + +  + VR+ GN+AVH G        + + + L  +N
Sbjct: 169 EKGKNIDDDIASLVSKG-LNPLVQKSLDIVRVIGNEAVHPGVIDLNDDRDTASQLLILIN 227

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
              D + + P  ++E     P   R+ 
Sbjct: 228 SIADQMISHPKKVEELYGKLPENKREA 254


>gi|229096946|ref|ZP_04227915.1| hypothetical protein bcere0020_21930 [Bacillus cereus Rock3-29]
 gi|228686556|gb|EEL40465.1| hypothetical protein bcere0020_21930 [Bacillus cereus Rock3-29]
          Length = 244

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECL 63
            +   K   +    + LK+ + I + +F+  + VR+ GN AVH G+  I++    +    
Sbjct: 160 ELKCPKGNNIYQNIKLLKERDNINDVVFDALDAVRLVGNNAVHPGKIKIDDNPKIAITLF 219

Query: 64  EFVNLFCDIVFTLPALIKEKKSTH 87
             +N   + + + PA ++E + + 
Sbjct: 220 WLLNFIVEELISKPAKVREFRKSL 243


>gi|332533299|ref|ZP_08409165.1| hypothetical protein PH505_ao00110 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037181|gb|EGI73637.1| hypothetical protein PH505_ao00110 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 266

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 6/87 (6%)

Query: 13  KCGMLSDR-TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           + G   D+    L     +   + +  + VR+ GN+AVH G+   ++    + +    VN
Sbjct: 171 ETGKKIDKDIASLVSKG-LNPLVQQALDIVRVVGNEAVHPGEIDFKDNKEIALKLFGLVN 229

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           L CD + T P  +KE     P    +G
Sbjct: 230 LICDQMITHPKQVKELYGDLPKDKLEG 256


>gi|222085947|ref|YP_002544479.1| hypothetical protein Arad_2333 [Agrobacterium radiobacter K84]
 gi|221723395|gb|ACM26551.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 142

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 34/72 (47%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           G L+ + + L     + + + +W++ +R+ GN   H+   + +E      F + F   + 
Sbjct: 69  GTLAAKIKTLVGGGELPKSLGDWADEIRLIGNDGAHDDGVTRDELKAARMFCDSFLRYLI 128

Query: 75  TLPALIKEKKST 86
           TLP  +  ++S 
Sbjct: 129 TLPTEVALRRSQ 140


>gi|288803415|ref|ZP_06408847.1| conserved hypothetical protein [Prevotella melaninogenica D18]
 gi|288334025|gb|EFC72468.1| conserved hypothetical protein [Prevotella melaninogenica D18]
          Length = 217

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 36/87 (41%), Gaps = 6/87 (6%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFV 66
           E    ++     L +   + + + +  + VR+ GNKAVH G  S +      +   +  +
Sbjct: 125 ETDRDINKNIGILVKKG-LPQAVQQALDVVRVVGNKAVHPGVISFDVDDKGTATMLMHLL 183

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           N+  + + T P  I+      P   ++
Sbjct: 184 NIITERMITEPKEIESLYEGLPETVKE 210


>gi|218901961|ref|YP_002449795.1| Type III restriction enzyme, res subunit [Bacillus cereus AH820]
 gi|218535465|gb|ACK87863.1| Type III restriction enzyme, res subunit [Bacillus cereus AH820]
          Length = 1068

 Score = 70.8 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECL-- 63
           + I         DR + L++  L+ +E+++  + +R +GN A HE G  +++E+   L  
Sbjct: 53  ENIKEAYNTSQVDRMQTLRREGLLEKELYDMFDALRKKGNNAAHEAGYGTVKEAQALLLM 112

Query: 64  ------EFVNLFCDIVFTLPALIKEKKSTHPNQS 91
                  F+ ++ D  F  P  I+ +K    + S
Sbjct: 113 AFRLGIWFMEVYGDWDFEAPEYIEPEKEEKVDVS 146


>gi|78067675|ref|YP_370444.1| hypothetical protein Bcep18194_A6206 [Burkholderia sp. 383]
 gi|77968420|gb|ABB09800.1| hypothetical protein Bcep18194_A6206 [Burkholderia sp. 383]
          Length = 210

 Score = 70.8 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 7   QRINFEKCG---MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH--EGQSSIEESDE 61
           +R+  EK G   ML+     LK   +I + + EW++ +R+E N   H  + +++ E++ +
Sbjct: 113 ERLIKEKTGKPQMLAKGLADLKSRGVIDQRLHEWADALRVERNIGAHASDVETTKEDAQD 172

Query: 62  CLEFVNLFCDIVFTLPALIKEKKSTH 87
            ++F     D V+TL    ++ +   
Sbjct: 173 IIDFTVAIFDYVYTLAEKYEKYRRRK 198


>gi|213646956|ref|ZP_03377009.1| hypothetical protein SentesTy_06399 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 219

 Score = 70.8 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTL 76
            + L     +   +   ++  RI GN+AVH G+ +I++    +    + +N+      T 
Sbjct: 126 IKSLVAKG-LSPLVQRAADICRIVGNQAVHPGEINIDDDPQLAHGLFKLLNIIVTEQITR 184

Query: 77  PALIKEKKSTHPNQSRDG 94
           P  ++   ++ P ++  G
Sbjct: 185 PKEVEAMFNSMPERALKG 202


>gi|284030151|ref|YP_003380082.1| hypothetical protein Kfla_2207 [Kribbella flavida DSM 17836]
 gi|283809444|gb|ADB31283.1| hypothetical protein Kfla_2207 [Kribbella flavida DSM 17836]
          Length = 187

 Score = 70.4 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH----EGQSSIEESDECLEFVNLFC 70
           G L  +   L+Q ++I E + E ++ +R  GN+  H        + E+++E L  ++   
Sbjct: 96  GTLMSKIDGLRQADVISEAMKEAAHEIRFAGNEVAHGDLVTDPLTREDAEEVLGLMDAII 155

Query: 71  DIVFTLPALIKEKKSTHPNQSRDG 94
             V+  PA +   +     +SR G
Sbjct: 156 LRVYQEPAQVARVRERR--ESRTG 177


>gi|262383638|ref|ZP_06076774.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262294536|gb|EEY82468.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 232

 Score = 70.0 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 37/86 (43%), Gaps = 6/86 (6%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFVN 67
           + G +      L Q   +   + +  + VR+ GNKAVH GQ + +      ++  ++ +N
Sbjct: 140 ETGAIDKMIGSLVQKG-LPTIVQKALDAVRVIGNKAVHPGQIAFDVDDRATAETLMKLLN 198

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRD 93
           +  + + T P  I       P   +D
Sbjct: 199 IITERLITEPKEIDGIFDALPQSVKD 224


>gi|282877334|ref|ZP_06286158.1| conserved hypothetical protein [Prevotella buccalis ATCC 35310]
 gi|281300519|gb|EFA92864.1| conserved hypothetical protein [Prevotella buccalis ATCC 35310]
          Length = 217

 Score = 70.0 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 36/87 (41%), Gaps = 6/87 (6%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFV 66
           E    ++     L +   + + + +  + VR+ GNKAVH G  S +      +   +  +
Sbjct: 125 ETDRDINKNIGSLVKKG-LPQSVQQALDVVRVVGNKAVHPGVISFDVDDKGTATMLMRLL 183

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           N+  + + T P  I+      P   ++
Sbjct: 184 NIITERMITEPKEIESLYEGFPETVKE 210


>gi|312972898|ref|ZP_07787071.1| hypothetical protein EC182770_3443 [Escherichia coli 1827-70]
 gi|310332840|gb|EFQ00054.1| hypothetical protein EC182770_3443 [Escherichia coli 1827-70]
          Length = 132

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNL 68
           +   ++D    L Q   + EEI +  +  R+ GN AVH G+ +I++    +      +NL
Sbjct: 41  EGDKINDDIATLVQKG-LPEEIQQALDICRVVGNNAVHPGEINIDDSPEIAASLFGLINL 99

Query: 69  FCDIVFTLPALIKEKKSTHPNQSRDG 94
             +   T P  + +  +  P  ++  
Sbjct: 100 IVEERITRPQKVAKMYANLPAGAKAA 125


>gi|295401702|ref|ZP_06811669.1| type III restriction protein res subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976322|gb|EFG51933.1| type III restriction protein res subunit [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 1123

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECL-- 63
           + I  E+     +R R L    +I +EI++    +R++GN+AVH      + E+   L  
Sbjct: 94  EEIREERGTDQQERLRVLFYEQIIPKEIYDLLTVIRLKGNEAVHNPSYGEVNEAKALLHM 153

Query: 64  ------EFVNLFCDIVFTLPALIKEKKST 86
                  F+ ++ D  F  P  I+    T
Sbjct: 154 AFRIAVWFMEVYGDWSFQAPEYIEPAPQT 182


>gi|213971540|ref|ZP_03399651.1| hypothetical protein PSPTOT1_0852 [Pseudomonas syringae pv. tomato
           T1]
 gi|302060707|ref|ZP_07252248.1| hypothetical protein PsyrptK_12010 [Pseudomonas syringae pv. tomato
           K40]
 gi|213923732|gb|EEB57316.1| hypothetical protein PSPTOT1_0852 [Pseudomonas syringae pv. tomato
           T1]
          Length = 221

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS----SIEESDECLEFVNL 68
           K G L  R      H+LI  E+  W++ +R++ N   H  +     S  E+ + +EF   
Sbjct: 143 KDGSLYSRIEAAATHHLITAEMASWAHEIRLDANDQRHSDEDASLPSEAEASKAVEFAMA 202

Query: 69  FCDIVFTLPALIKEKKS 85
               +F LPA +   ++
Sbjct: 203 LAQFLFVLPARVARGRA 219


>gi|330965893|gb|EGH66153.1| hypothetical protein PSYAC_14870 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 201

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS----SIEESDECLEFVNL 68
           K G L  R      H+LI  E+  W++ +R++ N   H  +     S  E+ + +EF   
Sbjct: 123 KDGSLYSRIEAAATHHLITPEMASWAHEIRLDANDQRHSDEDASMPSEAEASKAVEFATA 182

Query: 69  FCDIVFTLPALIKEKKS 85
               +F LPA +   ++
Sbjct: 183 LAQFLFVLPARVARGRA 199


>gi|301386145|ref|ZP_07234563.1| hypothetical protein PsyrptM_26064 [Pseudomonas syringae pv. tomato
           Max13]
          Length = 201

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS----SIEESDECLEFVNL 68
           K G L  R      H+LI  E+  W++ +R++ N   H  +     S  E+ + +EF   
Sbjct: 123 KDGSLYSRIEAAATHHLITAEMASWAHEIRLDANDQRHSDEDASLPSEAEASKAVEFAMA 182

Query: 69  FCDIVFTLPALIKEKKS 85
               +F LPA +   ++
Sbjct: 183 LAQFLFVLPARVARGRA 199


>gi|229542891|ref|ZP_04431951.1| type III restriction protein res subunit [Bacillus coagulans 36D1]
 gi|229327311|gb|EEN92986.1| type III restriction protein res subunit [Bacillus coagulans 36D1]
          Length = 1071

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 9/96 (9%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECL- 63
            + I         DR   L++  LI  E+ +    +R +GN+A+HE  + + EE+   L 
Sbjct: 54  AENIKEAYGTSQVDRIHMLRREGLIEPELMDIFETLRRKGNQAMHEALKFTTEEAKALLR 113

Query: 64  -------EFVNLFCDIVFTLPALIKEKKSTHPNQSR 92
                   F+ ++ +  F  P  I+ K+    +  +
Sbjct: 114 LAFRLSIWFMEVYGEWDFQAPEYIEPKEQKKVDTEQ 149


>gi|254455122|ref|ZP_05068557.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198263532|gb|EDY87804.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 276

 Score = 68.1 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 35/87 (40%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVN 67
           ++   +    + L     + ++I    + +R+ GN++VH G+  + +    + +     N
Sbjct: 185 QEGKSIDKDIKALVAKG-LSQKIQRALDVLRVVGNESVHPGELDMRDDSQTALKLFNVFN 243

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           L  + + +   LI E     P     G
Sbjct: 244 LIVNAMISEEKLINELYDGLPENKVKG 270


>gi|266619616|ref|ZP_06112551.1| type I restriction-modification system, R subunit [Clostridium
           hathewayi DSM 13479]
 gi|288868818|gb|EFD01117.1| type I restriction-modification system, R subunit [Clostridium
           hathewayi DSM 13479]
          Length = 1088

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 32/83 (38%), Gaps = 8/83 (9%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL---- 63
           R+ F K      R   L +  L+  ++ +  + +R + NKAVHE   S  ++   L    
Sbjct: 53  RLPFPKDNTSISRIDTLYREGLLTNDLTDILHLMRKKRNKAVHENYESESDAKILLQMAH 112

Query: 64  ----EFVNLFCDIVFTLPALIKE 82
                F+  + D  +     I  
Sbjct: 113 SLCQWFMQTYGDWNYQQSPFIMP 135


>gi|148255614|ref|YP_001240199.1| hypothetical protein BBta_4239 [Bradyrhizobium sp. BTAi1]
 gi|146407787|gb|ABQ36293.1| hypothetical protein BBta_4239 [Bradyrhizobium sp. BTAi1]
          Length = 267

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (37%), Gaps = 5/87 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----QSSIEESDECLEFVN 67
           E    +      L +   +   + +  + VR+ GN+AVH G    +   + + +    +N
Sbjct: 170 EPGKNIDTDIGSLVKKG-LEPAVQQALDIVRVIGNEAVHPGQIDLRDDRDTALKLFRLIN 228

Query: 68  LFCDIVFTLPALIKEKKSTHPNQSRDG 94
           +  + + + P  I E   + P      
Sbjct: 229 IIAEAMISRPKQIAELYGSLPPTKLQA 255


>gi|319788902|ref|YP_004090217.1| Type I site-specific deoxyribonuclease [Ruminococcus albus 7]
 gi|315450769|gb|ADU24331.1| Type I site-specific deoxyribonuclease [Ruminococcus albus 7]
          Length = 1086

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 40/94 (42%), Gaps = 11/94 (11%)

Query: 7   QRINFEK-CGMLSDRTRYLKQHNLIIE--EIFEWSNFVRIEGNKAVHEGQSSIEESDECL 63
           + ++        ++R + LK+  LI     I +    +R++ N AVH+ + S++ +   L
Sbjct: 52  EGLDEPDYDNTHANRIKILKREGLIDRGGRIDDILYSLRMKRNDAVHKYEDSVDTAKSLL 111

Query: 64  --------EFVNLFCDIVFTLPALIKEKKSTHPN 89
                    F+ ++ D  F  P  +  +    P+
Sbjct: 112 RMAFRLAVWFMEVYGDYSFKAPDFVMPQNEPIPD 145


>gi|294674414|ref|YP_003575030.1| hypothetical protein PRU_1736 [Prevotella ruminicola 23]
 gi|294471784|gb|ADE81173.1| conserved hypothetical protein [Prevotella ruminicola 23]
          Length = 194

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 36/87 (41%), Gaps = 6/87 (6%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFV 66
           E    +++    L     + + I +  + VR+ GNKAVH G  S +      +   +  +
Sbjct: 101 EVDRDINNNIGALVMKG-LPKIIQQALDVVRVVGNKAVHPGVISFDVDDMNTAITLMHLI 159

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           N+  + + + P  I+      P+  + 
Sbjct: 160 NMITERMISEPKEIESLYEILPDSVKK 186


>gi|261419105|ref|YP_003252787.1| type I restriction enzyme EcoKI subunit R [Geobacillus sp.
           Y412MC61]
 gi|319765922|ref|YP_004131423.1| type I site-specific deoxyribonuclease [Geobacillus sp. Y412MC52]
 gi|261375562|gb|ACX78305.1| type III restriction protein res subunit [Geobacillus sp. Y412MC61]
 gi|317110788|gb|ADU93280.1| Type I site-specific deoxyribonuclease [Geobacillus sp. Y412MC52]
          Length = 1080

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECL-- 63
           + I  E+     DR + L    +I +EI++    +R++GN+AVH      + E+   L  
Sbjct: 52  EGIREERGTDQQDRLKVLLYEQIIPKEIYDIFTMIRLKGNQAVHDPNYGDVHEAKTLLHM 111

Query: 64  ------EFVNLFCDIVFTLPALIKEKKST 86
                  F+ ++ D  F  P   +   S+
Sbjct: 112 AFRLAVWFMEVYGDWSFEAPQYREPLPSS 140


>gi|297530926|ref|YP_003672201.1| type I site-specific deoxyribonuclease [Geobacillus sp. C56-T3]
 gi|297254178|gb|ADI27624.1| Type I site-specific deoxyribonuclease [Geobacillus sp. C56-T3]
          Length = 1080

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECL-- 63
           + I  E+     DR + L    +I +EI++    +R++GN+AVH      + E+   L  
Sbjct: 52  EGIREERGTDQQDRLKVLLYEQIIPKEIYDIFTMIRLKGNQAVHDPNYGDVHEAKTLLHM 111

Query: 64  ------EFVNLFCDIVFTLPALIKEKKST 86
                  F+ ++ D  F  P   +   S+
Sbjct: 112 AFRLAVWFMEVYGDWSFEAPQYREPLPSS 140


>gi|223934465|ref|ZP_03626386.1| conserved hypothetical protein [bacterium Ellin514]
 gi|223896928|gb|EEF63368.1| conserved hypothetical protein [bacterium Ellin514]
          Length = 212

 Score = 67.7 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 5/84 (5%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ----SSIEESDECLEFVN 67
           E    ++D  R L Q   + E I +  + VR+ GN+AVH G+       E + +    VN
Sbjct: 119 EPGKNINDDIRSLVQKG-LDERIQQSLDIVRVIGNEAVHPGEMDLRDKTETAIQLATLVN 177

Query: 68  LFCDIVFTLPALIKEKKSTHPNQS 91
           L  +   T   LI     + P   
Sbjct: 178 LIANETITKHKLIIGLYDSLPPNK 201


>gi|138894433|ref|YP_001124886.1| type I restriction enzyme EcoKI subunit R [Geobacillus
           thermodenitrificans NG80-2]
 gi|134265946|gb|ABO66141.1| Type I restriction enzyme EcoKI R protein [Geobacillus
           thermodenitrificans NG80-2]
          Length = 1081

 Score = 67.7 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 9/85 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECL-- 63
           + I  E+     +R R L    +I +EI++    +R++GN+AVH      + E+   L  
Sbjct: 52  EEIREERGTDQQERLRILFYEQIIPKEIYDLFTVIRLKGNEAVHNPSYGEVNEAKALLHM 111

Query: 64  ------EFVNLFCDIVFTLPALIKE 82
                  F+ ++ D  F  P  I+ 
Sbjct: 112 AFRIAVWFMEVYGDWSFQTPEYIEP 136


>gi|325680587|ref|ZP_08160130.1| helicase C-terminal domain protein [Ruminococcus albus 8]
 gi|324107724|gb|EGC01997.1| helicase C-terminal domain protein [Ruminococcus albus 8]
          Length = 1086

 Score = 67.3 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%), Gaps = 11/94 (11%)

Query: 7   QRINFEK-CGMLSDRTRYLKQHNLIIE--EIFEWSNFVRIEGNKAVHEGQSSIEESDECL 63
           + ++        ++R + LK   LI     I +    +R++ N AVH+ + S++ +   L
Sbjct: 52  EGLDEPDYDNTHANRIKILKHEGLIDRGGRIDDILYSLRMKRNDAVHKYEDSVDTAKSLL 111

Query: 64  --------EFVNLFCDIVFTLPALIKEKKSTHPN 89
                    F+ ++ D  F  P  +  +    P+
Sbjct: 112 RMAFRLAVWFMEVYGDYNFQAPDFVMPENKPVPD 145


>gi|153217707|ref|ZP_01951388.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124113345|gb|EAY32165.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 102

 Score = 66.9 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCD 71
           ++     L +   +   I +  ++VR+ GN AVH G+ S+++           +NL  D
Sbjct: 13 NINKDIGKLVELG-LPVRIQQALDYVRVVGNNAVHPGELSLDDNPQTVTTLFGLINLIVD 71

Query: 72 IVFTLPALIKEKKSTHPNQSRDG 94
             T P  ++      P  + + 
Sbjct: 72 NQITQPKQVESLFHGLPEGAIEA 94


>gi|53718204|ref|YP_107190.1| hypothetical protein BPSL0564 [Burkholderia pseudomallei K96243]
 gi|167737075|ref|ZP_02409849.1| hypothetical protein Bpse14_03366 [Burkholderia pseudomallei 14]
 gi|167814189|ref|ZP_02445869.1| hypothetical protein Bpse9_03543 [Burkholderia pseudomallei 91]
 gi|52208618|emb|CAH34554.1| hypothetical protein BPSL0564 [Burkholderia pseudomallei K96243]
          Length = 202

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 7   QRINFEKCG---MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH--EGQSSIEESDE 61
           +R+  EK G    L+     L+   +I E +  W++ +R+E N   H    +++ +++++
Sbjct: 113 ERLVAEKTGKPQSLARGLAELRAQGVIDERLHAWADALRVERNIGAHASNTETTKDDAED 172

Query: 62  CLEFVNLFCDIVFTLPAL 79
            ++F     D V+TL   
Sbjct: 173 IIDFTVAIFDYVYTLAER 190


>gi|312831426|emb|CBY17606.1| unnamed protein product [Escherichia coli LF82]
          Length = 232

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query: 6   GQRINFEK-CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           G++   +K    L  R  +L  ++L+ E + E +  V+ +GN   HEG      +++  +
Sbjct: 144 GEQGPAQKIRRSLGLRMEWLFDNHLLPEALRELAECVKDDGNDGAHEGILDKAAAEDLED 203

Query: 65  FVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           F  LF + ++T P  + E K T   Q R+
Sbjct: 204 FTYLFLERLYTEPQRLIEAK-TRREQRRN 231


>gi|16761817|ref|NP_457434.1| hypothetical protein STY3192 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|25511886|pir||AB0871 hypothetical protein STY3192 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504119|emb|CAD02866.1| hypothetical protein [Salmonella enterica subsp. enterica serovar
           Typhi]
          Length = 176

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTL 76
            + L     +   +   ++  RI GN+AVH G+ +I++    +    + +N+      T 
Sbjct: 83  IKSLVAKG-LSPLVQRAADICRIVGNQAVHPGEINIDDDPQLAHGLFKLLNIIVTEQITR 141

Query: 77  PALIKEKKSTHPNQSRDG 94
           P  ++   ++ P ++  G
Sbjct: 142 PKEVEAMFNSMPERALKG 159


>gi|160935960|ref|ZP_02083334.1| hypothetical protein CLOBOL_00855 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441202|gb|EDP18919.1| hypothetical protein CLOBOL_00855 [Clostridium bolteae ATCC
           BAA-613]
          Length = 331

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 3/80 (3%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           G LSD    L +   I +   +  + +RI GNKAVHEG  +  ++++      L    V+
Sbjct: 56  GDLSDTIDQLYEGQWINKATKDNYHTIRILGNKAVHEGDDTAYDANQAF---QLLTQEVY 112

Query: 75  TLPALIKEKKSTHPNQSRDG 94
                        P ++   
Sbjct: 113 VFANEFAGGSGGRPVRTSSA 132


>gi|262393969|ref|YP_003285823.1| hypothetical protein VEA_003198 [Vibrio sp. Ex25]
 gi|262337563|gb|ACY51358.1| hypothetical protein VEA_003198 [Vibrio sp. Ex25]
          Length = 215

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 2/80 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSI--EESDECLEFVNLFC 70
           K     DR   L +   I   +  W++ +R  GN A H   +++  E++ +CL+      
Sbjct: 136 KGHNFYDRLESLHKAGHIDARLLSWAHGIRALGNDAAHAITANVSKEDAKDCLDLTEALL 195

Query: 71  DIVFTLPALIKEKKSTHPNQ 90
             +++L    +E +      
Sbjct: 196 IYIYSLGHRFEEFELRRQKN 215


>gi|251798710|ref|YP_003013441.1| type I restriction enzyme EcoKI subunit R [Paenibacillus sp. JDR-2]
 gi|247546336|gb|ACT03355.1| type III restriction protein res subunit [Paenibacillus sp. JDR-2]
          Length = 1083

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDE---- 61
           + ++  K     DR   LK+ +LI ++I ++ + +R  GNKAVHE G  S  E+      
Sbjct: 52  EEMDETKELTQVDRLSQLKRDDLISDDIVDYLHTLRKIGNKAVHESGYGSTREAQASTLL 111

Query: 62  ----CLEFVNLFCDIVFTLPALIKEKKST 86
                + F+ ++ D  F  P  I+  +  
Sbjct: 112 AFRLSVWFMQVYGDWNFQAPDYIEPVEQQ 140


>gi|154508189|ref|ZP_02043831.1| hypothetical protein ACTODO_00683 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797823|gb|EDN80243.1| hypothetical protein ACTODO_00683 [Actinomyces odontolyticus ATCC
           17982]
          Length = 184

 Score = 65.4 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH---EGQSSIEESDECLEFVNLFCD 71
           G L  +   L++  LI   +   S+ VR+ GN+  H   +     E+ D+ LEF++   +
Sbjct: 98  GTLKQKIDSLEESRLINPTLAGLSHQVRLMGNEMAHGDLDAAIDAEDCDDLLEFMSALLE 157

Query: 72  IVFTLPALIKEKKSTHPNQSRD 93
            ++  P  +  ++  +  +  +
Sbjct: 158 EIYQRPISLARRQELNRQRKAE 179


>gi|90592606|ref|YP_529866.1| hypothetical protein [Lactobacillus phage KC5a]
 gi|116629261|ref|YP_814433.1| hypothetical protein LGAS_0601 [Lactobacillus gasseri ATCC 33323]
 gi|116629321|ref|YP_814493.1| hypothetical protein LGAS_0663 [Lactobacillus gasseri ATCC 33323]
 gi|311111441|ref|ZP_07712838.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
 gi|89891935|gb|ABD78808.1| hypothetical protein [Lactobacillus phage KC5a]
 gi|116094843|gb|ABJ59995.1| hypothetical protein LGAS_0601 [Lactobacillus gasseri ATCC 33323]
 gi|116094903|gb|ABJ60055.1| hypothetical protein LGAS_0663 [Lactobacillus gasseri ATCC 33323]
 gi|311066595|gb|EFQ46935.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
          Length = 205

 Score = 65.4 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIVFTLPAL 79
             YL +++ +  +  +W + +R  GN+A HE Q +  E++ + ++F  +   + +  P+ 
Sbjct: 136 VNYLNENHFVSVKSHDWVDQIRKYGNEATHEIQVNTKEDAQKIIKFCEMILKMNYEYPSE 195

Query: 80  IKEKKSTHPN 89
           I +      N
Sbjct: 196 INDSNDGKNN 205


>gi|254228158|ref|ZP_04921587.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|151939231|gb|EDN58060.1| conserved hypothetical protein [Vibrio sp. Ex25]
          Length = 201

 Score = 65.4 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 2/80 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSI--EESDECLEFVNLFC 70
           K     DR   L +   I   +  W++ +R  GN A H   +++  E++ +CL+      
Sbjct: 122 KGHNFYDRLESLHKAGHIDARLLSWAHGIRALGNDAAHAITANVSKEDAKDCLDLTEALL 181

Query: 71  DIVFTLPALIKEKKSTHPNQ 90
             +++L    +E +      
Sbjct: 182 IYIYSLGHRFEEFELRRQKN 201


>gi|300361369|ref|ZP_07057546.1| conserved hypothetical protein [Lactobacillus gasseri JV-V03]
 gi|300353988|gb|EFJ69859.1| conserved hypothetical protein [Lactobacillus gasseri JV-V03]
          Length = 205

 Score = 65.4 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIVFTLPAL 79
             YL +++ +  +  +W + +R  GN+A HE Q +  E++ + ++F  +   + +  P+ 
Sbjct: 136 VNYLNENHFVSVKSHDWVDQIRKYGNEANHEIQVNTKEDAQKIIKFCEMILKMNYEYPSE 195

Query: 80  IKEKKSTHPN 89
           I +      N
Sbjct: 196 INDSNDRKNN 205


>gi|294498517|ref|YP_003562217.1| hypothetical protein BMQ_1753 [Bacillus megaterium QM B1551]
 gi|294348454|gb|ADE68783.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 91

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 5/79 (6%)

Query: 20 RTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFT 75
              L +   + +E+ +  + +R+ GN+AVH G   I++    +      +N   D + T
Sbjct: 1  MIGQLVRKG-LPKEVEKALDNLRVIGNEAVHPGTIDIKDNANVAFALFRLLNFVVDRMIT 59

Query: 76 LPALIKEKKSTHPNQSRDG 94
              I E     P   R G
Sbjct: 60 QLKEIDEIYELLPEGKRKG 78


>gi|114776879|ref|ZP_01451922.1| hypothetical protein SPV1_11706 [Mariprofundus ferrooxydans PV-1]
 gi|114552965|gb|EAU55396.1| hypothetical protein SPV1_11706 [Mariprofundus ferrooxydans PV-1]
          Length = 247

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCD 71
            +++  + L     +  +I +  + +R+ GN AVH GQ  +E+    +      +N   D
Sbjct: 158 NINNDIKALVAEG-LSPKIQQALDLLRVVGNNAVHPGQIDLEDGREIALRLFHVLNFIAD 216

Query: 72  IVFTLPALIKEKKST-HPNQSRD 93
            + + P  +    S   P +++ 
Sbjct: 217 EMISKPKELDLLYSDVVPEETKK 239


>gi|193064056|ref|ZP_03045141.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193064703|ref|ZP_03045781.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192927586|gb|EDV82202.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192929291|gb|EDV82900.1| conserved hypothetical protein [Escherichia coli E22]
          Length = 220

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 10/90 (11%)

Query: 15  GMLSDRTRYLKQHNLIIEEIF------EWSNFVRIEGNKAVHEGQSSIEE----SDECLE 64
           G       +L     +  +I       E  N   + GN+AVH G+ +I++    +    +
Sbjct: 114 GEPGKHIDFLYAAVFLPHKIAPDFGLSETLNHCLLVGNQAVHPGEINIDDDPQLAHGLFK 173

Query: 65  FVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
            +N+      T P  ++   ++ P ++  G
Sbjct: 174 LLNIIVTEQITRPKEVEAMFNSMPERALKG 203


>gi|260579753|ref|ZP_05847610.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
 gi|258602105|gb|EEW15425.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
          Length = 221

 Score = 64.2 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 41/87 (47%), Gaps = 8/87 (9%)

Query: 2   KDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFE-WSNFVRIEGNKAVHEGQSSIE-ES 59
           K+D+    +FE+C        +L    ++ + I + W++ +R+ GN A HE +S  +  +
Sbjct: 141 KNDRSWAPSFEEC------VNFLVNEGILTQRIKDSWADSIRLWGNAATHELKSVRQSTA 194

Query: 60  DECLEFVNLFCDIVFTLPALIKEKKST 86
            + +EF  +   + F      + +  +
Sbjct: 195 LKAIEFTQMILRMAFEFEGNARAENES 221


>gi|266621661|ref|ZP_06114596.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288866665|gb|EFC98963.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 326

 Score = 64.2 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 14/94 (14%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN----LF 69
            G L+D    L + + I +   +  + +R+ GNKAVH+G  S  +++E  + ++     F
Sbjct: 54  DGDLADSIDQLFEGHWISQATKDHYHRIRVLGNKAVHDGNDSPYDANEAFQLLSQEATAF 113

Query: 70  CDIVF---------TLPALIKEKKSTHPNQSRDG 94
            D ++         T P      +S+ P Q   G
Sbjct: 114 AD-IYSGRRRSTTPTRPQQRPASRSSQPAQRSTG 146


>gi|282896260|ref|ZP_06304282.1| hypothetical protein CRD_01142 [Raphidiopsis brookii D9]
 gi|281198756|gb|EFA73635.1| hypothetical protein CRD_01142 [Raphidiopsis brookii D9]
          Length = 325

 Score = 64.2 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDECLEFVNLFCD 71
           +   L  +   +K+  +I + +++W++ +R+  N  VH+  +    ++   + F     D
Sbjct: 241 EAVSLEKKLNKMKEQEIIDQNLYDWADRLRVTENDFVHKSITCGATDAQHIINFTYTVTD 300

Query: 72  IVFTLPALIKEKKS 85
            +FT    I+  K 
Sbjct: 301 YIFTYRKKIEHFKQ 314


>gi|253583388|ref|ZP_04860586.1| type I restriction enzyme EcoKI subunit R [Fusobacterium varium
           ATCC 27725]
 gi|251833960|gb|EES62523.1| type I restriction enzyme EcoKI subunit R [Fusobacterium varium
           ATCC 27725]
          Length = 1088

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +++N  + G   DR + LK ++LI E+I      +R +GN AVH    +  E++  L  V
Sbjct: 52  EKLNEPESGSQLDRIKILKTYDLIPEDIENILQLIRKKGNTAVHNMSGNESEAETLLSLV 111

Query: 67  NLFCDI 72
              C  
Sbjct: 112 VKLCGW 117


>gi|320322284|gb|EFW78378.1| hypothetical protein PsgB076_22996 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331941|gb|EFW87877.1| hypothetical protein PsgRace4_00025 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330882657|gb|EGH16806.1| hypothetical protein Pgy4_27600 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 146

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFCDI 72
             LS   + +K+  LI E +FEWS+ +R+ GN+A H    SI   ++ + +EF N   D 
Sbjct: 68  RNLSLSLKKMKEDGLIDERLFEWSDALRVVGNEAAHGVGISIAQPDARDTIEFTNAILDY 127

Query: 73  VFTLPALIKEKKSTHPNQS 91
           +F+     ++ K     +S
Sbjct: 128 LFSYRDRFEQFKKRRSGES 146


>gi|147679200|ref|YP_001213415.1| hypothetical protein PTH_2865 [Pelotomaculum thermopropionicum SI]
 gi|146275297|dbj|BAF61046.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 225

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFV-RIEGNKAVHEGQSSIEESDECLEFVNLFCDIV 73
             L ++   L +   I E +   +  +  ++G+    EG+ + EE+           + +
Sbjct: 138 NSLLEKIEDLAEKGKIPERLASLAGRLALLKGSACFDEGRFAEEEAAVLKSLCEAVLEYL 197

Query: 74  FTLPALIKE 82
           +  PAL++ 
Sbjct: 198 YRAPALVER 206


>gi|114562420|ref|YP_749933.1| hypothetical protein Sfri_1242 [Shewanella frigidimarina NCIMB 400]
 gi|114333713|gb|ABI71095.1| hypothetical protein Sfri_1242 [Shewanella frigidimarina NCIMB 400]
          Length = 247

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 37/83 (44%), Gaps = 6/83 (7%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCD 71
            +++  + L     +  +I +  + +R+ GN AVH GQ  +E+    + +    +N   D
Sbjct: 158 NINNDIKELVSEG-LSPKIQKALDLLRVVGNNAVHPGQIDLEDGRDIALKLFHVLNFIAD 216

Query: 72  IVFTLPALIKEKKST-HPNQSRD 93
            + + P  +    +   P +++ 
Sbjct: 217 EMISKPKELDLLYADVVPEETQK 239


>gi|260878744|ref|ZP_05891099.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308091344|gb|EFO41039.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
          Length = 255

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ----SSIEESDECLEFVNLFC 70
           G +++    L +   +  ++    + +R+ GN  VH GQ     + E++ +    +N   
Sbjct: 161 GKINNSIARLVKEG-LNSDVQIALDTLRVVGNNCVHPGQIVFDDNKEDAKKLFSLLNYIT 219

Query: 71  DIVFTLPALIKEKKSTH-PNQSRD 93
           D + T P   +       P+ +++
Sbjct: 220 DELVTRPKERERLFQDLVPDITKE 243


>gi|74316944|ref|YP_314684.1| hypothetical protein Tbd_0926 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056439|gb|AAZ96879.1| hypothetical protein Tbd_0926 [Thiobacillus denitrificans ATCC
           25259]
          Length = 216

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 32/80 (40%), Gaps = 1/80 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIV 73
           G  S +   L++H  I  +  E  +     GN A H G     ++ +  ++ V      V
Sbjct: 135 GSFSAKLDALEKHGAIGAKSKEILHAALDAGNAASHRGYQPTTDDINAVMDIVENLLQAV 194

Query: 74  FTLPALIKEKKSTHPNQSRD 93
           + L  L +  K   P +S+ 
Sbjct: 195 YHLKTLAESLKKATPTRSQK 214


>gi|160934948|ref|ZP_02082334.1| hypothetical protein CLOLEP_03823 [Clostridium leptum DSM 753]
 gi|156866401|gb|EDO59773.1| hypothetical protein CLOLEP_03823 [Clostridium leptum DSM 753]
          Length = 1078

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 16/103 (15%)

Query: 7   QRINFEKC-GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL-- 63
           + ++  K     ++R R LK+  L+  EI      +R   N AVH G  S++E+   L  
Sbjct: 52  EHMDEPKTDNTHANRIRLLKRAGLLPHEIDNTLYVLRKTRNSAVHAGTDSVDEAKTLLST 111

Query: 64  ------EFVNLFCDI-----VFTLPALI--KEKKSTHPNQSRD 93
                  F+  + D       F +P  +   + KS   +Q + 
Sbjct: 112 TYNLAIWFMETYGDWGFIAEDFVMPEEVHQADLKSVIEDQEKK 154


>gi|240146119|ref|ZP_04744720.1| type I restriction-modification system, R subunit [Roseburia
           intestinalis L1-82]
 gi|257201772|gb|EEV00057.1| type I restriction-modification system, R subunit [Roseburia
           intestinalis L1-82]
          Length = 1091

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 31/84 (36%), Gaps = 8/84 (9%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL---- 63
           RI          R   L++  L+  ++ +  + +R   NKAVHE   S+ E    L    
Sbjct: 53  RIQLPYDNTAVTRIDNLQREGLLTRDLTDILHALRKARNKAVHENYESVSECKILLEMAY 112

Query: 64  ----EFVNLFCDIVFTLPALIKEK 83
                F+  + D  +     +  K
Sbjct: 113 SLCEWFMQTYGDWNYQHHDFVMPK 136


>gi|291485261|dbj|BAI86336.1| hypothetical protein BSNT_04129 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 1068

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECL- 63
            + I         DR   L++  L+  E+ +    +R +GN A+HE     +EE+   L 
Sbjct: 51  AENIKEAYGTTQVDRINTLRRERLLEPELIDILEALRRKGNVAMHEADYGKVEEAKALLQ 110

Query: 64  -------EFVNLFCDIVFTLPALIK 81
                   F+ ++ D  F  P   +
Sbjct: 111 LTFRLSIWFMEVYGDWDFQAPEYTE 135


>gi|291167071|gb|EFE29117.1| hypothetical protein HMPREF0389_01039 [Filifactor alocis ATCC
           35896]
          Length = 217

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDECLEFVNLFC 70
           +   L  +   L    ++ E +      +R  GN A H    + +  +  EC+EF+++  
Sbjct: 133 EGKDLELKIADLVNKKILPEMMNSACWILRQLGNDAAHADDVEFTELDVKECIEFISIII 192

Query: 71  DIVFTLPALIKEKKSTHPNQSRD 93
           + ++++P  I + KS   ++   
Sbjct: 193 NYLYSMPIRIDQLKSKIEDRKTK 215


>gi|297516126|ref|ZP_06934512.1| type I restriction enzyme EcoKI subunit R [Escherichia coli OP50]
          Length = 136

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|150388682|ref|YP_001318731.1| type I restriction enzyme EcoKI subunit R [Alkaliphilus
           metalliredigens QYMF]
 gi|149948544|gb|ABR47072.1| type III restriction protein, res subunit [Alkaliphilus
           metalliredigens QYMF]
          Length = 1086

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 10/94 (10%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           +K DQ +   ++     ++R + LK+  LI + I +    +RI  NKAVH G  S E+  
Sbjct: 49  LKLDQMEPPEYD--NTHANRIKLLKKEGLISQNIDDIIYSLRIARNKAVHSGYDSFEDCV 106

Query: 61  ECL--------EFVNLFCDIVFTLPALIKEKKST 86
             L         F+  + D  +     +  + ++
Sbjct: 107 ILLEMGHNLAIWFMQTYGDWQYAPAEFVLPEDNS 140


>gi|302388494|ref|YP_003824316.1| SH3 type 3 domain protein [Clostridium saccharolyticum WM1]
 gi|302199122|gb|ADL06693.1| SH3 type 3 domain protein [Clostridium saccharolyticum WM1]
          Length = 377

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           M +  G+R    + G L+D    L +   I +   +  + +R+ GNKAVHEG  S  +++
Sbjct: 42  MVNYLGERALIVE-GDLADSIDQLFEGRFISQSAKDHYHRIRVLGNKAVHEGDDSPYDAN 100

Query: 61  ECLEFVN 67
           E ++ ++
Sbjct: 101 EAVQLLS 107


>gi|329667173|gb|AEB93121.1| hypothetical protein LJP_0795 [Lactobacillus johnsonii DPC 6026]
          Length = 202

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSI-EESDECLEFVNLFCDIVFTLPAL 79
             YL   + +     EW + +R  GN+A HE Q +  +++ + ++F  +   + +  P+ 
Sbjct: 136 VNYLADSHFVSVRSHEWVDQIRKYGNEATHEIQVNTQQDAQKIIKFCEMILKMNYEYPSE 195

Query: 80  IKE 82
           I +
Sbjct: 196 IND 198


>gi|330988717|gb|EGH86820.1| hypothetical protein PLA107_27074 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 220

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 41/92 (44%), Gaps = 13/92 (14%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE--- 61
           +G+ I+ +         + L     +   + +  + +R+ GN AVH  + ++E+ ++   
Sbjct: 127 KGEHIDTD--------IKALVALG-LDVHVQQALDVIRVTGNNAVHPLEMNLEDDEDSVL 177

Query: 62  -CLEFVNLFCDIVFTLPALIKEKKSTHPNQSR 92
              E +N   +   + P   +++ +  P ++R
Sbjct: 178 VLFEMINFIVEERISRPQKTQDRFANLPEKAR 209


>gi|319425868|gb|ADV53942.1| conserved hypothetical protein [Shewanella putrefaciens 200]
          Length = 247

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 32/84 (38%), Gaps = 5/84 (5%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFC 70
           G ++D  +       I ++I +  + VR  GN+AVH G    ++    +      +N+  
Sbjct: 157 GDINDMIKQKVSEG-IAKKIQKAMDLVRYIGNQAVHPGMIDFDDNQDIALLLFRLINIIA 215

Query: 71  DIVFTLPALIKEKKSTHPNQSRDG 94
             + T+P  I             G
Sbjct: 216 TELITVPNEIDSLFENIIPDKVKG 239


>gi|293393087|ref|ZP_06637402.1| type I restriction enzyme EcoKI R protein [Serratia odorifera DSM
           4582]
 gi|291424233|gb|EFE97447.1| type I restriction enzyme EcoKI R protein [Serratia odorifera DSM
           4582]
          Length = 758

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 35/88 (39%), Gaps = 9/88 (10%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  ++   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 50  GMLLDIPPCENQHDLLRELGKIPFVDDSILSIFHKLRRIGNQAVHEYHNDLDDAQMCLRL 109

Query: 66  VNLFC---------DIVFTLPALIKEKK 84
                         D  F LP  +  ++
Sbjct: 110 GFRLSVWYYRLVTKDYDFALPIFVLPER 137


>gi|218708017|ref|YP_002415536.1| type I restriction enzyme EcoKI subunit R [Escherichia coli UMN026]
 gi|293403008|ref|ZP_06647105.1| type I restriction enzyme EcoKI R protein [Escherichia coli
           FVEC1412]
 gi|298378535|ref|ZP_06988419.1| type I restriction enzyme EcoKI R protein [Escherichia coli
           FVEC1302]
 gi|300899294|ref|ZP_07117560.1| type III restriction enzyme, res subunit [Escherichia coli MS
           198-1]
 gi|301646866|ref|ZP_07246712.1| type III restriction enzyme, res subunit [Escherichia coli MS
           146-1]
 gi|218435114|emb|CAR16070.1| endonuclease R [Escherichia coli UMN026]
 gi|291429923|gb|EFF02937.1| type I restriction enzyme EcoKI R protein [Escherichia coli
           FVEC1412]
 gi|298280869|gb|EFI22370.1| type I restriction enzyme EcoKI R protein [Escherichia coli
           FVEC1302]
 gi|300357073|gb|EFJ72943.1| type III restriction enzyme, res subunit [Escherichia coli MS
           198-1]
 gi|301074919|gb|EFK89725.1| type III restriction enzyme, res subunit [Escherichia coli MS
           146-1]
          Length = 1170

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|218550387|ref|YP_002384178.1| type I restriction enzyme EcoKI subunit R [Escherichia fergusonii
           ATCC 35469]
 gi|218357928|emb|CAQ90572.1| endonuclease R [Escherichia fergusonii ATCC 35469]
          Length = 1170

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|228472528|ref|ZP_04057288.1| type I restriction enzyme EcoKI R protein [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228275941|gb|EEK14697.1| type I restriction enzyme EcoKI R protein [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 1087

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 27/66 (40%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           + I        ++R   LK+  +I  ++    N +R  GN+AVH G  S+  +   L+  
Sbjct: 53  EHIALPYDNNQANRISVLKREGIIEHQLGRILNELRQRGNEAVHAGFDSLTSAKTLLQMA 112

Query: 67  NLFCDI 72
                 
Sbjct: 113 YHLAQW 118


>gi|253775029|ref|YP_003037860.1| type I restriction enzyme EcoKI subunit R [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|301022252|ref|ZP_07186150.1| type III restriction enzyme, res subunit [Escherichia coli MS
           196-1]
 gi|253326073|gb|ACT30675.1| Type I site-specific deoxyribonuclease [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253980327|gb|ACT45997.1| endonuclease R [Escherichia coli BL21(DE3)]
 gi|299881302|gb|EFI89513.1| type III restriction enzyme, res subunit [Escherichia coli MS
           196-1]
 gi|313848842|emb|CAQ34699.2| host restriction; endonuclease R, subunit of EcoKI
           restriction-modification system [Escherichia coli
           BL21(DE3)]
          Length = 1170

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|254164267|ref|YP_003047377.1| type I restriction enzyme EcoKI subunit R [Escherichia coli B str.
           REL606]
 gi|253976170|gb|ACT41841.1| endonuclease R [Escherichia coli B str. REL606]
          Length = 1170

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|188586603|ref|YP_001918148.1| type III restriction protein res subunit [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179351290|gb|ACB85560.1| type III restriction protein res subunit [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 1082

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL--- 63
           + +   +      R   LK+ +L+ +++ +  + +R  GNKA H G  +I+++   L   
Sbjct: 53  ENLEEPEDQKQVSRLAILKKEDLLTDDLLDLFHTIRKIGNKAAHAGYGNIDDAKTLLRMA 112

Query: 64  -----EFVNLFCDIVFTLPALIKEKK 84
                 F+ ++    F  PA ++ +K
Sbjct: 113 FRISVWFMQVYGRWDFEPPAYVEPEK 138


>gi|117626662|ref|YP_859985.1| type I restriction enzyme EcoKI subunit R [Escherichia coli APEC
           O1]
 gi|115515786|gb|ABJ03861.1| DNA methylase R [Escherichia coli APEC O1]
 gi|294490639|gb|ADE89395.1| type I restriction enzyme EcoKI R protein [Escherichia coli
           IHE3034]
 gi|307629517|gb|ADN73821.1| type I restriction enzyme EcoKI subunit R [Escherichia coli UM146]
 gi|323950566|gb|EGB46444.1| type III restriction enzyme [Escherichia coli H252]
          Length = 1170

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|91214001|ref|YP_543987.1| type I restriction enzyme EcoKI subunit R [Escherichia coli UTI89]
 gi|91075575|gb|ABE10456.1| endonuclease R [Escherichia coli UTI89]
          Length = 1169

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 50  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLAVWYYRL 120


>gi|91787108|ref|YP_548060.1| hypothetical protein Bpro_1211 [Polaromonas sp. JS666]
 gi|91696333|gb|ABE43162.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 199

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 31/77 (40%), Gaps = 2/77 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDECLEFVNLFC 70
           K   L+   + LK   +I E IF W   +R   N   H    + + E++ + L+F    C
Sbjct: 120 KIKTLAAGLKKLKDDGVIDERIFNWGEALRENRNLGAHATAIKVTKEDARDLLDFGLAIC 179

Query: 71  DIVFTLPALIKEKKSTH 87
           + V+ L       +   
Sbjct: 180 EYVYVLNEKFNRFQERR 196


>gi|323141888|ref|ZP_08076749.1| helicase C-terminal domain protein [Phascolarctobacterium sp. YIT
           12067]
 gi|322413635|gb|EFY04493.1| helicase C-terminal domain protein [Phascolarctobacterium sp. YIT
           12067]
          Length = 1091

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 36/79 (45%), Gaps = 8/79 (10%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL----- 63
           + ++    L ++ R L+    I E++    + +R+ GN+A HEG  S++++   L     
Sbjct: 56  MPYQMKDTLVNKIRLLENEEYITEDLARIMHRLRLGGNEARHEGTDSLQKAKLLLPQAYS 115

Query: 64  ---EFVNLFCDIVFTLPAL 79
               F+ ++ D  +     
Sbjct: 116 LCEWFMQVYGDYSYQHQEY 134


>gi|332999613|gb|EGK19198.1| hypothetical protein SFVA6_3759 [Shigella flexneri VA-6]
          Length = 83

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 34 IFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTLPALIKEKKSTHPN 89
          +   ++  RI GN+AVH G+ +I++    +    + +N+      T P  ++   ++ P 
Sbjct: 2  VQRAADICRIVGNQAVHPGEINIDDDPQLAHGLFKLLNIIVTEQITRPKEVEAMFNSMPE 61

Query: 90 QSRDG 94
          ++  G
Sbjct: 62 RALKG 66


>gi|41752|emb|CAA29791.1| unnamed protein product [Escherichia coli K-12]
          Length = 1090

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + + ++  CL  
Sbjct: 69  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLNDAQMCLRL 128

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 129 GFRLAVWYYRL 139


>gi|259503492|ref|ZP_05746394.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259168570|gb|EEW53065.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 204

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIVFTLPAL 79
             YL +H+       +W + +R  GN+A HE + +  EE+   ++F  +   + +  P++
Sbjct: 138 VDYLNEHHYAGVRSEQWVDQIRQFGNQANHEIRINTKEEAQRIIKFCEMILKLNYEYPSI 197

Query: 80  IKEKKS 85
             ++ +
Sbjct: 198 ASDENN 203


>gi|213648687|ref|ZP_03378740.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
          Length = 1032

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|89111059|ref|AP_004839.1| endonuclease R [Escherichia coli str. K-12 substr. W3110]
 gi|238903438|ref|YP_002929234.1| endonuclease R [Escherichia coli BW2952]
 gi|331650831|ref|ZP_08351859.1| type I restriction enzyme EcoKI R protein (R.EcoKI) [Escherichia
           coli M718]
 gi|537192|gb|AAA97247.1| CG Site No. 620; alternate gene names hs, hsp, hsr, rm; apparent
           frameshift in GenBank Accession Number X06545
           [Escherichia coli str. K-12 substr. MG1655]
 gi|85677090|dbj|BAE78340.1| endonuclease R [Escherichia coli str. K12 substr. W3110]
 gi|238861030|gb|ACR63028.1| endonuclease R [Escherichia coli BW2952]
 gi|331051285|gb|EGI23334.1| type I restriction enzyme EcoKI R protein (R.EcoKI) [Escherichia
           coli M718]
          Length = 1188

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + + ++  CL  
Sbjct: 69  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLNDAQMCLRL 128

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 129 GFRLAVWYYRL 139


>gi|225420319|ref|ZP_03762622.1| hypothetical protein CLOSTASPAR_06662 [Clostridium asparagiforme
           DSM 15981]
 gi|225041005|gb|EEG51251.1| hypothetical protein CLOSTASPAR_06662 [Clostridium asparagiforme
           DSM 15981]
          Length = 145

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 4/78 (5%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           G LSD    L +   I     +  + +RI GNKAVHEG  +  ++++      +    V 
Sbjct: 56  GDLSDTIDQLYEGRWISRNTKDHYHNIRILGNKAVHEGDDTAYDANQAY---QMLVQEVK 112

Query: 75  TLPALIKEKK-STHPNQS 91
                    + +  P+ S
Sbjct: 113 AFADEYSSGRPAARPSGS 130


>gi|213022348|ref|ZP_03336795.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 548

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|213583087|ref|ZP_03364913.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
          Length = 409

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|226524764|ref|NP_418770.2| endonuclease R Type I restriction enzyme [Escherichia coli str.
           K-12 substr. MG1655]
 gi|269849739|sp|P08956|T1RK_ECOLI RecName: Full=Type I restriction enzyme EcoKI R protein;
           Short=R.EcoKI
 gi|226510991|gb|AAC77306.2| endonuclease R Type I restriction enzyme [Escherichia coli str.
           K-12 substr. MG1655]
          Length = 1170

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + + ++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLNDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|226313133|ref|YP_002773027.1| hypothetical protein BBR47_35460 [Brevibacillus brevis NBRC 100599]
 gi|226096081|dbj|BAH44523.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 243

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH--EGQSSIEESDECLEFVNLFCDIV 73
            L  + + L    ++   + E ++ +R  GN+A H  E + S +     ++F ++  D V
Sbjct: 141 DLYHKLKDLSDKGVLPPIVNEMASVLRELGNEAAHGDEREFSDDLISSMIKFTHVILDYV 200

Query: 74  FTLPALIKEKKSTH 87
           + LP  +   +   
Sbjct: 201 YNLPDKLSGIQKHL 214


>gi|168821021|ref|ZP_02833021.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342336|gb|EDZ29100.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320088961|emb|CBY98717.1| type I restriction-modification system, R subunit [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 1169

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|324115280|gb|EGC09244.1| type III restriction enzyme [Escherichia fergusonii B253]
          Length = 1170

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +N   C    D  R L +   + + I    + +R  GN+AVHE  + + ++  CL  
Sbjct: 51  GLLLNIPPCENQHDLLRELGKITFVDDNILSVFHKLRRIGNQAVHEYHNDLNDAQMCLRL 110

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 111 GFRLAVWYYRL 121


>gi|289824087|ref|ZP_06543684.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 391

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|56416310|ref|YP_153385.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197365233|ref|YP_002144870.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56130567|gb|AAV80073.1| subunit R of type I restriction-modification system [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197096710|emb|CAR62333.1| subunit R of type I restriction-modification system [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 1169

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|16763332|ref|NP_458949.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29144810|ref|NP_808152.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213428390|ref|ZP_03361140.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213864870|ref|ZP_03386989.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|25289195|pir||AD1069 type 1 site-specific deoxyribonuclease (EC 3.1.21.3) - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505641|emb|CAD03371.1| subunit R of type I restriction-modification system [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29140449|gb|AAO72012.1| subunit R of type I restriction-modification system [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 1169

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|257452213|ref|ZP_05617512.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp.
           3_1_5R]
 gi|317058756|ref|ZP_07923241.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp.
           3_1_5R]
 gi|313684432|gb|EFS21267.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp.
           3_1_5R]
          Length = 1088

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 18/105 (17%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL--- 63
           +RI+  K  M SDR   LK++ LI E+I +    +R +GNKAVH      E ++  L   
Sbjct: 52  ERISDSKKNMASDRLLALKKYELIPEDIEKILTTLRKKGNKAVHGIYGDEETAETLLSMA 111

Query: 64  -----EFVNLFC--------DIVFTLPALIK--EKKSTHPNQSRD 93
                 F  ++         +I++  P  I   E   +   +S +
Sbjct: 112 VKVAAWFQEVYGSDLSFTSEEIIYQKPKNIDYQEAYESLVKRSEE 156


>gi|289810393|ref|ZP_06541022.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 195

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|52144400|ref|YP_082428.1| hypothetical protein BCZK0824 [Bacillus cereus E33L]
 gi|51977869|gb|AAU19419.1| conserved hypothetical protein [Bacillus cereus E33L]
          Length = 754

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%), Gaps = 5/93 (5%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEF 65
           + I       L D+  YL +   I  E+    + VR  GNKA H+G  +   +  +  + 
Sbjct: 55  EDIKVPYISSLYDKISYLAKEGYITAEVQRDFDTVRFTGNKAAHDGSFNDISAAFKLHKV 114

Query: 66  VNLFCDIVFTL--PA--LIKEKKSTHPNQSRDG 94
           ++     ++ +  P    I   +   P QS + 
Sbjct: 115 MHNIAVWLYEVYSPEQLKIPAYEHPRPTQSNEA 147


>gi|213419771|ref|ZP_03352837.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 192

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|168232881|ref|ZP_02657939.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468971|ref|ZP_03074955.1| type I restriction enzyme EcoKI R protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194455335|gb|EDX44174.1| type I restriction enzyme EcoKI R protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|205333006|gb|EDZ19770.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 1169

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPACENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|161617831|ref|YP_001591796.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161367195|gb|ABX70963.1| hypothetical protein SPAB_05695 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 1169

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPACENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|16767770|ref|NP_463385.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16423093|gb|AAL23344.1| endonuclease R [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|312915623|dbj|BAJ39597.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
          Length = 1169

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPACENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|167991324|ref|ZP_02572423.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168243976|ref|ZP_02668908.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449776|ref|YP_002048549.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197262099|ref|ZP_03162173.1| type I restriction enzyme EcoKI R protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|194408080|gb|ACF68299.1| type I restriction enzyme EcoKI R protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197240354|gb|EDY22974.1| type I restriction enzyme EcoKI R protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|205330415|gb|EDZ17179.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205336991|gb|EDZ23755.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|261249611|emb|CBG27481.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996884|gb|ACY91769.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301161009|emb|CBW20546.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|323132868|gb|ADX20298.1| type III restriction enzyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332991335|gb|AEF10318.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 1169

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPACENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|213621071|ref|ZP_03373854.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 110

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109


>gi|154245046|ref|YP_001416004.1| type I restriction enzyme EcoKI subunit R [Xanthobacter
           autotrophicus Py2]
 gi|154159131|gb|ABS66347.1| type III restriction protein res subunit [Xanthobacter
           autotrophicus Py2]
          Length = 1124

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 6/68 (8%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +G+R  F++        R L    +I +E+ +  + +R  GN AVHE +    ++   L+
Sbjct: 57  RGERETFDET------LRRLSYDRVIPKEVADVFHALRKVGNAAVHEAKGGHADALTALK 110

Query: 65  FVNLFCDI 72
                   
Sbjct: 111 LARSLGVW 118


>gi|213162279|ref|ZP_03347989.1| type I restriction enzyme EcoKI subunit R [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
          Length = 224

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           GQ ++   C    D  R L +   I + I    + +R  GN AVHE  + ++++  CL  
Sbjct: 50  GQLLDIPVCENQHDLLRELGKIAFIDDSILSVFHKLRRIGNLAVHEFHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLSVWYYRL 120


>gi|260663335|ref|ZP_05864226.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|260552187|gb|EEX25239.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 204

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 23  YLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIVFTLP 77
           YL +H+       EW + +R  GN+A HE + +  EE+   ++F  +   + +  P
Sbjct: 139 YLNEHHYAGARSDEWVDQIRQFGNQANHEIRINTKEEAKRIIKFCEMILKLNYEYP 194


>gi|228926089|ref|ZP_04089167.1| hypothetical protein bthur0010_8110 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228833582|gb|EEM79141.1| hypothetical protein bthur0010_8110 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 754

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEF 65
           + I       L D+  YL +   I  E+    + VR  GNKA H+G  +   +  +  + 
Sbjct: 55  EDIKVPYISSLYDKISYLAKEGYITAEVQRDFDTVRFTGNKAAHDGSFNDISAAFKLHKV 114

Query: 66  VNLFCDIVFT 75
           ++     ++ 
Sbjct: 115 MHNIAVWLYE 124


>gi|254461164|ref|ZP_05074580.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677753|gb|EDZ42240.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 352

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 1/91 (1%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDEC 62
           D+   +     G      + L++   +  +  E  N V   GN A H G +   E+    
Sbjct: 136 DRLIVLTVGDKGNFPKGLKALEEEGKLSPQEREILNPVVEAGNAAAHRGWAPTKEQIAVI 195

Query: 63  LEFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           L+ V      +  LP L +E K   PN+   
Sbjct: 196 LDTVEGLIHRLLVLPTLAEELKEAVPNRGSR 226


>gi|297582111|ref|ZP_06944029.1| predicted protein [Vibrio cholerae RC385]
 gi|297533631|gb|EFH72474.1| predicted protein [Vibrio cholerae RC385]
          Length = 248

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 32/77 (41%), Gaps = 1/77 (1%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCD 71
           +   L  +   L +  L+ E      +  R  GNKAVHE    S+EE    ++ V    +
Sbjct: 167 RKSNLEGQISGLHEKGLLTEAHSSILHEHRFMGNKAVHELDMPSLEELKIAIDIVEHTLE 226

Query: 72  IVFTLPALIKEKKSTHP 88
            ++ LP    E ++   
Sbjct: 227 NIYELPEKASELRARKR 243


>gi|295691243|ref|YP_003594936.1| hypothetical protein Cseg_3899 [Caulobacter segnis ATCC 21756]
 gi|295433146|gb|ADG12318.1| conserved hypothetical protein [Caulobacter segnis ATCC 21756]
          Length = 257

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 29/78 (37%), Gaps = 5/78 (6%)

Query: 18  SDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIV 73
           +D  + L    +  E + +  + VRI  N +VH G  +  +    + +    VN   D  
Sbjct: 158 NDGIQTLVDRGM-PERVQKMCDAVRIITNDSVHLGTINSNDDLASATKLFHLVNAIVDQT 216

Query: 74  FTLPALIKEKKSTHPNQS 91
             L  L  E     P+  
Sbjct: 217 IGLDILADEIYGELPHDK 234


>gi|257463918|ref|ZP_05628304.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp. D12]
 gi|317061445|ref|ZP_07925930.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp. D12]
 gi|313687121|gb|EFS23956.1| type I restriction enzyme EcoKI subunit R [Fusobacterium sp. D12]
          Length = 1087

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 18/105 (17%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL--- 63
           + I+  K  M SDR   LK++ LI E+I +    +R +GNKAVH      E ++  L   
Sbjct: 52  EHISDSKKNMASDRLLVLKKYELIPEDIEKILTTLRKKGNKAVHGSYGDEETAETLLSMA 111

Query: 64  -----EFVNLFC--------DIVFTLPALIK--EKKSTHPNQSRD 93
                 F  ++         +I++  P  I   E   +   +S +
Sbjct: 112 VKAAAWFQEVYGSDLSFTSEEIIYQKPKNIDYQEAYESLVKRSGE 156


>gi|291167083|gb|EFE29129.1| type I restriction enzyme EcoKI R protein [Filifactor alocis ATCC
           35896]
          Length = 1098

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 26/59 (44%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
               ++R + LK+  ++  +I +  + +R+  NKAVH     +E+    LE        
Sbjct: 60  DNTHANRIKLLKKEGMLPNQIDDILHGLRLHRNKAVHANLDDLEKCKTLLEMTYHLAVW 118


>gi|257465992|ref|ZP_05630303.1| type I restriction enzyme EcoKI subunit R [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917148|ref|ZP_07913388.1| type I restriction enzyme EcoKI subunit R [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691023|gb|EFS27858.1| type I restriction enzyme EcoKI subunit R [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 1088

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 18/105 (17%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL--- 63
           + I+  +  M SDR   LK++ LI E+I +    +R +GNKAVH      E ++  L   
Sbjct: 52  EHISDSQKNMASDRLLALKKYELIPEDIEKILTTLRKKGNKAVHGIYGDEETAETLLSMA 111

Query: 64  -----EFVNLFC--------DIVFTLPALIK--EKKSTHPNQSRD 93
                 F  ++         +I++  P  I   E   +   +S +
Sbjct: 112 VKVAAWFQEVYGSDLSFTSEEIIYQKPKNIDYQEAYESLVKRSEE 156


>gi|261820961|ref|YP_003259067.1| type I restriction enzyme EcoKI subunit R [Pectobacterium wasabiae
           WPP163]
 gi|261604974|gb|ACX87460.1| type III restriction protein res subunit [Pectobacterium wasabiae
           WPP163]
          Length = 1169

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 31/71 (43%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  ++  +C    +  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 50  GILLDIPQCENQHELLRELGKIAFVDDNILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLAVWYYRL 120


>gi|304396443|ref|ZP_07378324.1| type III restriction protein res subunit [Pantoea sp. aB]
 gi|304355952|gb|EFM20318.1| type III restriction protein res subunit [Pantoea sp. aB]
          Length = 1169

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 29/71 (40%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G  +    C    D  R L +   + + I    + +R  GN+AVHE  + ++++  CL  
Sbjct: 50  GLLLGIPTCENQHDLLRELGKIAFVDDTILSVFHKLRRIGNQAVHEYHNDLDDAQMCLRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLGVWYYRL 120


>gi|167771151|ref|ZP_02443204.1| hypothetical protein ANACOL_02506 [Anaerotruncus colihominis DSM
          17241]
 gi|167666821|gb|EDS10951.1| hypothetical protein ANACOL_02506 [Anaerotruncus colihominis DSM
          17241]
          Length = 80

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIVF 74
            +    YL+ +  I  +   W + +R  GNK VH+  +++ E++ + + F+      ++
Sbjct: 14 SFAAYIDYLEANGYIGVQNKAWVDKIRTIGNKYVHQLDEATEEDARKVILFLKQLLGNLY 73

Query: 75 TLPALI 80
           +P L 
Sbjct: 74 EMPQLA 79


>gi|255523607|ref|ZP_05390574.1| type III restriction protein res subunit [Clostridium
           carboxidivorans P7]
 gi|255512662|gb|EET88935.1| type III restriction protein res subunit [Clostridium
           carboxidivorans P7]
          Length = 1090

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 39/88 (44%), Gaps = 14/88 (15%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE--------CLEF 65
               ++R + LK+ +LI E+I    + +RI+ N A H G  ++E++           + F
Sbjct: 61  DNSHNNRIKLLKREDLIPEDIDNILHMLRIKRNDAAHNGFENVEKAKVQLELTFKLAVWF 120

Query: 66  VNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           +  + +  F      + K    P++  +
Sbjct: 121 MQTYGEWSF------EPKPFVMPDEKEN 142


>gi|302874004|ref|YP_003842637.1| Type I site-specific deoxyribonuclease [Clostridium cellulovorans
           743B]
 gi|307689747|ref|ZP_07632193.1| type I restriction enzyme EcoKI subunit R [Clostridium
           cellulovorans 743B]
 gi|302576861|gb|ADL50873.1| Type I site-specific deoxyribonuclease [Clostridium cellulovorans
           743B]
          Length = 1085

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
                ++R + LK+ +LI E+I    + +RI+ N A H+G   +E++   LE        
Sbjct: 60  DDNNHNNRIKLLKKEDLIPEDIDNILHMLRIKRNSAAHQGYEDVEKAKVQLELTFKLAVW 119


>gi|90022721|ref|YP_528548.1| methyl-accepting chemotaxis sensory transducer [Saccharophagus
           degradans 2-40]
 gi|89952321|gb|ABD82336.1| methyl-accepting chemotaxis sensory transducer [Saccharophagus
           degradans 2-40]
          Length = 232

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 19  DRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-----ESDECLEFVNLFCDIV 73
           D  + +     +  +I +W++ +RI GN   H  + +++     +S+E  +FV+ F    
Sbjct: 147 DLIKQINSLASLPGDIKDWAHQIRIFGNWGAHPDRDNLKNIEATDSEEVHDFVSKFFMYT 206

Query: 74  FTLPALIKEKKSTHPNQSRDG 94
           F +P  +K  +    ++   G
Sbjct: 207 FIMPEKVKLSR-IRRDEKLKG 226


>gi|237739319|ref|ZP_04569800.1| type III restriction protein [Fusobacterium sp. 2_1_31]
 gi|229422927|gb|EEO37974.1| type III restriction protein [Fusobacterium sp. 2_1_31]
          Length = 1085

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 28/66 (42%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +  + +K  +  D+   LK+  LI ++I    + +R +GNKA H      + ++  L   
Sbjct: 52  ENFSCDKTTLAVDKILILKRAGLIPDDIDNILHSLRKKGNKAAHGAYGDEKTAETLLSLA 111

Query: 67  NLFCDI 72
                 
Sbjct: 112 VKLGAW 117


>gi|227820719|ref|YP_002824689.1| type I restriction enzyme EcoKI subunit R [Sinorhizobium fredii
           NGR234]
 gi|227339718|gb|ACP23936.1| putative restriction endonuclease type I with R subunit / type III
           with Res subunit [Sinorhizobium fredii NGR234]
          Length = 1140

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 22/59 (37%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
                D  R L    ++  E+ +  + VR  GN+A H    S  E+   L+F       
Sbjct: 64  RETTHDLLRRLATQQILPREVADIFHAVRKSGNEATHNLAGSPTEALAALKFCRALGVW 122


>gi|116250872|ref|YP_766710.1| type I restriction enzyme EcoKI subunit R [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255520|emb|CAK06597.1| putative type I restriction enzyme R subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 1136

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 24/63 (38%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLF 69
           N        D  R L    ++  E+ +  + VR  GNKA H+   S  E+   L+F    
Sbjct: 56  NATGRETTHDLLRRLATQQVLPREVADIFHAVRKAGNKANHDFGGSSAEALSALKFCRAL 115

Query: 70  CDI 72
              
Sbjct: 116 GVW 118


>gi|262066434|ref|ZP_06026046.1| type I restriction enzyme EcoKI R protein [Fusobacterium
           periodonticum ATCC 33693]
 gi|291379861|gb|EFE87379.1| type I restriction enzyme EcoKI R protein [Fusobacterium
           periodonticum ATCC 33693]
          Length = 1085

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 28/66 (42%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +  + +K  +  D+   LK+  LI ++I    + +R +GNKA H      + ++  L   
Sbjct: 52  ENFSCDKNTLAVDKILILKRAGLIPDDIDNILHSLRKKGNKAAHGAYGDEKTAETLLSLA 111

Query: 67  NLFCDI 72
                 
Sbjct: 112 VKLGAW 117


>gi|320450644|ref|YP_004202740.1| hypothetical protein TSC_c15760 [Thermus scotoductus SA-01]
 gi|320150813|gb|ADW22191.1| conserved hypothetical protein [Thermus scotoductus SA-01]
          Length = 148

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 38/90 (42%), Gaps = 9/90 (10%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH---------EGQSSIEESDECL 63
           + G L+DR +   +   +  + ++ +  +R+ GN A H         +GQ   E      
Sbjct: 56  EKGSLADRLKRAHEEGKLTTQTYKLAGVLRLAGNAAAHYELWKIDPSQGQEDREMILALF 115

Query: 64  EFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           EF+N   + +   P  ++E +     + R+
Sbjct: 116 EFLNEVTEELIAKPKRLEEMEQKLSRKLRE 145


>gi|134288672|ref|YP_001111134.1| gp55, hypothetical protein [Burkholderia phage phi644-2]
 gi|134132057|gb|ABO60854.1| gp55, hypothetical protein [Burkholderia phage phi644-2]
          Length = 104

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 17 LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECLEFVNLFCDIVFT 75
          L  R   L     I +++  W++ VR++GN A+H E + + E + E +EF  L    ++T
Sbjct: 22 LEKRIDRLADAGKITQDLKIWAHRVRLDGNDALHEEEEFTRESATELMEFTRLLLTYLYT 81

Query: 76 LPALIKEK 83
          LP  I+ +
Sbjct: 82 LPEKIRLR 89


>gi|332969660|gb|EGK08676.1| type I restriction-modification system R subunit [Desmospora sp.
           8437]
          Length = 1087

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECL--- 63
           ++    +    ++R R L +   +  E+    + +R +GN AVHEG  +I+E+   L   
Sbjct: 56  EKPAAVEPHNQNERLRVLGREADLPREVISMFHSLRQKGNDAVHEGIGTIQEAKSLLKIA 115

Query: 64  -----EFVNLFCDIVF 74
                 F+  + D  F
Sbjct: 116 YKLSVWFMQTYGDWDF 131


>gi|294676508|ref|YP_003577123.1| type I restriction-modification system RcaSBIP subunit R
           [Rhodobacter capsulatus SB 1003]
 gi|294475328|gb|ADE84716.1| type I restriction-modification system RcaSBIP, R subunit
           [Rhodobacter capsulatus SB 1003]
          Length = 1135

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 27/67 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            +   +   L+D  R LK    + +++ E  + +RI GN+A H+       +   L+   
Sbjct: 65  GLPIAQSDNLADLLRLLKIERSLPKQVLEILHSLRIAGNQAAHQNTDDHSSALSGLKLAR 124

Query: 68  LFCDIVF 74
                 F
Sbjct: 125 QLAIWYF 131


>gi|194466767|ref|ZP_03072754.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
 gi|194453803|gb|EDX42700.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
          Length = 202

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCDIVFTLPAL 79
             YL +++       +W N +R  GN+A HE   +  EE+   ++F  +   + +  P++
Sbjct: 136 VNYLNENHYAGARSEQWINQIRQFGNQANHEIIINSKEEAQRIIKFCEMILKLNYEYPSI 195

Query: 80  IKEKKS 85
             +  +
Sbjct: 196 ASDDNN 201


>gi|90408638|ref|ZP_01216791.1| ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase
           superfamily I member [Psychromonas sp. CNPT3]
 gi|90310245|gb|EAS38377.1| ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase
           superfamily I member [Psychromonas sp. CNPT3]
          Length = 942

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 38/89 (42%), Gaps = 9/89 (10%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +   +  E    L D+ +      L+ EEI +  + +R++GN+AVH  +++ +++   L+
Sbjct: 50  RELNLPCEPRSNLVDKLKSELFVELVGEEICQKLHAIRMKGNRAVHHNEATTDDALWLLK 109

Query: 65  FVNLFCDIV---------FTLPALIKEKK 84
              L    +            P+ I   +
Sbjct: 110 EAYLIGQWLHKSYSGELHIDYPSFIVPVR 138


>gi|254470457|ref|ZP_05083861.1| Type III restriction enzyme, res subunit family [Pseudovibrio sp.
           JE062]
 gi|211960768|gb|EEA95964.1| Type III restriction enzyme, res subunit family [Pseudovibrio sp.
           JE062]
          Length = 1131

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 24/61 (39%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           E           L +  ++ +++ +  + VR  GN A H  + +  ++   L+F  +   
Sbjct: 60  EDKETAFALLNRLSRDGILPKQVADIFHAVRKPGNDAAHGVEGTSSQALTSLKFCMVLGV 119

Query: 72  I 72
            
Sbjct: 120 W 120


>gi|241762634|ref|ZP_04760706.1| type III restriction protein res subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241372772|gb|EER62484.1| type III restriction protein res subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 1125

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/54 (24%), Positives = 25/54 (46%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           ++     +  R L    LI +E+ +  + +R  GN A+HE +     +   L+F
Sbjct: 58  DERETFEETLRRLSYDRLIPKEVSDIFHTLRKAGNSAIHEAKGDHSTALAALKF 111


>gi|167578796|ref|ZP_02371670.1| hypothetical protein BthaT_11678 [Burkholderia thailandensis
          TXDOH]
          Length = 96

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 17 LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECLEFVNLFCDIVFT 75
          L  R   L     I +++  W++ VR++GN A+H E + + E + E +EF  L    ++T
Sbjct: 22 LEKRIDKLADAGKITQDLKTWAHRVRLDGNDALHEEEEFTRESATELMEFTRLLLTYLYT 81

Query: 76 LPALIKEK 83
          LP  I+ +
Sbjct: 82 LPEKIRLR 89


>gi|218709367|ref|YP_002416988.1| type I restriction enzyme EcoKI subunit R [Vibrio splendidus LGP32]
 gi|218322386|emb|CAV18539.1| Type I restriction enzyme EcoKI, R subunit [Vibrio splendidus
           LGP32]
          Length = 1187

 Score = 53.8 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 31/71 (43%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
            + ++ E      +  R L +   + + I    + +R  GN+AVHE    +++++ CL F
Sbjct: 50  AKLLDIEVPENQHELLRELGKIPFVDDSILNVFHKLRKIGNQAVHEYHDDLQDAEMCLRF 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 AFRLAVWYYRL 120


>gi|326778042|ref|ZP_08237307.1| hypothetical protein SACT1_3891 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326658375|gb|EGE43221.1| hypothetical protein SACT1_3891 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 237

 Score = 53.8 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVNLFCD 71
           +   L+ +   L    ++  EI E  +  RI GN ++H+G + S EE  +  + +     
Sbjct: 151 EGNGLARKIDDLVNRGVV-REIVEDLHEARILGNWSLHDGLEFSAEEVADVADLIAEAIH 209

Query: 72  IVFTLPALIKEKKSTH 87
           I++  P   +  +   
Sbjct: 210 ILYVQPEERRAMRDAR 225


>gi|291533953|emb|CBL07066.1| Type I site-specific restriction-modification system, R
           (restriction) subunit and related helicases [Megamonas
           hypermegale ART12/1]
          Length = 1096

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 28/86 (32%), Gaps = 6/86 (6%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSI-----EESDEC 62
            I         +R   L +   I E++    + +R   NKAVHE          E +   
Sbjct: 52  NIKKPTEDKAVNRINILIREGYIDEQLKNILHALRKARNKAVHENYEKPCGLLLEFAYVL 111

Query: 63  L-EFVNLFCDIVFTLPALIKEKKSTH 87
              F+  + D  +     I  KK   
Sbjct: 112 SEWFMQTYGDYRYEHKPFILPKKEDI 137


>gi|311111507|ref|ZP_07712904.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
 gi|311066661|gb|EFQ47001.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
          Length = 187

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLEFVNLFCD 71
             YL +++ +  +  +W + +R  GN+A HE Q +  E++ + ++F  +   
Sbjct: 136 VNYLNENHFVSVKSHDWVDQIRKYGNEATHEIQVNTKEDAQKIIKFCEMILK 187


>gi|296328511|ref|ZP_06871030.1| type I restriction-modification system [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|296154320|gb|EFG95119.1| type I restriction-modification system [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 286

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 28/68 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +   ++K  +  DR   LK+  LI  +I      +R +GN A+H      ++++  L 
Sbjct: 50  KAENFTYDKNVLPVDRILILKRAGLIPADIDNILTSLRKKGNDAIHNYYRDEKKAETFLS 109

Query: 65  FVNLFCDI 72
                   
Sbjct: 110 LAVKLGAW 117


>gi|261493748|ref|ZP_05990265.1| hypothetical protein COK_2151 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261310593|gb|EEY11779.1| hypothetical protein COK_2151 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 234

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFC 70
           +    L+ R   L     + +++  ++  +R    +A H     S++E +E   F  LF 
Sbjct: 152 DARAKLNKRIEKLFDDGKLTKDLKNFALHIRSLSAEASHTYNDFSVDELEELRLFTQLFL 211

Query: 71  DIVFTLPALIKEKKSTHPNQSRD 93
              FTLPA+I       P++SR+
Sbjct: 212 RYTFTLPAMI-------PDESRE 227


>gi|90425135|ref|YP_533505.1| type I restriction enzyme EcoKI subunit R [Rhodopseudomonas
           palustris BisB18]
 gi|90107149|gb|ABD89186.1| type III restriction enzyme, res subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 1126

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 24/61 (39%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           ++     +  R L    +I +E  +  + +R  GN+A H+   +  ++   L+       
Sbjct: 59  DERESFEETLRRLSFERIIPKEAADVFHALRKSGNRAAHDIAGTQSDALTALKLARQLGI 118

Query: 72  I 72
            
Sbjct: 119 W 119


>gi|184155147|ref|YP_001843487.1| hypothetical protein LAF_0671 [Lactobacillus fermentum IFO 3956]
 gi|183226491|dbj|BAG27007.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
          Length = 229

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDECLEFVNLFCDIVF 74
             YL ++  + E+  EW + +R EGN A H   + +  ++   L+FV +   I F
Sbjct: 126 VDYLVENGYVPEKSREWIDKIRTEGNSATHNQTAKNKSDAQRILDFVQMLLLINF 180


>gi|218675224|ref|ZP_03524893.1| type I restriction enzyme EcoKI subunit R [Rhizobium etli GR56]
          Length = 1083

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 24/63 (38%)

Query: 10 NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLF 69
          N       +D    L    ++  E+ +  + VR  GNKA H+   S  E+   L+F    
Sbjct: 3  NAASRETTNDLLHRLATQQVLPREVADIFHAVRKAGNKANHDFGGSSAEALSALKFCRAL 62

Query: 70 CDI 72
             
Sbjct: 63 GVW 65


>gi|331270258|ref|YP_004396750.1| hypothetical protein CbC4_2086 [Clostridium botulinum BKT015925]
 gi|329126808|gb|AEB76753.1| conserved hypothetical protein [Clostridium botulinum BKT015925]
          Length = 790

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 13/86 (15%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECL--------EFV 66
             ++R R L+   +I  EI +  + VR+ GNKA HE  +  +E +             FV
Sbjct: 62  TQAERLRKLENEGVIEGEIDKLFHTVRLLGNKAAHEDVEGELEVALNIHKNIYKITCWFV 121

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSR 92
             + D  F         KS  P Q +
Sbjct: 122 ESYIDYNF----EATSYKSPMPQQDK 143


>gi|209526219|ref|ZP_03274749.1| type III restriction protein res subunit [Arthrospira maxima
           CS-328]
 gi|209493316|gb|EDZ93641.1| type III restriction protein res subunit [Arthrospira maxima
           CS-328]
          Length = 1128

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 23/58 (39%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
              +D  + LK   +I  E+ +  + +RI GN+A HE       +   L+        
Sbjct: 63  EAQADLLKRLKFQRVISPEVADLFHQIRIAGNRATHEYIGDHRSALTMLKMARQLAIW 120


>gi|323486841|ref|ZP_08092159.1| N-acetylmuramoyl-L-alanine amidase [Clostridium symbiosum
           WAL-14163]
 gi|323690859|ref|ZP_08105153.1| hypothetical protein HMPREF9475_00014 [Clostridium symbiosum
           WAL-14673]
 gi|323399854|gb|EGA92234.1| N-acetylmuramoyl-L-alanine amidase [Clostridium symbiosum
           WAL-14163]
 gi|323505078|gb|EGB20846.1| hypothetical protein HMPREF9475_00014 [Clostridium symbiosum
           WAL-14673]
          Length = 293

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 3/70 (4%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           G L D    L    +I +   E  + +R  GNKA+HE  +S   +++    ++     V+
Sbjct: 58  GNLIDMIDGLYDDGIISKTTCEHYHKIRTIGNKAIHEEDNSAYNANQAHHLLS---QEVY 114

Query: 75  TLPALIKEKK 84
           T      E++
Sbjct: 115 TFANDYNERR 124


>gi|89891082|ref|ZP_01202590.1| type I restriction-modification system, R subunit [Flavobacteria
           bacterium BBFL7]
 gi|89516726|gb|EAS19385.1| type I restriction-modification system, R subunit [Flavobacteria
           bacterium BBFL7]
          Length = 1070

 Score = 51.9 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 25/62 (40%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIV 73
            G   DR   L   N++ E I    + +R  GN+A H G  S +++   L+         
Sbjct: 57  NGTQLDRLNRLAYSNILPEVIEGIFHTIRKSGNQASHYGTGSFDQAKFILKKTFKLSKWF 116

Query: 74  FT 75
           + 
Sbjct: 117 YE 118


>gi|255527613|ref|ZP_05394475.1| type III restriction protein res subunit [Clostridium
           carboxidivorans P7]
 gi|296187656|ref|ZP_06856050.1| type III restriction enzyme, res subunit [Clostridium
           carboxidivorans P7]
 gi|255508685|gb|EET85063.1| type III restriction protein res subunit [Clostridium
           carboxidivorans P7]
 gi|296047613|gb|EFG87053.1| type III restriction enzyme, res subunit [Clostridium
           carboxidivorans P7]
          Length = 1102

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
             RI  ++     D+ + L+  N I + I +  + VR  GNKA H+G  + +++ ECL  
Sbjct: 50  ALRIETDRFATQDDKIKLLRTTN-INKAIPDLFDIVRRFGNKANHDGYENKKDALECLIS 108

Query: 66  VNLFCDIVFTL 76
           +       +  
Sbjct: 109 MYKVAAWFYIR 119


>gi|228964014|ref|ZP_04125144.1| hypothetical protein bthur0004_8740 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228795666|gb|EEM43143.1| hypothetical protein bthur0004_8740 [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 1430

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 9/82 (10%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDE--------CLEFVNLFCD 71
              L +  ++ EE+     ++R  GNKAVHE    SIE++ +         + F+ L+ D
Sbjct: 68  IHKLYREGILNEEMHFRFEWIRKMGNKAVHEANFGSIEDALKAHKLTYDLAVWFMELYGD 127

Query: 72  IVFTLPALIKEKKSTHPNQSRD 93
           + F  PA    K +     + D
Sbjct: 128 VNFKAPAYASPKANAEQKVNTD 149


>gi|149179563|ref|ZP_01858098.1| hypothetical protein PM8797T_03705 [Planctomyces maris DSM 8797]
 gi|148841598|gb|EDL56026.1| hypothetical protein PM8797T_03705 [Planctomyces maris DSM 8797]
          Length = 238

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 36/91 (39%), Gaps = 7/91 (7%)

Query: 4   DQGQRINFEKCG------MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSI 56
           DQG+ +     G       L  +   L    LI +   +  + +R  GN + H   Q  +
Sbjct: 144 DQGKLVRERATGKIVLRSNLEGKINGLWMKGLISKNQSKVLHQLRRLGNDSAHALDQPPL 203

Query: 57  EESDECLEFVNLFCDIVFTLPALIKEKKSTH 87
           +  +EC+E +      V+  P L+K   +  
Sbjct: 204 KLIEECIEALEHLLIQVYDQPELLKRLMNRK 234


>gi|315650928|ref|ZP_07903969.1| N-acetylmuramoyl-L-alanine amidase [Eubacterium saburreum DSM 3986]
 gi|315486842|gb|EFU77183.1| N-acetylmuramoyl-L-alanine amidase [Eubacterium saburreum DSM 3986]
          Length = 293

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 25/52 (48%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            L+D    L   N+I ++  E  + +R+ GNKAVH+       +    + ++
Sbjct: 57  SLADIIDSLYTSNIISQKSCEHYHKIRVIGNKAVHDNSDDSYSATIAYKLLS 108


>gi|269976585|ref|ZP_06183570.1| type I restriction enzyme EcoKI R protein [Mobiluncus mulieris
           28-1]
 gi|269935386|gb|EEZ91935.1| type I restriction enzyme EcoKI R protein [Mobiluncus mulieris
           28-1]
          Length = 1085

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 26/65 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
           R+          R   L++  L+ +++    + +R   NKAVHEG    + +   L  ++
Sbjct: 53  RVPEPTENKAIVRIDTLQREGLLPQDVVNVLHILRKARNKAVHEGWGDTDTATRFLPVIH 112

Query: 68  LFCDI 72
                
Sbjct: 113 SLTAW 117


>gi|17231631|ref|NP_488179.1| hypothetical protein all4139 [Nostoc sp. PCC 7120]
 gi|17133274|dbj|BAB75838.1| all4139 [Nostoc sp. PCC 7120]
          Length = 238

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 27/74 (36%), Gaps = 2/74 (2%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE--GQSSIEESDECLEFVNLFCDIV 73
            L ++   L     I  ++   ++ +R   N   H   G+ + EE     +      + V
Sbjct: 143 DLYNKLNDLAAKGEIPGKLVGVADQLRHLRNVGAHASLGELTKEEIPILDDLCRAILEYV 202

Query: 74  FTLPALIKEKKSTH 87
           ++ P L  + +   
Sbjct: 203 YSAPYLANKAQQQL 216


>gi|323963885|gb|EGB59379.1| hypothetical protein ERJG_04731 [Escherichia coli M863]
 gi|327252357|gb|EGE64029.1| hypothetical protein ECSTEC7V_3209 [Escherichia coli STEC_7v]
          Length = 73

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 34/67 (50%)

Query: 21 TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALI 80
            +L  ++L+ E + E +  V+ +GN   HEG      +++  +F  LF + ++T P  +
Sbjct: 1  MEWLFDNHLLPEALRELAECVKDDGNDGAHEGILDKAAAEDLEDFTYLFLERLYTEPQRL 60

Query: 81 KEKKSTH 87
           E K+  
Sbjct: 61 IEAKTRR 67


>gi|323136161|ref|ZP_08071243.1| Type I site-specific deoxyribonuclease [Methylocystis sp. ATCC
           49242]
 gi|322398235|gb|EFY00755.1| Type I site-specific deoxyribonuclease [Methylocystis sp. ATCC
           49242]
          Length = 1106

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 27/65 (41%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            +  ++     +  R L+Q  L+  +  +  +F R  GN AVHE   + E++   L+   
Sbjct: 36  GLGIDRRANFDEMLRVLRQEGLLPRQAADVFHFFRKVGNLAVHENSGTPEQALAGLKLAQ 95

Query: 68  LFCDI 72
                
Sbjct: 96  QLGAW 100


>gi|188589957|ref|YP_001921313.1| hypothetical protein CLH_1932 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188500238|gb|ACD53374.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 800

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 31/74 (41%), Gaps = 3/74 (4%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVNLFCDIVF 74
              +R R L++  ++ E I +  + VR+ GNKA H   +  +E +    + +        
Sbjct: 62  TQVERLRKLEEEGILTENIDKLFHVVRLLGNKAAHSNLEGELEAALNIHKNIYKITCWFV 121

Query: 75  TLPALIKEKKSTHP 88
            +   +  K  + P
Sbjct: 122 EV--YVDPKFESLP 133


>gi|300118619|ref|ZP_07056357.1| type I restriction enzyme EcoKI subunit R [Bacillus cereus SJ1]
 gi|298724008|gb|EFI64712.1| type I restriction enzyme EcoKI subunit R [Bacillus cereus SJ1]
          Length = 1437

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 9/82 (10%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDE--------CLEFVNLFCD 71
              L +  ++ EE+     ++R  GNKAVHE    S+E++ +         + F+ L+ D
Sbjct: 68  IHKLYREGILNEEMHFRFEWIRKMGNKAVHEANFGSVEDALKAHKLTYDLAVWFMELYGD 127

Query: 72  IVFTLPALIKEKKSTHPNQSRD 93
           + F  PA    K  T    + D
Sbjct: 128 VNFKAPAYASPKAVTEQKVNTD 149


>gi|229131852|ref|ZP_04260721.1| hypothetical protein bcere0014_7990 [Bacillus cereus BDRD-ST196]
 gi|228651599|gb|EEL07565.1| hypothetical protein bcere0014_7990 [Bacillus cereus BDRD-ST196]
          Length = 788

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEES--------DECLEFVN 67
             DR + L++ +++ +EI    + VR  GNKA HE  +S +E +           + F+ 
Sbjct: 63  QVDRIQKLEREDILSKEISRSFDTVRYLGNKAAHEHIESGVESAFKMHKNLFQIAVWFME 122

Query: 68  LFCDIVFTLPAL 79
           ++    F  P  
Sbjct: 123 VYGSYEFVAPKY 134


>gi|331003734|ref|ZP_08327228.1| hypothetical protein HMPREF0491_02090 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330412117|gb|EGG91512.1| hypothetical protein HMPREF0491_02090 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 296

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 26/58 (44%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
             E+   L+D    L  +N+I +   E  + +R  GNKAVHE       +    + ++
Sbjct: 51  EDEEDQSLADIIDSLYTNNIISKTSCEHYHKIRAIGNKAVHENNDDGYNATIAYQLLS 108


>gi|154251679|ref|YP_001412503.1| exonuclease V subunit alpha [Parvibaculum lavamentivorans DS-1]
 gi|154253941|ref|YP_001414765.1| exonuclease V subunit alpha [Parvibaculum lavamentivorans DS-1]
 gi|154155629|gb|ABS62846.1| ATP-dependent exoDNAse (exonuclease V) alpha subunit - helicase
           superfamily I member-like protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157891|gb|ABS65108.1| ATP-dependent exoDNAse (exonuclease V) alpha subunit - helicase
           superfamily I member-like protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 924

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 26/57 (45%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
            + ++      DR   L+  +L+   +    + +R  GN A H G+ +  +++  LE
Sbjct: 57  GLQYDPAHSHFDRLVLLENADLLDARLLSKFHAIRKVGNNAAHNGKVTPAQAEALLE 113


>gi|297584947|ref|YP_003700727.1| hypothetical protein Bsel_2662 [Bacillus selenitireducens MLS10]
 gi|297143404|gb|ADI00162.1| hypothetical protein Bsel_2662 [Bacillus selenitireducens MLS10]
          Length = 397

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 34/87 (39%), Gaps = 9/87 (10%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECL 63
           + + I+   C  L DR R LK H    E++    + +R  GN A HE  +    ++    
Sbjct: 53  RKEGISDIACENLLDRIRLLKSHGKCSEDVLNAIHEIRKAGNSAAHETKEFRYSQALRTW 112

Query: 64  EFVNLFCDI--------VFTLPALIKE 82
           E + +             F +PA  + 
Sbjct: 113 EELYVLVAWYMKKYGPLKFEMPAYREP 139


>gi|323697975|ref|ZP_08109887.1| Type I site-specific deoxyribonuclease [Desulfovibrio sp. ND132]
 gi|323457907|gb|EGB13772.1| Type I site-specific deoxyribonuclease [Desulfovibrio desulfuricans
           ND132]
          Length = 1122

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 22/52 (42%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
            R L    L+  +I +  + +R  GN A HE +   + + + L F  +    
Sbjct: 74  IRRLDDEGLLTPKINQVLHILRKAGNVAAHELEGEPQHALDALRFARILAIW 125


>gi|283797584|ref|ZP_06346737.1| N-acetylmuramoyl-L-alanine amidase [Clostridium sp. M62/1]
 gi|291074693|gb|EFE12057.1| N-acetylmuramoyl-L-alanine amidase [Clostridium sp. M62/1]
          Length = 306

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +R +  +   L D    L ++ +I +   E  + +R+ GNKAVHE  +    + +    +
Sbjct: 50  ERFDVSEA-TLVDMIDALYENGIINKTTCEHYHKIRMIGNKAVHEEDNLAYNAGQAYHLL 108

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           +     ++T       KK     + R+
Sbjct: 109 S---QEIYTFANDFTGKKKKPLPRQRE 132


>gi|170718591|ref|YP_001783794.1| exonuclease V subunit alpha [Haemophilus somnus 2336]
 gi|168826720|gb|ACA32091.1| ATP-dependent exoDNAse (exonuclease V) alpha subunit-like protein -
           helicase superfamily I member [Haemophilus somnus 2336]
          Length = 937

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 2/72 (2%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE--GQSSIEESDEC 62
           +   I       LSDR R       + +EI +  + +RI GNKAVH         E  +C
Sbjct: 50  KQLHIELVDNESLSDRMRKADFKTYVPKEIQQKLHLLRIAGNKAVHTSFSHLDFSEVADC 109

Query: 63  LEFVNLFCDIVF 74
           L    L    ++
Sbjct: 110 LREAYLLGKWLY 121


>gi|295115044|emb|CBL35891.1| Bacterial SH3 domain. [butyrate-producing bacterium SM4/1]
          Length = 306

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +R +  +   L D    L ++ +I +   E  + +R+ GNKAVHE  +    + +    +
Sbjct: 50  ERFDVSEA-TLVDMIDALYENGIINKTTCEHYHKIRMIGNKAVHEEDNLAYNAGQAYHLL 108

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           +     ++T       KK     + R+
Sbjct: 109 S---QEIYTFANDFTGKKKKPLPRQRE 132


>gi|229171705|ref|ZP_04299280.1| hypothetical protein bcere0006_8260 [Bacillus cereus MM3]
 gi|228611851|gb|EEK69098.1| hypothetical protein bcere0006_8260 [Bacillus cereus MM3]
          Length = 788

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEES--------DECLEFVN 67
             +R + L++ +++ +EI    + VR  GNKA HE  +S +E +           + F+ 
Sbjct: 63  QVERIQKLEREDILSKEISRSFDTVRYLGNKAAHEHIESGVESAFKMHKNLFQIAVWFME 122

Query: 68  LFCDIVFTLPAL 79
           ++    F  P  
Sbjct: 123 VYGSYEFVAPKY 134


>gi|90410146|ref|ZP_01218163.1| endonuclease R, host restriction [Photobacterium profundum 3TCK]
 gi|90329499|gb|EAS45756.1| endonuclease R, host restriction [Photobacterium profundum 3TCK]
          Length = 1175

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 31/71 (43%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
            + ++ E      D  R L + + + + I ++ + +R  GNKAVHE    + +++  L  
Sbjct: 50  AKLLDMEIPENQVDLIRDLSRISWVDDNIIKFFHQLRKVGNKAVHEYHDDLNDAEMMLRI 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 AFKVSVWYYRL 120


>gi|295089932|emb|CBK76039.1| Bacterial SH3 domain. [Clostridium cf. saccharolyticum K10]
          Length = 306

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +R +  +   L D    L ++ +I +   E  + +R+ GNKAVHE  +    + +    +
Sbjct: 50  ERFDVSEA-TLVDMIDALYENGIINKTTCEHYHKIRMIGNKAVHEEDNLAYNAGQAYHLL 108

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSRD 93
           +     ++T       KK     + R+
Sbjct: 109 S---QEIYTFANDFTGKKKKPLPRQRE 132


>gi|167005389|ref|ZP_02271147.1| hypothetical protein Cjejjejuni_03980 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|107770375|gb|ABF83712.1| hypothetical protein cju18 [Campylobacter jejuni subsp. jejuni
           81-176]
          Length = 221

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 32  EEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTLPALIKEKKSTH 87
           E + E  N +R+ GNKA H  +  I +    ++   E +N     + T P   +E+ +  
Sbjct: 154 ESLEEAMNSIRLIGNKASHPSELDINDNSEIANILFEMINFIVGEIITKPKEREERLNKL 213


>gi|254225989|ref|ZP_04919590.1| type III restriction enzyme, res subunit family [Vibrio cholerae
           V51]
 gi|125621523|gb|EAZ49856.1| type III restriction enzyme, res subunit family [Vibrio cholerae
           V51]
          Length = 682

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
            + ++ +      D    L + + + E I +  + +R  GNKAVHE  S + +++  L  
Sbjct: 50  AKLLDIDLPDNQRDLINELGKISFVDENILKVFHNLRKIGNKAVHEYHSDLPDAEMALRL 109

Query: 66  VNLFCDIVFTL 76
                   + L
Sbjct: 110 GFRLAVWYYRL 120


>gi|229195245|ref|ZP_04322019.1| hypothetical protein bcere0001_8190 [Bacillus cereus m1293]
 gi|228588271|gb|EEK46315.1| hypothetical protein bcere0001_8190 [Bacillus cereus m1293]
          Length = 788

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEES--------DECLEFVN 67
             +R + L++ +++ +EI    + VR  GNKA HE  +S +E +           + F+ 
Sbjct: 63  QVERIQKLEREDILSKEISRSFDTVRYLGNKAAHEHIESGVESAFKMHKNLFQIAVWFME 122

Query: 68  LFCDIVFTLPAL 79
           ++    F +P  
Sbjct: 123 VYGSYEFVVPKY 134


>gi|228919776|ref|ZP_04083135.1| hypothetical protein bthur0011_7970 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228839863|gb|EEM85145.1| hypothetical protein bthur0011_7970 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 788

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEES--------DECLEFVN 67
             +R + L++ +++ +EI    + VR  GNKA HE  +S +E +           + F+ 
Sbjct: 63  QVERIQKLEREDILSKEISRSFDTVRYLGNKAAHEHIESGVESAFKMHKNLFQIAVWFME 122

Query: 68  LFCDIVFTLPAL 79
           ++    F +P  
Sbjct: 123 VYGSYEFVVPKY 134


>gi|28869587|ref|NP_792206.1| hypothetical protein PSPTO_2390 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28852829|gb|AAO55901.1| protein of unknown function [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 256

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 28/84 (33%), Gaps = 5/84 (5%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVNL 68
             EK     +R   L +            N +R  GN   H G +   E++   LE +  
Sbjct: 162 TEEKFISFGNRINLLPEEQ---ASTKNLFNAIRWIGNHGSHPGNEIEFEDALHALEIMEY 218

Query: 69  FCDIVF-TLPALIKEKKSTHPNQS 91
             + VF      ++   +   ++ 
Sbjct: 219 LLEEVFGDRKQALEALAAAINDRK 242


>gi|85708304|ref|ZP_01039370.1| hypothetical protein NAP1_03675 [Erythrobacter sp. NAP1]
 gi|85689838|gb|EAQ29841.1| hypothetical protein NAP1_03675 [Erythrobacter sp. NAP1]
          Length = 232

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 28/81 (34%), Gaps = 1/81 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIV 73
             L  +   L     + E      + +R +GN   HE    +  E    +  VNL  + +
Sbjct: 152 RNLMQKIDNLHSRGHVDENQLGLLHKIREKGNAGAHERIAMNRNEMVAGIGIVNLLLEKL 211

Query: 74  FTLPALIKEKKSTHPNQSRDG 94
           +  P   +E         +DG
Sbjct: 212 YNGPKRQEEILKKAKQAFQDG 232


>gi|288947721|ref|YP_003445104.1| type III restriction protein res subunit [Allochromatium vinosum
           DSM 180]
 gi|288898237|gb|ADC64072.1| type III restriction protein res subunit [Allochromatium vinosum
           DSM 180]
          Length = 1128

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 22/65 (33%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            +        SD  R LK       E+ +  + +RI GN+A H       E+   L+   
Sbjct: 57  GLLTSPEEPQSDLLRRLKLERAAPPEVMDLFHQLRIAGNRAAHAILDDHREALTALKIAR 116

Query: 68  LFCDI 72
                
Sbjct: 117 QLAIW 121


>gi|153217689|ref|ZP_01951370.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124113364|gb|EAY32184.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 62

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 4/52 (7%)

Query: 47 KAVHEGQSSIEE----SDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
           AVH G+ S+++           +NL  D   T P  ++      P  + + 
Sbjct: 3  NAVHPGELSLDDNPQTVTTLFGLINLIVDNQITQPKQVESLFHGLPEGAIEA 54


>gi|82617326|emb|CAI64238.1| hypothetical protein [uncultured archaeon]
 gi|268323035|emb|CBH36623.1| conserved hypothetical protein [uncultured archaeon]
          Length = 215

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE-SDECLEFVNLFCDIVFTL 76
             YL++   +   +  W + +R  GNKA H  +S  ++ ++  L F      +++ +
Sbjct: 148 LSYLEEQGFVTPPMKGWVDLIRQHGNKATHSLESPDKKRAESTLMFTAELLRLIYEM 204


>gi|82617194|emb|CAI64101.1| hypothetical protein [uncultured archaeon]
          Length = 215

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE-SDECLEFVNLFCDIVFTL 76
             YL++   +   +  W + +R  GNKA H  +S  ++ ++  L F      +++ +
Sbjct: 148 LSYLEEQGFVTPPMKGWVDLIRQHGNKATHSLESPDKKRAESTLMFTAELLRLIYEM 204


>gi|295135275|ref|YP_003585951.1| hypothetical protein ZPR_3439 [Zunongwangia profunda SM-A87]
 gi|294983290|gb|ADF53755.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 298

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 1/80 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE-CLEFVNLFCDIV 73
             L++R   L ++  +     +  + +R  GN A+HE +   EE     L  +N     +
Sbjct: 139 NNLAERIDGLSKNGHLTTSESKRLHSIRFLGNDALHEMEVPKEEHLYLLLGIINHLLTNL 198

Query: 74  FTLPALIKEKKSTHPNQSRD 93
           F    ++K K  T  +   +
Sbjct: 199 FINDKIMKGKVETMVDTYDE 218


>gi|312142612|ref|YP_003994058.1| hypothetical protein Halsa_0217 [Halanaerobium sp. 'sapolanicus']
 gi|311903263|gb|ADQ13704.1| hypothetical protein Halsa_0217 [Halanaerobium sp. 'sapolanicus']
          Length = 728

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 9/82 (10%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC--------LEFV 66
             L ++ + L   N + EE     + +R  GN+A H+   + EE  E         + FV
Sbjct: 61  RKLFEKIK-LMGQNYLEEETISKLHKIRKIGNRASHDSDVTQEEVLEIHEDIFSLAVWFV 119

Query: 67  NLFCDIVFTLPALIKEKKSTHP 88
            L+ D  F  P   K KK    
Sbjct: 120 ELYIDYSFEEPKYQKPKKKEER 141


>gi|86153424|ref|ZP_01071628.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|121613205|ref|YP_001000446.1| hypothetical protein CJJ81176_0778 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|85843150|gb|EAQ60361.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|87249527|gb|EAQ72487.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           81-176]
          Length = 197

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 32  EEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTLPALIKEKKSTH 87
           E + E  N +R+ GNKA H  +  I +    ++   E +N     + T P   +E+ +  
Sbjct: 130 ESLEEAMNSIRLIGNKASHPSELDINDNSEIANILFEMINFIVGEIITKPKEREERLNKL 189


>gi|167854769|ref|ZP_02477547.1| type III restriction enzyme, res subunit [Haemophilus parasuis
           29755]
 gi|167854067|gb|EDS25303.1| type III restriction enzyme, res subunit [Haemophilus parasuis
           29755]
          Length = 1121

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----- 62
           R+   +    +DR + LK+   +  EI    +F++  GN+AVHEG    +++        
Sbjct: 52  RLALPENITQNDRLKALKECR-LDREILSMFHFLKNAGNEAVHEGIEDSQKAITAMIAAW 110

Query: 63  ---LEFVNLFCDIV 73
              + FV  F D +
Sbjct: 111 QLSIWFVRTFGDNM 124


>gi|90579609|ref|ZP_01235418.1| putative type I restriction enzyme R protein [Vibrio angustum S14]
 gi|90439183|gb|EAS64365.1| putative type I restriction enzyme R protein [Vibrio angustum S14]
          Length = 1145

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 29/70 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +   +       + D+       +++ + I +  + VR  GNKA HEG+ S  ++   L+
Sbjct: 48  RELHLPVAPNASMHDKLVSGSFTSIVDKTIVDKFHAVRRGGNKAAHEGEVSQHDAIWLLK 107

Query: 65  FVNLFCDIVF 74
                   +F
Sbjct: 108 ESYFIGCWLF 117


>gi|332520742|ref|ZP_08397204.1| Type I site-specific deoxyribonuclease [Lacinutrix algicola
           5H-3-7-4]
 gi|332044095|gb|EGI80290.1| Type I site-specific deoxyribonuclease [Lacinutrix algicola
           5H-3-7-4]
          Length = 1082

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 24/66 (36%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFV 66
           +++          R   L  ++    EI +  + +R  GNKA H G+ S  E+   L   
Sbjct: 54  EQLEEPYDKKQISRLVVLANNSDTPREIIDIFHSIRKSGNKASHTGEGSQAEARYMLRQA 113

Query: 67  NLFCDI 72
                 
Sbjct: 114 FYLTKW 119


>gi|314937242|ref|ZP_07844587.1| putative type II restriction endonuclease [Staphylococcus hominis
           subsp. hominis C80]
 gi|313654675|gb|EFS18422.1| putative type II restriction endonuclease [Staphylococcus hominis
           subsp. hominis C80]
          Length = 1464

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 32/80 (40%), Gaps = 6/80 (7%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE--SDECLE 64
           + I   K    +   + LK  N++  +I      ++  GN + H+ ++ ++E  + E L 
Sbjct: 59  EMIKIPKRTTFNSLLKILKNKNILPTKILNILYNIKSYGNISAHDIENEVDESLAIEILR 118

Query: 65  FVNLFCDIVF----TLPALI 80
                   ++    T P  +
Sbjct: 119 QTFTIVSWLYKKYATDPKSV 138


>gi|32476613|ref|NP_869607.1| type I restriction enzyme EcoKI subunit R [Rhodopirellula baltica
           SH 1]
 gi|32447159|emb|CAD76985.1| type I restriction enzyme EcoKI R protein [Rhodopirellula baltica
           SH 1]
          Length = 1138

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 22  RYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
           R L+   ++ +++ +    VR +GN A H       ++  CL+ V      
Sbjct: 76  RRLRDSGILNQQLRDVMRTVRQKGNSAAHSLAGERRDALHCLKLVRQLAIW 126


>gi|312887843|ref|ZP_07747430.1| type III restriction protein res subunit [Mucilaginibacter paludis
           DSM 18603]
 gi|311299662|gb|EFQ76744.1| type III restriction protein res subunit [Mucilaginibacter paludis
           DSM 18603]
          Length = 1081

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 25/52 (48%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           ++F       +R + L    ++   I +    ++ +GN AVH+ + + E++ 
Sbjct: 55  LDFPFDNTFHNRIKVLWFEKILPSTINDILFTIKDKGNVAVHQSKGTFEDAK 106


>gi|89901611|ref|YP_524082.1| hypothetical protein Rfer_2839 [Rhodoferax ferrireducens T118]
 gi|89346348|gb|ABD70551.1| hypothetical protein Rfer_2839 [Rhodoferax ferrireducens T118]
          Length = 271

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 26/76 (34%), Gaps = 1/76 (1%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-SIEESDECLEFVNLFCD 71
           K   L  +   L    ++        + +R  GN + HE    +  +    +  V+   +
Sbjct: 153 KGNNLLKQIDDLVSLGILTPGRASVLHQIRTLGNLSAHEAAPHTPAQLGLAMAVVDHLLE 212

Query: 72  IVFTLPALIKEKKSTH 87
            V+ LP   +   S  
Sbjct: 213 EVYILPEKTQRLFSGL 228


>gi|330969621|gb|EGH69687.1| type I restriction enzyme EcoKI subunit R [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 1154

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 26/65 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I F+     +D    L +   +   I    + +R+EGNKA HE ++   E+ + L    
Sbjct: 55  GIEFDATTSQADLLFRLSREIQLDGNIRNLFHTLRVEGNKATHEFRTQHREALDGLRVAR 114

Query: 68  LFCDI 72
                
Sbjct: 115 ALAIW 119


>gi|322384019|ref|ZP_08057747.1| hypothetical protein PL1_2075 [Paenibacillus larvae subsp. larvae
          B-3650]
 gi|321151386|gb|EFX44575.1| hypothetical protein PL1_2075 [Paenibacillus larvae subsp. larvae
          B-3650]
          Length = 187

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 34 IFEWSNFVRIEGNKAVH-EGQSSIEESDECL--------EFVNLFCDIVFTLPALIKEKK 84
          + +  + +R++GNKAVH       +E+   L         F+ ++ D  F  PA  +  K
Sbjct: 1  MIDLFHTIRLKGNKAVHKPEYGDTDEAKALLHMAFRLSVWFMEVYGDWKFKAPAYQEPSK 60

Query: 85 STH 87
             
Sbjct: 61 ENL 63


>gi|127514520|ref|YP_001095717.1| Sel1 domain-containing protein [Shewanella loihica PV-4]
 gi|126639815|gb|ABO25458.1| Sel1 domain protein repeat-containing protein [Shewanella loihica
           PV-4]
          Length = 472

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/76 (14%), Positives = 29/76 (38%), Gaps = 4/76 (5%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
            L DR   L +  +I   +    + +R +GN+  H  +  +  ++   +      + +  
Sbjct: 60  NLYDRIELLNRQRVINVRLTRALHRLRSDGNRGAHPEKYHL-TAEALEQLAEKAIERLV- 117

Query: 76  LPALIKEKKSTHPNQS 91
              L+++      N+ 
Sbjct: 118 --KLVEDLYPLLCNEP 131


>gi|329118426|ref|ZP_08247132.1| hypothetical protein HMPREF9123_0560 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465472|gb|EGF11751.1| hypothetical protein HMPREF9123_0560 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 251

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 30/86 (34%), Gaps = 1/86 (1%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFV 66
            I F K   L  +   + +  L+ +   +  + ++  GN + HE  + +IE        +
Sbjct: 161 NIIFGKRDHLFQKIGKILEQGLLPKGSKDILHSIKDMGNSSAHEAKRQNIEHLKLAFGVL 220

Query: 67  NLFCDIVFTLPALIKEKKSTHPNQSR 92
                 ++       E K    +  +
Sbjct: 221 ESLLRTLYIHTKQFNEIKQDSDDAKQ 246


>gi|300854635|ref|YP_003779619.1| hypothetical protein CLJU_c14490 [Clostridium ljungdahlii DSM
           13528]
 gi|300434750|gb|ADK14517.1| hypothetical protein CLJU_c14490 [Clostridium ljungdahlii DSM
           13528]
          Length = 798

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 28/74 (37%), Gaps = 3/74 (4%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVNLFCDIVF 74
              +R + L+   +  + I +  + VR++GNKA H   +  +E +      +        
Sbjct: 62  TQVERLKKLEFEGVFSDNIEKLFHAVRLQGNKAAHSDVEGELEVALNMHRNIYKITCWFV 121

Query: 75  TLPALIKEKKSTHP 88
                I +K    P
Sbjct: 122 K--TYIYQKFEALP 133


>gi|126667627|ref|ZP_01738596.1| endonuclease R [Marinobacter sp. ELB17]
 gi|126627896|gb|EAZ98524.1| endonuclease R [Marinobacter sp. ELB17]
          Length = 1174

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 31/64 (48%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNL 68
           ++F++    +D    L +      ++ E  + +RIEGNKA H+ ++  +E+ + L+    
Sbjct: 60  VDFDEQTSQADLLCRLNKELRFEPQVKELFHTLRIEGNKATHQFRTRHKEAMDGLKLARA 119

Query: 69  FCDI 72
               
Sbjct: 120 LAIW 123


>gi|13476621|ref|NP_108191.1| hypothetical protein mll8000 [Mesorhizobium loti MAFF303099]
 gi|14027383|dbj|BAB53652.1| mll8000 [Mesorhizobium loti MAFF303099]
          Length = 223

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 27/73 (36%), Gaps = 5/73 (6%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-----EGQSSIEESDECLEFVNLFC 70
            L  R   L    +I  E+   ++ +RI GN A H           EES+  +E      
Sbjct: 143 DLKTRLAALGTVAVIPSELLSAADELRILGNDAAHIEAKDYDSIGKEESEIAIELAKELL 202

Query: 71  DIVFTLPALIKEK 83
             V+   +L+   
Sbjct: 203 KAVYQYTSLVARL 215


>gi|319952259|ref|YP_004163526.1| hypothetical protein Celal_0689 [Cellulophaga algicola DSM 14237]
 gi|319420919|gb|ADV48028.1| hypothetical protein Celal_0689 [Cellulophaga algicola DSM 14237]
          Length = 297

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 31/82 (37%), Gaps = 1/82 (1%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEFVNLFCD 71
           +   L +R   L +   +     +  + +R  GN A+HE     +E     L+ +N    
Sbjct: 136 RKDNLEERINLLNEKGHLTVSESKRLHSIRFLGNDALHEIAKPKKEHLYILLDIINHLLV 195

Query: 72  IVFTLPALIKEKKSTHPNQSRD 93
            +F     IK +  T  +   D
Sbjct: 196 NLFVNDKKIKGQIETQIDSYED 217


>gi|186684990|ref|YP_001868186.1| type I restriction enzyme EcoKI subunit R [Nostoc punctiforme PCC
           73102]
 gi|186467442|gb|ACC83243.1| type III restriction enzyme, res subunit [Nostoc punctiforme PCC
           73102]
          Length = 1105

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 21/59 (35%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
                D    L+   LI  E+    + +R  GN+A HE   +   +   L++       
Sbjct: 61  DERQIDLLNRLRDRGLIKGEVDRLFHELRKIGNQATHELSGNHRTALSGLKYALALGIW 119


>gi|149203430|ref|ZP_01880400.1| putative type I restriction enzyme R protein [Roseovarius sp.
           TM1035]
 gi|149143263|gb|EDM31302.1| putative type I restriction enzyme R protein [Roseovarius sp.
           TM1035]
          Length = 1142

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 27/75 (36%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +  R+         D  R      ++ + + +  + +RI GNKA H   +S + +   ++
Sbjct: 51  RDLRLPKPDQATFIDLLRNESFSAIVPKVVLDKLHALRIHGNKAAHGDPASTKNALWLIK 110

Query: 65  FVNLFCDIVFTLPAL 79
                   +F     
Sbjct: 111 EAFDLSRWIFVQARK 125


>gi|126172445|ref|YP_001048594.1| Sel1 domain-containing protein [Shewanella baltica OS155]
 gi|125995650|gb|ABN59725.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS155]
          Length = 491

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            L DR   L Q  +I  +     + +R +GN+  H  +  + ++ + L  V 
Sbjct: 65  NLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEKYHLTQA-QLLALVQ 115


>gi|24375751|ref|NP_719794.1| type I restriction enzyme EcoKI subunit R [Shewanella oneidensis
           MR-1]
 gi|24350694|gb|AAN57238.1|AE015859_7 type I restriction-modification system, R subunit [Shewanella
           oneidensis MR-1]
          Length = 1188

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 29/65 (44%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I F+     +D    + +   +   + +  + +RIEGNKA H+ ++  +E+ E L+   
Sbjct: 65  GIEFDDKTTQADLLFKINRELTLEPVVRQLFHALRIEGNKATHQFRTQHKEALEGLKLAR 124

Query: 68  LFCDI 72
                
Sbjct: 125 SLAIW 129


>gi|217971401|ref|YP_002356152.1| Sel1 domain-containing protein repeat-containing protein
           [Shewanella baltica OS223]
 gi|217496536|gb|ACK44729.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS223]
          Length = 491

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 20/47 (42%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
            L DR   L Q  +I  +     + +R +GN+  H  +  + ++   
Sbjct: 65  NLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEKYHLTQAQLL 111


>gi|163748777|ref|ZP_02156029.1| hypothetical protein KT99_02547 [Shewanella benthica KT99]
 gi|161331551|gb|EDQ02356.1| hypothetical protein KT99_02547 [Shewanella benthica KT99]
          Length = 472

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 28/76 (36%), Gaps = 4/76 (5%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
            L DR   L    +I   I    + +R +GN+  H  +  +  +++  +      + +  
Sbjct: 60  NLYDRIETLNNKRVIDVRITRALHRLRGDGNRGAHPEKYHL-TAEQLQQLSEKSIEKLL- 117

Query: 76  LPALIKEKKSTHPNQS 91
              LI+        +S
Sbjct: 118 --KLIESLFKQVTGES 131


>gi|282900741|ref|ZP_06308683.1| hypothetical protein CRC_02103 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194541|gb|EFA69496.1| hypothetical protein CRC_02103 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 190

 Score = 43.4 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE--GQSSIEESDECLEFVNLFC 70
           +   L ++   ++Q  +I   ++ W++ +R++     HE     +  ++ + +E  +L  
Sbjct: 112 EGNSLKEKLEIMRQQEIINHHLYSWASNLRLQ--DLSHEVDINFNQNDAQQIVELTDLLI 169

Query: 71  DIVFTLPALIKEKKSTH 87
           + +F      +  K T 
Sbjct: 170 EYIFRYRKNFELFKKTK 186


>gi|120600671|ref|YP_965245.1| Sel1 domain-containing protein [Shewanella sp. W3-18-1]
 gi|146291428|ref|YP_001181852.1| Sel1 domain-containing protein [Shewanella putrefaciens CN-32]
 gi|120560764|gb|ABM26691.1| Sel1 domain protein repeat-containing protein [Shewanella sp.
           W3-18-1]
 gi|145563118|gb|ABP74053.1| Sel1 domain protein repeat-containing protein [Shewanella
           putrefaciens CN-32]
          Length = 484

 Score = 43.4 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
            L DR   L Q  LI  +     + +R +GN+  H  +  + + ++ L         V T
Sbjct: 65  NLYDRIEQLNQKRLIDVKTTRALHRLRADGNRGAHPEKYHLTQ-EQLLALAQKTIKDVLT 123

Query: 76  L 76
           L
Sbjct: 124 L 124


>gi|319428341|gb|ADV56415.1| Sel1 domain protein repeat-containing protein [Shewanella
           putrefaciens 200]
          Length = 484

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
            L DR   L Q  LI  +     + +R +GN+  H  +  + + ++ L         V T
Sbjct: 65  NLYDRIEQLNQKRLIDVKTTRALHRLRADGNRGAHPEKYHLTQ-EQLLALAQKTIKDVLT 123

Query: 76  L 76
           L
Sbjct: 124 L 124


>gi|153002642|ref|YP_001368323.1| Sel1 domain-containing protein [Shewanella baltica OS185]
 gi|151367260|gb|ABS10260.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS185]
          Length = 491

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 20/47 (42%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
            L DR   L Q  +I  +     + +R +GN+  H  +  + ++   
Sbjct: 65  NLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEKYHLTQAQLL 111


>gi|317486935|ref|ZP_07945745.1| type III restriction enzyme [Bilophila wadsworthia 3_1_6]
 gi|316921810|gb|EFV43086.1| type III restriction enzyme [Bilophila wadsworthia 3_1_6]
          Length = 1089

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVN 67
           I   +     +R   L++   +  ++    + +R   NKA HEG +    +    L+  +
Sbjct: 54  ITLPEHCDAVERIDILQRREALPADVAAAFHLMRRVRNKAAHEGLRLPEAKILYFLQITH 113

Query: 68  LFCDIVFT 75
             C+  F 
Sbjct: 114 SLCEWFFQ 121


>gi|160877378|ref|YP_001556694.1| Sel1 domain-containing protein [Shewanella baltica OS195]
 gi|160862900|gb|ABX51434.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS195]
 gi|315269581|gb|ADT96434.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS678]
          Length = 491

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 20/47 (42%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
            L DR   L Q  +I  +     + +R +GN+  H  +  + ++   
Sbjct: 65  NLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEKYHLTQAQLL 111


>gi|113972081|ref|YP_735874.1| Sel1 domain-containing protein [Shewanella sp. MR-4]
 gi|113886765|gb|ABI40817.1| Sel1 domain protein repeat-containing protein [Shewanella sp. MR-4]
          Length = 485

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 30/71 (42%), Gaps = 8/71 (11%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE------SDECLEFVNLF 69
            L DR   L Q  LI  +     + +R +GN+  H  +  + +      + + ++ V   
Sbjct: 65  NLYDRIELLNQKRLIDVKTTRALHRLRGDGNRGAHPEKYHLTQEQLLALAQKAIKDVLAL 124

Query: 70  CDIVFTLPALI 80
            + ++  P +I
Sbjct: 125 IEHLY--PKVI 133


>gi|323526113|ref|YP_004228266.1| Type I site-specific deoxyribonuclease [Burkholderia sp. CCGE1001]
 gi|323383115|gb|ADX55206.1| Type I site-specific deoxyribonuclease [Burkholderia sp. CCGE1001]
          Length = 1117

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 8/61 (13%), Positives = 20/61 (32%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           E     +     L+    +  +  +  +++R  GN A H+       + + L+       
Sbjct: 60  EGEDNQAALLSRLRGAGWLPGDSADLFHWLRKAGNAANHQFSGDHRAALQGLKIATQLGY 119

Query: 72  I 72
            
Sbjct: 120 W 120


>gi|297190776|ref|ZP_06908174.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197722557|gb|EDY66465.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 479

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 9/65 (13%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT- 75
           +S     L +  ++   +   ++++R   N + H G+ +++ ++          + +   
Sbjct: 365 ISSAIEELSKFGVMPTRVTAAAHWLRNLRNDSAHRGREAVQYAETAYGLTVEILEWLHQE 424

Query: 76  LPALI 80
           LP L+
Sbjct: 425 LPRLL 429


>gi|304412306|ref|ZP_07393914.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS183]
 gi|307306090|ref|ZP_07585835.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           BA175]
 gi|304349341|gb|EFM13751.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           OS183]
 gi|306910963|gb|EFN41390.1| Sel1 domain protein repeat-containing protein [Shewanella baltica
           BA175]
          Length = 491

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 20/47 (42%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
            L DR   L Q  +I  +     + +R EGN+  H  +  + ++   
Sbjct: 65  NLYDRIEQLNQQRVIDVKTTRALHRLRAEGNRGAHPEKYHLTQAQLL 111


>gi|157373391|ref|YP_001471991.1| Sel1 domain-containing protein [Shewanella sediminis HAW-EB3]
 gi|157315765|gb|ABV34863.1| Sel1 domain protein repeat-containing protein [Shewanella sediminis
           HAW-EB3]
          Length = 472

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 30/69 (43%), Gaps = 2/69 (2%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
           RI F+    L DR   L +  +I        + +R +GN+  H  +  +  S++ LE   
Sbjct: 53  RITFD-SPNLYDRIEMLNRKRVINVRTTRALHKLRGDGNRGAHPEKYHL-TSEQLLELSE 110

Query: 68  LFCDIVFTL 76
              + + +L
Sbjct: 111 KSIEKLLSL 119


>gi|24376033|ref|NP_720076.1| hypothetical protein SO_4559 [Shewanella oneidensis MR-1]
 gi|24351041|gb|AAN57520.1|AE015888_4 conserved domain protein [Shewanella oneidensis MR-1]
          Length = 484

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 35/85 (41%), Gaps = 8/85 (9%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE------SDECLEFVNLF 69
            L DR   L Q  LI  +     + +R +GN+  H  +  + +      + + ++ V   
Sbjct: 65  NLYDRIELLNQKRLIDVKTTRALHRLRGDGNRGAHPEKYHLTQEQLLALAQKAIKDVLAL 124

Query: 70  CDIVFTLPALIKEKKSTHPNQSRDG 94
            + ++  P ++  +   +  Q+ D 
Sbjct: 125 VEHLY--PKVVGSEAPAYRFQASDA 147


>gi|114049311|ref|YP_739861.1| Sel1 domain-containing protein [Shewanella sp. MR-7]
 gi|113890753|gb|ABI44804.1| Sel1 domain protein repeat-containing protein [Shewanella sp. MR-7]
          Length = 485

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 34/85 (40%), Gaps = 8/85 (9%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE------SDECLEFVNLF 69
            L DR   L Q  LI  +     + +R +GN+  H  +  + +      + + ++ V   
Sbjct: 65  NLYDRIELLNQKRLIDVKTTRALHRLRGDGNRGAHPEKYHLTQEQLLALAQKAIKDVLAL 124

Query: 70  CDIVFTLPALIKEKKSTHPNQSRDG 94
            + ++  P ++      +  Q+ D 
Sbjct: 125 IEHLY--PKVVGRAAPAYRYQASDA 147


>gi|282897432|ref|ZP_06305434.1| hypothetical protein CRD_02356 [Raphidiopsis brookii D9]
 gi|281198084|gb|EFA72978.1| hypothetical protein CRD_02356 [Raphidiopsis brookii D9]
          Length = 190

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 9/75 (12%), Positives = 33/75 (44%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
           +   L ++   ++Q  +I   ++ W++ ++++      +   +  ++ + +E  +L  + 
Sbjct: 112 EGNSLKEKLEIMRQQEIINHHLYNWASNLKLQDLSCDVDINFNQNDAQQIVELTDLVIEY 171

Query: 73  VFTLPALIKEKKSTH 87
           +F      +  K T 
Sbjct: 172 IFRYRKNFELFKKTK 186


>gi|293609935|ref|ZP_06692237.1| predicted protein [Acinetobacter sp. SH024]
 gi|292828387|gb|EFF86750.1| predicted protein [Acinetobacter sp. SH024]
          Length = 1147

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE--- 64
           ++       L +    LK  +LI   I++  + +R+ GN AVH  +     ++E ++   
Sbjct: 53  KLTQPYDASLHNLLNDLKFKDLIPPYIWDKMDNIRMVGNSAVHGKKFKQLTTEETVKHIS 112

Query: 65  ---FVNLFCDIVFTLPAL 79
               + ++ +  +  P+ 
Sbjct: 113 HLFLMYVWFERNYGSPSK 130


>gi|262371156|ref|ZP_06064477.1| type I site-specific deoxyribonuclease R [Acinetobacter johnsonii
           SH046]
 gi|262313886|gb|EEY94932.1| type I site-specific deoxyribonuclease R [Acinetobacter johnsonii
           SH046]
          Length = 1146

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE--- 64
           ++       L +    LK  +LI   I++  + +R+ GN AVH  +     ++E ++   
Sbjct: 53  KLTQPYDASLHNLLNDLKFKDLIPPYIWDKMDNIRMVGNSAVHGKKFKQLTTEETVKHIS 112

Query: 65  ---FVNLFCDIVFTLPAL 79
               + ++ +  +  P+ 
Sbjct: 113 HLFLMYVWFERNYGSPSK 130


>gi|237807923|ref|YP_002892363.1| type III restriction protein res subunit [Tolumonas auensis DSM
           9187]
 gi|237500184|gb|ACQ92777.1| type III restriction protein res subunit [Tolumonas auensis DSM
           9187]
          Length = 1123

 Score = 42.7 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 11/65 (16%), Positives = 24/65 (36%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNL 68
           +         D  +     N+    + +  +F+R EGN   H G  S++++   L   + 
Sbjct: 56  LPKPPTANFMDLLKNDAFVNITESRLRDLLHFLRKEGNDTAHGGDGSLDKAFAALGVAHQ 115

Query: 69  FCDIV 73
               +
Sbjct: 116 LGQYM 120


>gi|289664158|ref|ZP_06485739.1| type I restriction enzyme EcoKI subunit R [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 1183

 Score = 42.3 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I  ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+   
Sbjct: 81  GIIHDQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVAR 140

Query: 68  LFCDI 72
                
Sbjct: 141 DLAVW 145


>gi|310765337|gb|ADP10287.1| type I restriction-modification system, R subunit [Erwinia sp.
           Ejp617]
          Length = 180

 Score = 42.3 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 25/65 (38%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I  E      +    L +       I +  + +R+EGN+A H+ Q+   E+ + L+   
Sbjct: 60  NIATEGNPSQQELLYRLDRELQFDPAIRQLFHTLRLEGNRATHQFQTPHREAMDALKIAR 119

Query: 68  LFCDI 72
                
Sbjct: 120 ALAIW 124


>gi|289667523|ref|ZP_06488598.1| type I restriction enzyme EcoKI subunit R [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 1183

 Score = 42.3 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I  ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+   
Sbjct: 81  GIIHDQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVAR 140

Query: 68  LFCDI 72
                
Sbjct: 141 DLAVW 145


>gi|224368578|ref|YP_002602741.1| HsdR1 [Desulfobacterium autotrophicum HRM2]
 gi|223691294|gb|ACN14577.1| HsdR1 [Desulfobacterium autotrophicum HRM2]
          Length = 1132

 Score = 42.3 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 22/68 (32%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            +       L+D          +   I    + +R  GNKA H    S  E+ + ++  +
Sbjct: 59  ELPRPYQPSLNDLLNNHVFKAAVPPVILNTLHIIRKSGNKAAHGADISQNEALKLVKDAH 118

Query: 68  LFCDIVFT 75
                 + 
Sbjct: 119 HLSRWFYV 126


>gi|57790373|gb|AAW56115.1| Cj81-034 [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 108

 Score = 42.3 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 32  EEIFEWSNFVRIEGNKAVHEGQSSIEE----SDECLEFVNLFCDIVFTLPALIKEKKSTH 87
           E + E  N +R+ GNKA H  +  I +    ++   E +N     + T P   +E+ +  
Sbjct: 41  ESLEEAMNSIRLIGNKASHPSELDINDNSEIANILFEMINFIVGEIITKPKEREERLNKL 100


>gi|117922384|ref|YP_871576.1| Sel1 domain-containing protein [Shewanella sp. ANA-3]
 gi|117614716|gb|ABK50170.1| Sel1 domain protein repeat-containing protein [Shewanella sp.
           ANA-3]
          Length = 485

 Score = 42.3 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 27/65 (41%), Gaps = 6/65 (9%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE------SDECLEFVNLF 69
            L DR   L Q  LI  +     + +R +GN+  H  +  + +      + + ++ V   
Sbjct: 65  NLYDRIELLNQKRLIDVKTTRALHRLRGDGNRGAHPEKYHLTQEQLLALAQKAIKDVLAL 124

Query: 70  CDIVF 74
            + ++
Sbjct: 125 IEHLY 129


>gi|325926903|ref|ZP_08188184.1| helicase, type I site-specific restriction-modification system
           restriction subunit [Xanthomonas perforans 91-118]
 gi|325926914|ref|ZP_08188195.1| helicase, type I site-specific restriction-modification system
           restriction subunit [Xanthomonas perforans 91-118]
 gi|325542719|gb|EGD14180.1| helicase, type I site-specific restriction-modification system
           restriction subunit [Xanthomonas perforans 91-118]
 gi|325542730|gb|EGD14191.1| helicase, type I site-specific restriction-modification system
           restriction subunit [Xanthomonas perforans 91-118]
          Length = 1157

 Score = 41.9 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I  ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+   
Sbjct: 55  GIIHDQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVAR 114

Query: 68  LFCDI 72
                
Sbjct: 115 DLAVW 119


>gi|146281030|ref|YP_001171183.1| type I restriction enzyme EcoKI subunit R [Pseudomonas stutzeri
           A1501]
 gi|145569235|gb|ABP78341.1| type I restriction-modification system, R subunit [Pseudomonas
           stutzeri A1501]
          Length = 1157

 Score = 41.9 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 25/57 (43%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
             SD    L +   + + I    + +R+EGN+A HE ++   E+ + L+        
Sbjct: 62  TQSDLLYKLSREIQLDQNIRSLFHTLRVEGNRATHEFRTQHREAMDGLKVARALAIW 118


>gi|153828455|ref|ZP_01981122.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|148876006|gb|EDL74141.1| conserved hypothetical protein [Vibrio cholerae 623-39]
          Length = 257

 Score = 41.9 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEFVNLFCDIV 73
             L ++   L + +++ +E  +    +R  GN+A HE +   EE     ++ ++   +  
Sbjct: 183 RNLYEKIDSLHKMSVVTKEGSDTLQKLRGLGNEAAHEVKPQSEEQLYTAMQIIDHMLEGT 242

Query: 74  FTLPALIKEKKSTH 87
           + +P  + +     
Sbjct: 243 YIIPKQVLQIFGAE 256


>gi|332087171|gb|EGI92305.1| type III restriction enzyme, res subunit domain protein [Shigella
           boydii 3594-74]
          Length = 345

 Score = 41.9 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|226951286|ref|ZP_03821750.1| type III restriction protein res subunit [Acinetobacter sp. ATCC
           27244]
 gi|226837959|gb|EEH70342.1| type III restriction protein res subunit [Acinetobacter sp. ATCC
           27244]
          Length = 1124

 Score = 41.9 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE--- 64
           ++       L +    LK  +LI   I++  + +R+ GN AVH  +     ++E ++   
Sbjct: 53  KLTQPYDPSLHNLLNDLKFKDLIPPYIWDKMDNIRMVGNSAVHGKKFKQLTTEETVKHIS 112

Query: 65  ---FVNLFCDIVFTLPAL 79
               + ++ +  +  P+ 
Sbjct: 113 HLFLMYVWFERNYGSPSK 130


>gi|166711008|ref|ZP_02242215.1| type I restriction enzyme EcoKI subunit R [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 1183

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 25/61 (40%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+       
Sbjct: 85  DQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVARDLAV 144

Query: 72  I 72
            
Sbjct: 145 W 145


>gi|58583084|ref|YP_202100.1| type I restriction enzyme EcoKI subunit R [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58427678|gb|AAW76715.1| type I restriction-modification system, R subunit [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 1190

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 25/61 (40%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+       
Sbjct: 85  DQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVARDLAV 144

Query: 72  I 72
            
Sbjct: 145 W 145


>gi|84624923|ref|YP_452295.1| type I restriction enzyme EcoKI subunit R [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|84368863|dbj|BAE70021.1| type I restriction-modification system R subunit [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
          Length = 1183

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 25/61 (40%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+       
Sbjct: 85  DQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVARDLAV 144

Query: 72  I 72
            
Sbjct: 145 W 145


>gi|188577913|ref|YP_001914842.1| type I restriction enzyme EcoKI subunit R [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188522365|gb|ACD60310.1| type I restriction enzyme EcoKI R protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 1157

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 25/61 (40%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCD 71
           ++    +D    L +   +   I E  + +R+EGNKA H   +   E+ + L+       
Sbjct: 59  DQRTTQADLIYQLARELRLDRRIQELFHVLRVEGNKATHGFTTQHREAMDGLKVARDLAV 118

Query: 72  I 72
            
Sbjct: 119 W 119


>gi|283476979|emb|CAY72868.1| type I restriction-modification system, R subunit [Erwinia
           pyrifoliae DSM 12163]
          Length = 180

 Score = 41.5 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 25/65 (38%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I  E      +    L +       I +  + +R+EGN+A H+ Q+   E+ + L+   
Sbjct: 60  NIATEGNPSQQELLYRLDRELQFDPAIRQLFHTLRLEGNRATHQFQTPHREAMDALKIAR 119

Query: 68  LFCDI 72
                
Sbjct: 120 ALAIW 124


>gi|190890128|ref|YP_001976670.1| hypothetical protein RHECIAT_CH0000499 [Rhizobium etli CIAT 652]
 gi|190695407|gb|ACE89492.1| hypothetical protein RHECIAT_CH0000499 [Rhizobium etli CIAT 652]
          Length = 260

 Score = 41.5 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 28/73 (38%), Gaps = 1/73 (1%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDECLE 64
            + +  +       +   +   NLI +   E  + +   GN + H G +    +    ++
Sbjct: 147 AEILGVDPSKNFQRKLDEMVSKNLIRQSEREHLDVLINAGNASAHRGWTPSFSDLSTLMD 206

Query: 65  FVNLFCDIVFTLP 77
            +  F + VF +P
Sbjct: 207 TLESFLNDVFIVP 219


>gi|291561999|emb|CBL40811.1| hypothetical protein CK3_10600 [butyrate-producing bacterium SS3/4]
          Length = 512

 Score = 41.5 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query: 3   DDQGQRINFEKCGMLSDRTR-------YLKQHNLIIEEIFEW-SNFVRIEGNKAVHEGQS 54
           D +GQR  +   G    R         +L ++  +   + +W  N +R+ GNKAVHE   
Sbjct: 96  DGRGQRETYRMNGRKRQRVMTFQQFGWWLDENGYLD-RVGKWELNEIRVIGNKAVHENYV 154

Query: 55  SIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94
           S E++     ++     IV    A  ++++     +S+ G
Sbjct: 155 SKEDAWNQYNYMEDVLRIVADHHANRRKQRGPAVKKSQTG 194


>gi|157963771|ref|YP_001503805.1| Sel1 domain-containing protein [Shewanella pealeana ATCC 700345]
 gi|157848771|gb|ABV89270.1| Sel1 domain protein repeat-containing protein [Shewanella pealeana
           ATCC 700345]
          Length = 473

 Score = 41.1 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 22/65 (33%), Gaps = 10/65 (15%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----------QSSIEESDECLEF 65
            L DR   L QH LI  +     + +R +GN+  H            Q S     + L  
Sbjct: 60  NLYDRIEQLNQHRLINVKTTRALHKLRADGNRGAHPEKYHLTPEQLQQLSERSIKQLLSL 119

Query: 66  VNLFC 70
           V    
Sbjct: 120 VESLF 124


>gi|251791237|ref|YP_003005958.1| type I restriction enzyme EcoKI subunit R [Dickeya zeae Ech1591]
 gi|247539858|gb|ACT08479.1| type III restriction protein res subunit [Dickeya zeae Ech1591]
          Length = 1174

 Score = 41.1 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 28/65 (43%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            I F++     D    L +   +   + E  + +R+EGN+A H  ++  +E+ + L+   
Sbjct: 60  GITFDEKTKQVDLLYQLNRELQLEPTVRELFHILRMEGNRATHHFRTQHKEAMDGLKVAR 119

Query: 68  LFCDI 72
                
Sbjct: 120 SLAIW 124


>gi|124514611|gb|EAY56123.1| conserved hypothetical protein [Leptospirillum rubarum]
          Length = 209

 Score = 41.1 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 30/88 (34%), Gaps = 13/88 (14%)

Query: 13  KCGMLSDRTRYLKQHN----LIIEEIFEWSNFVRIEGNKAVHEGQS---------SIEES 59
           K   L+     L   +     I E +    + +R  GN + H                E+
Sbjct: 109 KNHDLAKEIDLLLNESDPRKAIPESLRNTIDGIRNFGNFSAHPITDLTSLQIIDVEPHEA 168

Query: 60  DECLEFVNLFCDIVFTLPALIKEKKSTH 87
           + CL+ V       +  PAL K++K   
Sbjct: 169 EWCLDIVEEMFQHYYVRPALAKKRKDDL 196


>gi|332289276|ref|YP_004420128.1| type I restriction enzyme EcoKI subunit R [Gallibacterium anatis
           UMN179]
 gi|330432172|gb|AEC17231.1| type I restriction enzyme EcoKI subunit R [Gallibacterium anatis
           UMN179]
          Length = 1114

 Score = 41.1 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 9/72 (12%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC----- 62
           RI        +DR + LKQ   +  EI    +F++  GN+AVHEG    ++         
Sbjct: 52  RIALPDQTTQNDRLKLLKQAR-LDREILAMLHFLKNAGNEAVHEGAEDQQKLVTAMLAAW 110

Query: 63  ---LEFVNLFCD 71
              + FV  F D
Sbjct: 111 QISIWFVRTFAD 122


>gi|190151422|ref|YP_001974333.1| hypothetical protein phiPH15_gp07 [Streptococcus phage PH15]
 gi|190014416|emb|CAQ57802.1| hypothetical protein [Streptococcus phage PH15]
          Length = 226

 Score = 40.7 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%), Gaps = 9/67 (13%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEESDECLEFVNLF 69
           L D    LK+  L+     +  + +R  GN   H  +           E+ + L+F+ L 
Sbjct: 135 LVDEIDALKE--LVDPSTKKVLDALRKLGNIGAHPEKDINLIVDIEPNEAHKLLKFIELL 192

Query: 70  CDIVFTL 76
               +  
Sbjct: 193 MQKWYIE 199


>gi|282901533|ref|ZP_06309455.1| TPR repeat protein [Cylindrospermopsis raciborskii CS-505]
 gi|281193576|gb|EFA68551.1| TPR repeat protein [Cylindrospermopsis raciborskii CS-505]
          Length = 1280

 Score = 40.7 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 23/58 (39%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
              +D    L+   ++ +++    + VR+  ++A +E  S   ++   L+        
Sbjct: 64  ENQADLLNQLELKGILPQKVALLFHQVRVVSDRAAYEYTSDSSQALTILKIARELAIW 121


>gi|254481742|ref|ZP_05094985.1| Type III restriction enzyme, res subunit family [marine gamma
           proteobacterium HTCC2148]
 gi|214037871|gb|EEB78535.1| Type III restriction enzyme, res subunit family [marine gamma
           proteobacterium HTCC2148]
          Length = 1165

 Score = 40.7 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 27/69 (39%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +   +         DR       +++   I +  + +R EGNKA HEG+     S   L+
Sbjct: 57  REWSLPCYPNDKFIDRLENNAFASVVDTAIIDKLHAIRKEGNKAAHEGKFGKGSSLWLLK 116

Query: 65  FVNLFCDIV 73
             ++    +
Sbjct: 117 ESHILASWL 125


>gi|312965801|ref|ZP_07780027.1| type III restriction enzyme, res subunit [Escherichia coli 2362-75]
 gi|312289044|gb|EFR16938.1| type III restriction enzyme, res subunit [Escherichia coli 2362-75]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|323495599|ref|ZP_08100672.1| SecC motif-containing protein [Vibrio sinaloensis DSM 21326]
 gi|323319331|gb|EGA72269.1| SecC motif-containing protein [Vibrio sinaloensis DSM 21326]
          Length = 556

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 17/42 (40%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE 58
           L D    LK       EI    + +R+ GN+A H  Q    E
Sbjct: 63  LYDLVEKLKSTGEFNSEIVNSLHQIRLNGNRAAHPEQFPKRE 104


>gi|167630082|ref|YP_001680581.1| hypothetical protein HM1_2013 [Heliobacterium modesticaldum Ice1]
 gi|167592822|gb|ABZ84570.1| hypothetical protein HM1_2013 [Heliobacterium modesticaldum Ice1]
          Length = 221

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 27/72 (37%), Gaps = 9/72 (12%)

Query: 31  IEEIFEWSNFVRIEGNKAVHEGQ---------SSIEESDECLEFVNLFCDIVFTLPALIK 81
            E I    + VR  GN A H  +          +++E+   LE ++   +     P    
Sbjct: 143 PEYIKNSIDAVRNVGNFAAHPLKEKTTDIIVDVTVDEAKWLLEIIDALIEYSIVRPTKDN 202

Query: 82  EKKSTHPNQSRD 93
           E+K    ++  +
Sbjct: 203 ERKKKLNDKLSN 214


>gi|72536281|gb|AAZ73196.1| hypothetical protein [Escherichia coli]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|320177257|gb|EFW52264.1| Type I restriction-modification system, restriction subunit R
           [Shigella dysenteriae CDC 74-1112]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|309704074|emb|CBJ03420.1| endonuclease R [Escherichia coli ETEC H10407]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|307312948|ref|ZP_07592576.1| type III restriction protein res subunit [Escherichia coli W]
 gi|306907116|gb|EFN37623.1| type III restriction protein res subunit [Escherichia coli W]
 gi|315063583|gb|ADT77910.1| type III restriction enzyme, res subunit [Escherichia coli W]
 gi|323380336|gb|ADX52604.1| type III restriction protein res subunit [Escherichia coli KO11]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|300925835|ref|ZP_07141683.1| DEAD/DEAH box helicase [Escherichia coli MS 182-1]
 gi|300418087|gb|EFK01398.1| DEAD/DEAH box helicase [Escherichia coli MS 182-1]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|331669723|ref|ZP_08370569.1| type I restriction-modification system, R subunit [Escherichia coli
           TA271]
 gi|331063391|gb|EGI35304.1| type I restriction-modification system, R subunit [Escherichia coli
           TA271]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|330907936|gb|EGH36455.1| type 1 restriction-modification system, restriction subunit R
           [Escherichia coli AA86]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|82546466|ref|YP_410413.1| type I restriction enzyme R protein [Shigella boydii Sb227]
 gi|81247877|gb|ABB68585.1| putative type I restriction enzyme R protein [Shigella boydii
           Sb227]
 gi|320185253|gb|EFW60030.1| Type I restriction-modification system, restriction subunit R
           [Shigella flexneri CDC 796-83]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|187730438|ref|YP_001882945.1| type III restriction enzyme, res subunit [Shigella boydii CDC
           3083-94]
 gi|187427430|gb|ACD06704.1| type III restriction enzyme, res subunit [Shigella boydii CDC
           3083-94]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|194448462|ref|YP_002048346.1| type III restriction enzyme, res subunit [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194406766|gb|ACF66985.1| type III restriction enzyme, res subunit [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
          Length = 1137

 Score = 40.7 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|331678992|ref|ZP_08379664.1| type I restriction-modification system, R subunit [Escherichia coli
           H591]
 gi|331073057|gb|EGI44380.1| type I restriction-modification system, R subunit [Escherichia coli
           H591]
          Length = 1137

 Score = 40.3 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGIWLYVR 123


>gi|288559579|ref|YP_003423065.1| dnd system-associated protein 3 [Methanobrevibacter ruminantium M1]
 gi|288542289|gb|ADC46173.1| dnd system-associated protein 3 [Methanobrevibacter ruminantium M1]
          Length = 749

 Score = 40.3 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE-SDECLEFVNLFCDIVFT 75
              R   L    +I  +I++  N +R   NKAVH   S IE+ ++    ++ L C   + 
Sbjct: 64  QKKRLEMLGYKGIISYDIYKRLNHIRKIRNKAVHGHLSDIEDNANILHAYLYLICAYFYK 123

Query: 76  L 76
            
Sbjct: 124 E 124


>gi|226952349|ref|ZP_03822813.1| type I site-specific deoxyribonuclease protein R [Acinetobacter sp.
           ATCC 27244]
 gi|226836901|gb|EEH69284.1| type I site-specific deoxyribonuclease protein R [Acinetobacter sp.
           ATCC 27244]
          Length = 996

 Score = 40.3 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE--- 64
           ++       L +    +K  +LI   I++  + +R+ GN AVH  +     ++E ++   
Sbjct: 53  KLTQPYDASLHNLLNDIKFKDLIPPYIWDKMDNIRMVGNSAVHGKKFKQLTTEETVKHIS 112

Query: 65  ---FVNLFCDIVFTLPAL 79
               + ++ +  +  P+ 
Sbjct: 113 HLFLMYVWFERNYGSPSK 130


>gi|148252799|ref|YP_001237384.1| hypothetical protein BBta_1238 [Bradyrhizobium sp. BTAi1]
 gi|146404972|gb|ABQ33478.1| hypothetical protein BBta_1238 [Bradyrhizobium sp. BTAi1]
          Length = 1131

 Score = 40.3 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 10/72 (13%), Positives = 25/72 (34%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +  R+         D  +     ++  + + +  + +RI GNKA H   +  +     L+
Sbjct: 51  RDLRLPKPDQPTFVDLLKNAAFASVTPKVVLDKLHALRIHGNKAAHGDDARTQNVLWLLK 110

Query: 65  FVNLFCDIVFTL 76
             +     +   
Sbjct: 111 EAHDLARWLLVQ 122


>gi|114568714|ref|YP_755394.1| type III restriction enzyme, res subunit [Maricaulis maris MCS10]
 gi|114339176|gb|ABI64456.1| type III restriction enzyme, res subunit [Maricaulis maris MCS10]
          Length = 1137

 Score = 40.3 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 28/72 (38%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           +  R+  E      D        + I   + +  + +R+ GNKA H  Q++I+ +   L+
Sbjct: 51  RDLRLPREDRMSFVDMLGGSAFQSAIPRVVIDKLHAIRVHGNKAAHGEQATIKTALFLLK 110

Query: 65  FVNLFCDIVFTL 76
             +     +   
Sbjct: 111 EAHGLARWLLVA 122


>gi|308047791|ref|YP_003911357.1| Sel1 domain protein repeat-containing protein [Ferrimonas
          balearica DSM 9799]
 gi|307629981|gb|ADN74283.1| Sel1 domain protein repeat-containing protein [Ferrimonas
          balearica DSM 9799]
          Length = 484

 Score = 40.3 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 6  GQRINFE-KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE 51
          G+R   E     L DR   L +  +I   +    + +R +GNK  H 
Sbjct: 48 GERAELEFHSKNLYDRIEQLARAKVIDMRLARKLHKLRGDGNKGAHP 94


>gi|110598785|ref|ZP_01387045.1| hypothetical protein CferDRAFT_0134 [Chlorobium ferrooxidans DSM
           13031]
 gi|110339612|gb|EAT58127.1| hypothetical protein CferDRAFT_0134 [Chlorobium ferrooxidans DSM
           13031]
          Length = 372

 Score = 40.3 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-ESDEC 62
           ++ + +N  +    + +   + Q  LI E+IF      R   N+ +H GQS  + E +  
Sbjct: 229 NRKRALNDYRTWTSATKIELIYQKGLIDEDIFRHFTVSRSSRNRFLHNGQSPKKSEVESS 288

Query: 63  LEFVNLFCDIVFTLPALIKEK 83
           +  V     +V+T     +E 
Sbjct: 289 ISLVMQLISLVYTQFKNKEEL 309


>gi|84390141|ref|ZP_00991403.1| type I restriction-modification system, R subunit [Vibrio
           splendidus 12B01]
 gi|84376795|gb|EAP93670.1| type I restriction-modification system, R subunit [Vibrio
           splendidus 12B01]
          Length = 1167

 Score = 40.3 bits (93), Expect = 0.093,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 35/100 (35%), Gaps = 12/100 (12%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
            + +         D+ + L     + +E     + +R  GNKA H   ++   ++  LE 
Sbjct: 50  AELVKLAPNLSTFDQLKELGSRGFLDDERLTIFHALRKHGNKAAHGYYNNPVAAEHALEI 109

Query: 66  VN---------LFCDIVFTLPAL---IKEKKSTHPNQSRD 93
            +            +  F  P     ++E+ +    QS+ 
Sbjct: 110 SHKAATIYYRVKTGEANFQPPKYVPPVEEETAELVEQSKK 149


>gi|326789841|ref|YP_004307662.1| hypothetical protein Clole_0731 [Clostridium lentocellum DSM 5427]
 gi|326540605|gb|ADZ82464.1| hypothetical protein Clole_0731 [Clostridium lentocellum DSM 5427]
          Length = 225

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 23/67 (34%), Gaps = 9/67 (13%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEESDECLEFVN 67
           G L D    L  +  I  +++   + +R  GN   H  +           E++  +  + 
Sbjct: 134 GSLYDEISEL--NGKIPADLWSALDGLRKLGNIGAHMEKDTSVIIDIDPSEAENLIVLIE 191

Query: 68  LFCDIVF 74
           L     +
Sbjct: 192 LLMKEWY 198


>gi|32469438|ref|NP_862846.1| gp7 [Streptococcus phage SM1]
 gi|32441590|gb|AAP81889.1| gp7 [Streptococcus phage SM1]
          Length = 226

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%), Gaps = 9/67 (13%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEESDECLEFVNLF 69
           L D    LK  +L+     +  + +R  GN   H  +           E+ + L+F+ L 
Sbjct: 135 LVDEIDALK--DLVDPSTKKVLDALRKLGNIGAHPEKDINLIVDIESHEAQKLLKFIELL 192

Query: 70  CDIVFTL 76
               +  
Sbjct: 193 MQKWYIE 199


>gi|145638504|ref|ZP_01794113.1| hypothetical protein CGSHiII_07316 [Haemophilus influenzae PittII]
 gi|145272099|gb|EDK12007.1| hypothetical protein CGSHiII_07316 [Haemophilus influenzae PittII]
          Length = 715

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 28/72 (38%), Gaps = 2/72 (2%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS--IEESDEC 62
           +   I+ +    L D+ +       I  EI    + +R++GNKA H    +   EE    
Sbjct: 51  KQLHISIDYNENLLDKMKNPVFIENIPNEILTKLHLLRMKGNKAAHGEVINYKQEELLNL 110

Query: 63  LEFVNLFCDIVF 74
           L+   L     +
Sbjct: 111 LKETYLLGKWFY 122


>gi|170724619|ref|YP_001758645.1| Sel1 domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169809966|gb|ACA84550.1| Sel1 domain protein repeat-containing protein [Shewanella woodyi
           ATCC 51908]
          Length = 471

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 27/84 (32%), Gaps = 12/84 (14%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----------QSSIEESDECLEF 65
            L DR   L    +I   +    + +R +GN+  H            Q S +  +  L  
Sbjct: 60  NLYDRIETLNSRRVINVRVTRAMHKLRGDGNRGAHPEKYHLTSEQLQQLSEKSIERLLSL 119

Query: 66  VNLFCDIVF--TLPALIKEKKSTH 87
           +      V   +LP    E   + 
Sbjct: 120 IESLFVQVTGKSLPKYHFEAFDSL 143


>gi|39935884|ref|NP_948160.1| hypothetical protein RPA2817 [Rhodopseudomonas palustris CGA009]
 gi|39649738|emb|CAE28259.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 17  LSDRTRY-LKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVF 74
           L +R    +K +  ++    +  + +R+ GN   H+   +  +  E  +      D + 
Sbjct: 188 LYNRIEAFIKANGKVVH--QDHLHALRVVGNLGTHKNSLTRSDILEAFQVYEHALDELI 244


>gi|237654257|ref|YP_002890571.1| type I restriction enzyme EcoKI subunit R [Thauera sp. MZ1T]
 gi|237625504|gb|ACR02194.1| type III restriction protein res subunit [Thauera sp. MZ1T]
          Length = 1137

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 17/58 (29%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
            I         D  R L+   ++  E+      VR  GN A H        +   L  
Sbjct: 57  GIYTSPDEKQVDLLRRLQDKGIVPREVGALFAEVRKAGNDANHCLSGDHRTALLGLRL 114


>gi|254430369|ref|ZP_05044072.1| type I restriction-modification system, R subunit [Cyanobium sp.
           PCC 7001]
 gi|197624822|gb|EDY37381.1| type I restriction-modification system, R subunit [Cyanobium sp.
           PCC 7001]
          Length = 1119

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 19/58 (32%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
                  R L+    I  ++ +  + +R  GN+A H+       +   L+        
Sbjct: 60  ETQQALIRRLQLDGQIERDVADLFHNLRRSGNRAAHDLAGDHAMALSNLKIAWQLGLW 117


>gi|145629765|ref|ZP_01785560.1| hypothetical protein CGSHi22121_00347 [Haemophilus influenzae
           22.1-21]
 gi|144978004|gb|EDJ87788.1| hypothetical protein CGSHi22121_00347 [Haemophilus influenzae
           22.1-21]
 gi|309751803|gb|ADO81787.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 921

 Score = 39.6 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 28/72 (38%), Gaps = 2/72 (2%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS--IEESDEC 62
           +   I+ +    L D+ +       I  EI    + +R++GNKA H    +   EE    
Sbjct: 51  KQLHISIDYNENLLDKMKNPVFIENIPNEILTKLHLLRMKGNKAAHGEVINYKQEELLNL 110

Query: 63  LEFVNLFCDIVF 74
           L+   L     +
Sbjct: 111 LKETYLLGKWFY 122


>gi|212637477|ref|YP_002314002.1| Sel1-like repeat protein [Shewanella piezotolerans WP3]
 gi|212558961|gb|ACJ31415.1| Sel1-like repeat protein [Shewanella piezotolerans WP3]
          Length = 469

 Score = 39.6 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 16/36 (44%)

Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE 51
           L DR   L Q  LI  +     + +R +GN+  H 
Sbjct: 60 NLYDRIELLNQRRLIDVKTTRALHKLRTDGNRGAHP 95


>gi|114561477|ref|YP_748990.1| Sel1 domain-containing protein [Shewanella frigidimarina NCIMB
          400]
 gi|114332770|gb|ABI70152.1| Sel1 domain protein repeat-containing protein [Shewanella
          frigidimarina NCIMB 400]
          Length = 502

 Score = 39.6 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE 51
           L DR   L Q  +I        + +R +GN+  H 
Sbjct: 60 NLYDRIEQLNQRRVIDVAAVRALHRLRSDGNRGAHP 95


>gi|149185177|ref|ZP_01863494.1| hypothetical protein ED21_19027 [Erythrobacter sp. SD-21]
 gi|148831288|gb|EDL49722.1| hypothetical protein ED21_19027 [Erythrobacter sp. SD-21]
          Length = 860

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 7/55 (12%), Positives = 23/55 (41%)

Query: 8  RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
           + F+     ++R   L++   +   +      +R  GN+  H  + +  ++++ 
Sbjct: 10 GLTFQTSQTHAERLNLLEKSGFLNRRLLAKLQAIRNFGNRGAHGRKVTTSQAEDL 64


>gi|282897129|ref|ZP_06305131.1| TPR repeat protein [Raphidiopsis brookii D9]
 gi|281197781|gb|EFA72675.1| TPR repeat protein [Raphidiopsis brookii D9]
          Length = 1279

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 24/58 (41%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
              +D  R L+   ++ +++    + VR+  ++A +E  S   ++   L+        
Sbjct: 63  ENQTDLLRQLELKGILPQKVALLFHQVRVVSDRATYEHTSDPSQALTILKIARELAIW 120


>gi|225874789|ref|YP_002756248.1| hypothetical protein ACP_3246 [Acidobacterium capsulatum ATCC
           51196]
 gi|225794583|gb|ACO34673.1| hypothetical protein ACP_3246 [Acidobacterium capsulatum ATCC
           51196]
          Length = 309

 Score = 39.2 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 22  RYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDECLEFVNLFCDIVF 74
           R L + + I  E+    + +R   N A H    +   EE+   L+   L+CD  +
Sbjct: 245 RDLGKED-ITAELTGIFDMIRKTRNDAGHPTGRRVEREEAFALLQLFPLYCDAGY 298


>gi|219883113|ref|YP_002478275.1| hypothetical protein Cyan7425_5314 [Cyanothece sp. PCC 7425]
 gi|219867238|gb|ACL47576.1| hypothetical protein Cyan7425_5314 [Cyanothece sp. PCC 7425]
          Length = 952

 Score = 39.2 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 2/70 (2%)

Query: 7   QRINFEKCGMLSDRTRYL--KQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           Q    ++     +R   +  K    + E I +  + +R  GN A HE + ++ ++   L 
Sbjct: 55  QESIDDESIDQKERLDKIGKKFKRTLDESIIDKFDKLRRLGNSATHEWRGNLRDAGASLR 114

Query: 65  FVNLFCDIVF 74
                    +
Sbjct: 115 DAYEISVWYY 124


>gi|54024734|ref|YP_118976.1| putative restriction-modification system endonuclease [Nocardia
           farcinica IFM 10152]
 gi|54016242|dbj|BAD57612.1| putative restriction-modification system endonuclease [Nocardia
           farcinica IFM 10152]
          Length = 1147

 Score = 39.2 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 28/78 (35%), Gaps = 5/78 (6%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES----- 59
           + Q +       L+ R    K   ++   +    + +R  GN AVH+ +   +++     
Sbjct: 50  RAQNLPEPYKSDLAARIHDGKFVGVVGHALVTKMDLIRRLGNTAVHDAKPVSKDAGHKAL 109

Query: 60  DECLEFVNLFCDIVFTLP 77
            E    ++       T P
Sbjct: 110 AELFHILSWLARTYATQP 127


>gi|167622249|ref|YP_001672543.1| Sel1 domain-containing protein [Shewanella halifaxensis HAW-EB4]
 gi|167352271|gb|ABZ74884.1| Sel1 domain protein repeat-containing protein [Shewanella
           halifaxensis HAW-EB4]
          Length = 474

 Score = 39.2 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 20/65 (30%), Gaps = 10/65 (15%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG----------QSSIEESDECLEF 65
            L DR   L Q  LI  +     + +R +GN+  H            Q S       L  
Sbjct: 60  NLYDRIEQLNQRRLIDVKTTRALHKLRGDGNRGAHPEKYHLTPEQLQQLSERSIKHLLSL 119

Query: 66  VNLFC 70
           V    
Sbjct: 120 VESLF 124


>gi|253991409|ref|YP_003042765.1| hypothetical protein PAU_03936 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782859|emb|CAQ86024.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 1137

 Score = 39.2 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGFKANLYDLMNADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAFLLGVWLYVR 123


>gi|160872958|ref|YP_001556965.1| hypothetical protein Sbal195_4548 [Shewanella baltica OS195]
 gi|160858480|gb|ABX51705.1| conserved hypothetical protein [Shewanella baltica OS195]
          Length = 189

 Score = 38.8 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 18/49 (36%)

Query: 2  KDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH 50
          K+D+   I +   G  S +     +   I +   +  + +R   N   H
Sbjct: 50 KNDELFDIGYAPFGTFSAKIDLAYRVGCINQHTRQSCHILRKIRNDFAH 98


>gi|269121198|ref|YP_003309375.1| hypothetical protein Sterm_2596 [Sebaldella termitidis ATCC 33386]
 gi|268615076|gb|ACZ09444.1| hypothetical protein Sterm_2596 [Sebaldella termitidis ATCC 33386]
          Length = 216

 Score = 38.8 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 13/71 (18%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC-LEF 65
           + +  +K  +  +    +     I + I +  + +R  GN A H+  S  +E  E  ++ 
Sbjct: 131 EAVCVDKGIVSGNLMNKIVNSTFITDNIKKNLHGIRYLGNDATHDFISPKKEDLELTIKI 190

Query: 66  VNLFCDIVFTL 76
           +    + V+ L
Sbjct: 191 LEDILNTVYDL 201


>gi|73669075|ref|YP_305090.1| hypothetical protein Mbar_A1563 [Methanosarcina barkeri str.
           Fusaro]
 gi|72396237|gb|AAZ70510.1| hypothetical protein Mbar_A1563 [Methanosarcina barkeri str.
           Fusaro]
          Length = 227

 Score = 38.4 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 35/90 (38%), Gaps = 11/90 (12%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE---------ESDECL 63
           K G LS      +    +   + E  + +R  GN A H  +S+           E++  L
Sbjct: 130 KPGDLSKEID--EAMQTLPSYLAESIDAIRHIGNFAAHPNKSTSTGQIVDVEIGEAEWAL 187

Query: 64  EFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           + +    D  +  PA+ + KK     + +D
Sbjct: 188 DVLEDLFDFYYVQPAITQRKKDAMNEKLKD 217


>gi|332140036|ref|YP_004425774.1| hypothetical protein MADE_1003140 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550058|gb|AEA96776.1| hypothetical protein MADE_1003140 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 237

 Score = 38.4 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 28/77 (36%), Gaps = 6/77 (7%)

Query: 4   DQGQRINFEKCG---MLSDRTRYLKQHNLIIEEIFEWSN-FVRIEGNKAVHEG--QSSIE 57
           D+  R N  K      L  +        +I +     ++  +R+ GN  +H+   +   E
Sbjct: 133 DKTMRANGYKTKQESNLYKQIEAAADDGVITQARKRRAHDEIRVLGNDVLHDEWQEIPAE 192

Query: 58  ESDECLEFVNLFCDIVF 74
           + +    +     + ++
Sbjct: 193 DVEAAQHYSQRILEDLY 209


>gi|253689250|ref|YP_003018440.1| type III restriction protein res subunit [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251755828|gb|ACT13904.1| type III restriction protein res subunit [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 1137

 Score = 38.4 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE 64
           + +R+       L D        +++ E I    + +RI GN+A H G+   +++   L+
Sbjct: 52  RQERLPEGIKASLYDLMGADVFTSMMPEAIIMKMDALRIHGNRAAHGGRIKAKDTYWLLK 111

Query: 65  FVNLFCDIVFTL 76
              L    ++  
Sbjct: 112 EAYLLGVWLYVR 123


>gi|113866912|ref|YP_725401.1| hypothetical protein H16_A0886 [Ralstonia eutropha H16]
 gi|113525688|emb|CAJ92033.1| Hypothetical protein H16_A0886 [Ralstonia eutropha H16]
          Length = 220

 Score = 38.0 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 23/75 (30%), Gaps = 1/75 (1%)

Query: 3   DDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDE 61
           D   + +  +    L  +   LK    I E      + V   GN A H G S    E   
Sbjct: 120 DRTTEILKLDPGHTLEQKVALLKDKGYIGETEAAILSVVTDAGNAAAHRGWSPGAAEFRV 179

Query: 62  CLEFVNLFCDIVFTL 76
            L  +  F +     
Sbjct: 180 LLIALEQFIERTVIQ 194


>gi|325066203|ref|ZP_08124876.1| hypothetical protein AoriK_00200 [Actinomyces oris K20]
          Length = 311

 Score = 38.0 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%), Gaps = 5/90 (5%)

Query: 4   DQGQRINFEKC--GMLSDRTRYLKQ--HNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES 59
           D+    +  +C   ++++R   L      ++       +  +R   NK  H    S++++
Sbjct: 51  DRTYEPSDPQCQLRIITERIGNLGFLFSGILSRGEQNLAGELREVRNKWAHNSPFSMDDT 110

Query: 60  DECLEFVNLFCDIVFTLPALIKEKKSTHPN 89
              L+            PA   + ++   +
Sbjct: 111 YRALDTAERLL-RAINAPAEADQVRAMKRD 139


>gi|295112014|emb|CBL28764.1| Type I site-specific restriction-modification system, R
           (restriction) subunit and related helicases
           [Synergistetes bacterium SGP1]
          Length = 1098

 Score = 38.0 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDEC 62
           D+   + ++    L       +  +++ + +    +F+R  GN A H G+  + E++  C
Sbjct: 53  DRALAMPYQD--NLVSLISTDEFRDIVDDSLLRRMDFIRKTGNAAAHAGRKITREQAALC 110

Query: 63  LEFVNLFCDIV 73
           LE + +F D V
Sbjct: 111 LENLFIFLDFV 121


>gi|269119929|ref|YP_003308106.1| hypothetical protein Sterm_1309 [Sebaldella termitidis ATCC 33386]
 gi|268613807|gb|ACZ08175.1| hypothetical protein Sterm_1309 [Sebaldella termitidis ATCC 33386]
          Length = 216

 Score = 38.0 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC-LEFVNLFCD 71
           K   L ++         I + I +  + +R  GN A H+  SS +E  E  ++ +    +
Sbjct: 140 KGKNLMNKID---NSTFITDNIKKNLHGIRYLGNDATHDFISSKKEDLELTIKILEDILN 196

Query: 72  IVFTL 76
            V+ L
Sbjct: 197 TVYDL 201


>gi|295106004|emb|CBL03547.1| hypothetical protein [Gordonibacter pamelaeae 7-10-1-b]
          Length = 139

 Score = 38.0 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 20/50 (40%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE 57
           R N      L+++  +L     I     +  + VR  GN AVH+     +
Sbjct: 65  RRNNRSTYSLNEKVDFLCSQENIPAASRDAYDAVRTYGNAAVHKTDFRED 114


>gi|262371530|ref|ZP_06064842.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313538|gb|EEY94593.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 233

 Score = 38.0 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 24/68 (35%), Gaps = 9/68 (13%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEESDECLEFV 66
              L      L     + E+++E  N VR  GN   H  +          +E+   +E +
Sbjct: 142 DTTLYKEINAL--EGKVTEQVWESLNAVREIGNIGAHMEKDINVIVDVESDEAKILIEML 199

Query: 67  NLFCDIVF 74
            +  +  +
Sbjct: 200 EILFEEWY 207


>gi|227893813|ref|ZP_04011618.1| conserved hypothetical protein [Lactobacillus ultunensis DSM 16047]
 gi|227864377|gb|EEJ71798.1| conserved hypothetical protein [Lactobacillus ultunensis DSM 16047]
          Length = 279

 Score = 37.6 bits (86), Expect = 0.48,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 35/98 (35%), Gaps = 15/98 (15%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS------------S 55
               +    L+     L +   +   I E  + +R+ GN   H  ++            +
Sbjct: 173 HTEADANSSLNIMIGQLSR--TMPSFITEMMDNIRVFGNSNAHAHENELDRYRQINETEN 230

Query: 56  IEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
            E+  E   FVNL CD +  L A   E     P+  ++
Sbjct: 231 KEQVIELFTFVNLICDQM-GLLAKSHEMYERIPDTKKN 267


>gi|167519318|ref|XP_001743999.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777961|gb|EDQ91577.1| predicted protein [Monosiga brevicollis MX1]
          Length = 466

 Score = 37.6 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 26/75 (34%), Gaps = 4/75 (5%)

Query: 3   DDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAV----HEGQSSIEE 58
           +D  Q   +++   L  R         +   +      +R+ GN+AV           ++
Sbjct: 84  EDITQSGPYQEPMSLGMRIHEYLTQTKVPPSVLNALEELRVLGNRAVFVYADPEVVGPKD 143

Query: 59  SDECLEFVNLFCDIV 73
            ++ L  + L    V
Sbjct: 144 VNKVLLLLQLIGRYV 158


>gi|25986871|gb|AAN16057.1| ORF182 [Pseudomonas stutzeri]
          Length = 181

 Score = 37.6 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 21  TRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSI--EESDECLEFVNLFCDIVFTLP 77
             +L +   +  +  E  + +R   NKA H  + SI  EE++  +         +   P
Sbjct: 124 VDWLMREGKLPNDSVEILSALRELRNKAAHLPEFSISQEEAERYITLAVKIST-LIVEP 181


>gi|262375872|ref|ZP_06069103.1| predicted protein [Acinetobacter lwoffii SH145]
 gi|262308966|gb|EEY90098.1| predicted protein [Acinetobacter lwoffii SH145]
          Length = 1147

 Score = 37.6 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 31/78 (39%), Gaps = 6/78 (7%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLE--- 64
           ++       L      +K   +I   I++  + +R+ GN AVH  +     ++E ++   
Sbjct: 53  KLTQPYDPSLYSLITDVKFKEIIPPYIWDKMDNIRMVGNSAVHGKKFKQLTTEETVKHIS 112

Query: 65  ---FVNLFCDIVFTLPAL 79
               + ++ +  +  P  
Sbjct: 113 HLFLIYVWFERTYGSPTK 130


>gi|256821295|ref|YP_003145258.1| hypothetical protein Kkor_0068 [Kangiella koreensis DSM 16069]
 gi|256794834|gb|ACV25490.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
          Length = 249

 Score = 37.6 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 24/70 (34%), Gaps = 5/70 (7%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
            L +R    K       ++ E    V+  GN   H G  +     E  E ++   + +F 
Sbjct: 170 SLHERIELFKVK---DPQLAEIMLAVKWLGNAGSHTGSLNTNNVLEAFELLDHVIEHLFV 226

Query: 76  LPALIKEKKS 85
               +K  + 
Sbjct: 227 --KKLKRLRE 234


>gi|329119431|ref|ZP_08248116.1| MORN repeat protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464364|gb|EGF10664.1| MORN repeat protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 534

 Score = 37.3 bits (85), Expect = 0.64,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 17  LSDRTRYLKQHNLII-EEIFEWSNFVRIEGNKAVHEGQSSIEE 58
            +DR   L +  +I  ++  E  +F+R++GN A HE   +   
Sbjct: 85  QADRLFVLLKEEIISYQDKTERFDFIRLKGNAAAHEDAENPYT 127


>gi|116629557|ref|YP_814729.1| Type I site-specific restriction-modification system, R
           (restriction) subunit related helicase [Lactobacillus
           gasseri ATCC 33323]
 gi|311110799|ref|ZP_07712196.1| type I restriction-modification system, R subunit [Lactobacillus
           gasseri MV-22]
 gi|116095139|gb|ABJ60291.1| Type I site-specific restriction-modification system, R
           (restriction) subunit related helicase [Lactobacillus
           gasseri ATCC 33323]
 gi|311065953|gb|EFQ46293.1| type I restriction-modification system, R subunit [Lactobacillus
           gasseri MV-22]
          Length = 1113

 Score = 37.3 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVN 67
           +       L      L   +++    ++  + +R  GN AVH  +  S++E+  CL+ + 
Sbjct: 59  LRTPYQDKLVTLINTLDFKDIVDPNTWQGLDLIRRLGNVAVHTNRKVSLDEAVLCLKALF 118

Query: 68  LFCDIV 73
            F D++
Sbjct: 119 SFFDML 124


>gi|238853924|ref|ZP_04644285.1| type I site-specific restriction-modification system, R
           [Lactobacillus gasseri 202-4]
 gi|238833458|gb|EEQ25734.1| type I site-specific restriction-modification system, R
           [Lactobacillus gasseri 202-4]
          Length = 1110

 Score = 37.3 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVN 67
           +       L      L   +++    ++  + +R  GN AVH  +  S++E+  CL+ + 
Sbjct: 56  LRTPYQDKLVTLINTLDFKDIVDPNTWQGLDLIRRLGNVAVHTNRKVSLDEAVLCLKALF 115

Query: 68  LFCDIV 73
            F D++
Sbjct: 116 SFFDML 121


>gi|88799480|ref|ZP_01115057.1| hypothetical protein MED297_03827 [Reinekea sp. MED297]
 gi|88777790|gb|EAR08988.1| hypothetical protein MED297_03827 [Reinekea sp. MED297]
          Length = 187

 Score = 37.3 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 23/57 (40%), Gaps = 2/57 (3%)

Query: 22  RYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFCDIVFTL 76
             L   NL+  +  +  + +R   NKA H    ++   ++ + +E      D + T 
Sbjct: 121 DALMDENLLSTKQIKLFHELRRLRNKAAHAEDFTVSTADAIQYVELCFRVIDSLITA 177


>gi|326772741|ref|ZP_08232025.1| ATPase of the AAA+ family protein [Actinomyces viscosus C505]
 gi|326637373|gb|EGE38275.1| ATPase of the AAA+ family protein [Actinomyces viscosus C505]
          Length = 1139

 Score = 37.3 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 33/92 (35%), Gaps = 5/92 (5%)

Query: 2   KDDQGQRINFEKC--GMLSDRTRYLKQ--HNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE 57
           + D+    +  +C   ++++R   L      ++       +  +R   NK  H    S++
Sbjct: 49  RPDRTYEPSDPQCQLRIITERIGNLGFLFSGILSRGEQNLAGELREVRNKWAHNSPFSMD 108

Query: 58  ESDECLEFVNLFCDIVFTLPALIKEKKSTHPN 89
           ++   L+            PA   + ++   +
Sbjct: 109 DTYRALDTAERLL-RAINAPAEADQVRAMKRD 139


>gi|113971541|ref|YP_735334.1| SecC motif-containing protein [Shewanella sp. MR-4]
 gi|113886225|gb|ABI40277.1| SEC-C motif domain protein [Shewanella sp. MR-4]
          Length = 544

 Score = 37.3 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 19/43 (44%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE 58
            L      L++   +  EI  + + +R  GN+A H  Q +  E
Sbjct: 62  DLYGLLIELEKKRHVNHEIVHYLHTIRKSGNRAAHPEQFADNE 104


>gi|322371621|ref|ZP_08046165.1| hypothetical protein ZOD2009_19013 [Haladaptatus paucihalophilus
          DX253]
 gi|320548767|gb|EFW90437.1| hypothetical protein ZOD2009_19013 [Haladaptatus paucihalophilus
          DX253]
          Length = 94

 Score = 37.3 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 26/78 (33%), Gaps = 2/78 (2%)

Query: 14 CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH--EGQSSIEESDECLEFVNLFCD 71
             +    + L +   I  ++      V+  GN   H  E +   E+++     ++    
Sbjct: 11 NKSIYGMVKKLNEEGHIPAKLRRSLLTVKDIGNDGAHINENEPDREQAEAIKGLIDAVLS 70

Query: 72 IVFTLPALIKEKKSTHPN 89
                  I+  +  HPN
Sbjct: 71 ATVLTDQQIEFAREKHPN 88


>gi|210621610|ref|ZP_03292723.1| hypothetical protein CLOHIR_00668 [Clostridium hiranonis DSM 13275]
 gi|210154675|gb|EEA85681.1| hypothetical protein CLOHIR_00668 [Clostridium hiranonis DSM 13275]
          Length = 364

 Score = 37.3 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 20/52 (38%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE 61
           +      L  R  Y+++  L    I  + + +R  GN  VH  +      +E
Sbjct: 282 DKAGNRNLFQRIEYMRKTELASPRITAYMHIIRAFGNAEVHTDEEVEYSIEE 333


>gi|229490943|ref|ZP_04384777.1| type III restriction enzyme, res subunit family [Rhodococcus
           erythropolis SK121]
 gi|229322150|gb|EEN87937.1| type III restriction enzyme, res subunit family [Rhodococcus
           erythropolis SK121]
          Length = 1138

 Score = 37.3 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 33/90 (36%), Gaps = 8/90 (8%)

Query: 5   QGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES-DECL 63
           Q + +       LS R    +  +LI   +    N +R  GN AVH+ +    ++  + L
Sbjct: 50  QVEALPQPYKDDLSARIHEPEFVSLIGHGLQAKMNLIRKLGNTAVHDQRPIPPDAGLKAL 109

Query: 64  EFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
             +      +         + ++ P+   D
Sbjct: 110 AELFHILSWL-------ARRYASQPSSKPD 132


>gi|330896858|gb|EGH28453.1| hypothetical protein PSYJA_05424 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 323

 Score = 36.9 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 5/62 (8%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG---QSSIEESDECLEFVNLFCDI 72
            L  R   LK  N   +++ +  + +R  GN   HE    + S E     L  + L C+ 
Sbjct: 62  NLYSRIDRLK--NFFPQDVIDSLHGIRELGNDGAHEANHKKLSNERIRTGLRDLGLVCEW 119

Query: 73  VF 74
             
Sbjct: 120 TI 121


>gi|269928640|ref|YP_003320961.1| hypothetical protein Sthe_2725 [Sphaerobacter thermophilus DSM
           20745]
 gi|269787997|gb|ACZ40139.1| hypothetical protein Sthe_2725 [Sphaerobacter thermophilus DSM
           20745]
          Length = 247

 Score = 36.9 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 17/52 (32%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
             + R        LI  ++ E  N +R   N+  H       +  E  +  N
Sbjct: 115 SFAARIELAYLIGLISPKLREDLNRIRRIRNEFAHTSSEVRFDDPEIAKLCN 166


>gi|304411074|ref|ZP_07392690.1| hypothetical protein Sbal183DRAFT_2528 [Shewanella baltica OS183]
 gi|307301803|ref|ZP_07581561.1| hypothetical protein Sbal175DRAFT_0061 [Shewanella baltica BA175]
 gi|304350609|gb|EFM15011.1| hypothetical protein Sbal183DRAFT_2528 [Shewanella baltica OS183]
 gi|306913841|gb|EFN44262.1| hypothetical protein Sbal175DRAFT_0061 [Shewanella baltica BA175]
          Length = 248

 Score = 36.9 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 32/81 (39%), Gaps = 3/81 (3%)

Query: 4   DQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDEC 62
           D  +  +    G      + L++ N I   +      +R+ GN A H EG    +++ + 
Sbjct: 155 DVLEVPDKCDNGNFMPLAKRLEKINDISLPLKNKLTALRLLGNAATHGEGLLCRKDNVDA 214

Query: 63  LEFVNLFCDIVFTLPALIKEK 83
            + +    D +F  PA   E 
Sbjct: 215 YKLLAHVFDKLF--PAKENEL 233


>gi|291458790|ref|ZP_06598180.1| putative type I restriction-modification system, R subunit
           [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418707|gb|EFE92426.1| putative type I restriction-modification system, R subunit
           [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 1096

 Score = 36.9 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVN 67
           +       L       +  ++I +++ +  +F+R  GN A H   + + +++  CLE + 
Sbjct: 56  LTMPYQDNLISLMSTEEFRDIIDDDLMKRMDFIRKMGNNAAHSNKKITEDQAILCLENLQ 115

Query: 68  LFCDIV 73
           +F D V
Sbjct: 116 IFFDFV 121


>gi|116334899|ref|YP_796424.1| superfamily II DNA/RNA helicase [Lactobacillus brevis ATCC 367]
 gi|116100246|gb|ABJ65393.1| DNA or RNA helicase of superfamily II [Lactobacillus brevis ATCC
           367]
          Length = 1480

 Score = 36.9 bits (84), Expect = 0.88,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 28/93 (30%), Gaps = 10/93 (10%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH----------EGQSSIEE 58
           +N       +D  R LK    I  +  E    ++  GN+A H          + ++ + +
Sbjct: 57  LNVSDQDTFNDVLRALKYDTNIDHDALELFYDLKQSGNQAAHQLAVMTVSKTDKETGLRD 116

Query: 59  SDECLEFVNLFCDIVFTLPALIKEKKSTHPNQS 91
                + +  F +  +     I           
Sbjct: 117 LKRLYKLLAWFVNTFYDQTIDINAFHEPKKEDY 149


>gi|288560497|ref|YP_003423983.1| hypothetical protein mru_1241 [Methanobrevibacter ruminantium M1]
 gi|288543207|gb|ADC47091.1| hypothetical protein mru_1241 [Methanobrevibacter ruminantium M1]
          Length = 1562

 Score = 36.9 bits (84), Expect = 0.90,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 22/60 (36%), Gaps = 1/60 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAV-HEGQSSIEESDECLEFVNLFCDIVF 74
             + +   L    +I E+ +   + +R   N A  HE +  +  + +  + V       +
Sbjct: 62  DQNKKLNTLYSKGIIPEDKYNKLDSIRQYRNIATHHELRDEMNIAKKTHKDVFNILSWFY 121


>gi|52081325|ref|YP_080116.1| hypothetical protein BL00762 [Bacillus licheniformis ATCC 14580]
 gi|52786704|ref|YP_092533.1| hypothetical protein BLi02972 [Bacillus licheniformis ATCC 14580]
 gi|52004536|gb|AAU24478.1| hypothetical protein BL00762 [Bacillus licheniformis ATCC 14580]
 gi|52349206|gb|AAU41840.1| hypothetical protein BLi02972 [Bacillus licheniformis ATCC 14580]
          Length = 257

 Score = 36.9 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIVF 74
            L  +   LK+ N+I EE       ++  GN+ VHE  +    +    LE ++L    ++
Sbjct: 184 NLVQKINELKEKNIIDEEQRRILLEIKDVGNQTVHEIFRPKRRDLLLYLETLDLILFNIY 243

Query: 75  TLP 77
            LP
Sbjct: 244 ELP 246


>gi|319647237|ref|ZP_08001459.1| hypothetical protein HMPREF1012_02498 [Bacillus sp. BT1B_CT2]
 gi|317390584|gb|EFV71389.1| hypothetical protein HMPREF1012_02498 [Bacillus sp. BT1B_CT2]
          Length = 257

 Score = 36.9 bits (84), Expect = 0.97,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIVF 74
            L  +   LK+ N+I EE       ++  GN+ VHE  +    +    LE ++L    ++
Sbjct: 184 NLVQKINELKEKNIIDEEQRRILLEIKDVGNQTVHEIFRPKRRDLLLYLETLDLILFNIY 243

Query: 75  TLP 77
            LP
Sbjct: 244 ELP 246


>gi|87199189|ref|YP_496446.1| hypothetical protein Saro_1167 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134870|gb|ABD25612.1| hypothetical protein Saro_1167 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 191

 Score = 36.9 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 7/52 (13%), Positives = 17/52 (32%)

Query: 22  RYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIV 73
           R L++  ++          +R   N A H    S+ ++           + +
Sbjct: 137 RALQKRGILPARTIGMIGEMRRLRNAAAHNQDISVSDALRFRNLAKGVLNEI 188


>gi|294792442|ref|ZP_06757589.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
 gi|294456341|gb|EFG24704.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
          Length = 949

 Score = 36.9 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 1/68 (1%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFV 66
           R+         D+ +       +  +I +  + +R+ GNKA H+  +   +  + CL+  
Sbjct: 54  RLPNNPRISFCDKLQEPNFCKAVPTDISDKLHVLRVYGNKAAHQVLEYGQDAVNHCLKEA 113

Query: 67  NLFCDIVF 74
            L    ++
Sbjct: 114 YLLGKWLY 121


>gi|268319590|ref|YP_003293246.1| putative type IV restriction endonuclease [Lactobacillus johnsonii
           FI9785]
 gi|262397965|emb|CAX66979.1| putative type IV restriction endonuclease [Lactobacillus johnsonii
           FI9785]
          Length = 1471

 Score = 36.5 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 31/100 (31%), Gaps = 14/100 (14%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDE------ 61
           +  ++        + LK    I +   ++   V+  GN A H    +  E++        
Sbjct: 56  LVVDERETFDSVLKRLKSGQYIDKYALQFFYDVKNIGNVAAHTLSDNSQEDALTALRRLY 115

Query: 62  --CLEFVNLFCDIV-----FTLPALIKEKKSTHPNQSRDG 94
             C+ FV+ + D       F  P        T      + 
Sbjct: 116 SLCVWFVDSYYDENIDATDFQEPKKEDVLYQTTTQPLSNA 155


>gi|119776583|ref|YP_929323.1| hypothetical protein Sama_3451 [Shewanella amazonensis SB2B]
 gi|119769083|gb|ABM01654.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 475

 Score = 36.5 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEE 58
           R+ F+    L +R   L Q  L+        + +R +GN+  H  +  ++E
Sbjct: 56  RLTFD-SPNLYNRIESLSQARLLGVRQARAMHRLRADGNRGAHPEKYHLDE 105


>gi|260497974|ref|ZP_05816090.1| gp7 [Fusobacterium sp. 3_1_33]
 gi|260196482|gb|EEW94013.1| gp7 [Fusobacterium sp. 3_1_33]
          Length = 238

 Score = 36.1 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 30/84 (35%), Gaps = 13/84 (15%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-------QSSIEESDECLEF 65
           K   L D    ++    +  +IF   + +R  GN   H         +    E+ + ++F
Sbjct: 140 KKKNLVDEINTIQND--LGTDIFNALHSLRSIGNIGAHPESDINLIVEIDEGEAQKLIKF 197

Query: 66  VNLFCDIVF----TLPALIKEKKS 85
           + L  D  +        +++E   
Sbjct: 198 IELLMDKWYIKREEERKMLEEINQ 221


>gi|227510787|ref|ZP_03940836.1| type II restriction-modification system restriction subunit
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227189746|gb|EEI69813.1| type II restriction-modification system restriction subunit
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 1465

 Score = 36.1 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 12  EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH--------EGQSSIEESDECL 63
           +     +   + +K H+L+ +++ +    ++  GN+A H        +G +++++  + +
Sbjct: 58  DNDATFAQNLKAVKYHHLLNQQLVDLLYAIKQPGNEASHTLEQYNKQDGVAALQQVIQLM 117

Query: 64  -EFVNLFCDI 72
             F   +CD 
Sbjct: 118 YWFAKTYCDY 127


>gi|24372244|ref|NP_716286.1| hypothetical protein SO_0653 [Shewanella oneidensis MR-1]
 gi|24346165|gb|AAN53731.1|AE015511_14 hypothetical protein SO_0653 [Shewanella oneidensis MR-1]
          Length = 266

 Score = 36.1 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 7/64 (10%), Positives = 25/64 (39%), Gaps = 3/64 (4%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSN---FVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
            L+ +   LK+      ++ E  +    ++  GN   H+ +    +     + ++    +
Sbjct: 181 NLNKKLNELKKIEASQPKLLEILDYFLAIKWLGNNGSHDAELEERDLAVAFKIMDKALIL 240

Query: 73  VFTL 76
           +++ 
Sbjct: 241 LYSR 244


>gi|117921403|ref|YP_870595.1| type I restriction enzyme EcoKI subunit R [Shewanella sp. ANA-3]
 gi|117613735|gb|ABK49189.1| type III restriction enzyme, res subunit [Shewanella sp. ANA-3]
          Length = 1167

 Score = 36.1 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/112 (17%), Positives = 41/112 (36%), Gaps = 26/112 (23%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES-------- 59
            I F++    +D    + +   +   + E  + +R+EGN A H+ ++  +E+        
Sbjct: 58  GIEFDEQTKQTDLLYRINRDLKLEPMVRELFHTLRVEGNIANHQFRTKHKEAINGLVVAR 117

Query: 60  DECLEFVNLFCD------------------IVFTLPALIKEKKSTHPNQSRD 93
              + F   F                     +FTL A I+  K+   N + +
Sbjct: 118 KLAIWFHQTFSKSGTAFKPGPFIPPKDPSAELFTLQAEIEGLKAQLQNANVE 169


>gi|289706680|ref|ZP_06503028.1| DEAD/DEAH box helicase [Micrococcus luteus SK58]
 gi|289556600|gb|EFD49943.1| DEAD/DEAH box helicase [Micrococcus luteus SK58]
          Length = 1137

 Score = 36.1 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 26/66 (39%), Gaps = 2/66 (3%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
           R+       LS     +    L    + +  NF+R  GN AVH+   S+ ++   L  + 
Sbjct: 49  RLEDPYKTDLSGLINGVAFTGLAGRPVVDKLNFLRKAGNNAVHKD--SVLDARAALTILR 106

Query: 68  LFCDIV 73
               ++
Sbjct: 107 ELFHVL 112


>gi|91788605|ref|YP_549557.1| hypothetical protein Bpro_2743 [Polaromonas sp. JS666]
 gi|91697830|gb|ABE44659.1| hypothetical protein Bpro_2743 [Polaromonas sp. JS666]
          Length = 188

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 30/77 (38%), Gaps = 6/77 (7%)

Query: 4   DQGQRIN--FEKCGM-LSDRTRYLKQHNLIIEEIFEWSN-FVRIEGNKAVHEGQ--SSIE 57
           D+  R N   EK G  L  +     +  +I E     ++  +R+ GN  +H+      +E
Sbjct: 83  DKTLRANGYKEKNGTTLEQQIDAATKDGVITEARRRRAHDEIRVLGNDVLHDEWHAVPVE 142

Query: 58  ESDECLEFVNLFCDIVF 74
           + +    +     +  +
Sbjct: 143 DVEAARHYAQRILEDFY 159


>gi|328947252|ref|YP_004364589.1| hypothetical protein Tresu_0335 [Treponema succinifaciens DSM 2489]
 gi|328447576|gb|AEB13292.1| hypothetical protein Tresu_0335 [Treponema succinifaciens DSM 2489]
          Length = 255

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 21/45 (46%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE 51
           Q+  +E+   L++    LK   L+   I    + +R  GN A H+
Sbjct: 164 QKYIYEQNYSLANIINELKARKLVSGGIANAMHKIRKSGNAATHQ 208


>gi|84387011|ref|ZP_00990034.1| hypothetical protein V12B01_24379 [Vibrio splendidus 12B01]
 gi|84378086|gb|EAP94946.1| hypothetical protein V12B01_24379 [Vibrio splendidus 12B01]
          Length = 300

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 27/64 (42%), Gaps = 5/64 (7%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDEC-LEFVNLFCDI 72
            L+ R   L   +    +I +  + +R  GNK  H+   +  +E+  E  L  ++  C+ 
Sbjct: 62  NLNARLNTL--SDFFPNDINDKLHGIRKLGNKGAHQNGHKDLVEDELELTLVDLSQICEW 119

Query: 73  VFTL 76
             T 
Sbjct: 120 TITA 123


>gi|225022501|ref|ZP_03711693.1| hypothetical protein CORMATOL_02541 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224944740|gb|EEG25949.1| hypothetical protein CORMATOL_02541 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 1158

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 21/58 (36%), Gaps = 1/58 (1%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEESDECLEFVNLFCDI 72
            L+D+  +    + + + I +  N +R  GN A H       E +   +  +      
Sbjct: 65  NLNDKLNHRSFKDRVNQRIHDKMNVLRRFGNDAAHNPDHIDPERAVRAIGQLFDILVW 122


>gi|295110201|emb|CBL24154.1| Type I site-specific restriction-modification system, R
           (restriction) subunit and related helicases
           [Ruminococcus obeum A2-162]
          Length = 1114

 Score = 35.7 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFV 66
            +       L       +   ++  ++++  +++R  GN A H   +   +E+  CLE +
Sbjct: 56  ELEMPYQDNLQSLMNAEEYRQIVGPDLWKRMDYIRRSGNNAAHSNKKLGRDEAMLCLENL 115

Query: 67  NLFCDIV 73
            ++ D +
Sbjct: 116 FIYLDYI 122


>gi|119945602|ref|YP_943282.1| hypothetical protein Ping_1908 [Psychromonas ingrahamii 37]
 gi|119864206|gb|ABM03683.1| hypothetical protein Ping_1908 [Psychromonas ingrahamii 37]
          Length = 530

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 4   DQGQRINF--EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH 50
           + G ++N      G L+ + + +   + +   I +  N +RIEGNK+ H
Sbjct: 59  EVGAKLNLYPPITGDLNSKIKQISYSHKVPGYILDTLNKLRIEGNKSAH 107


>gi|184153998|ref|YP_001842339.1| type I restriction-modification system R subunit [Lactobacillus
           reuteri JCM 1112]
 gi|227363769|ref|ZP_03847877.1| type I site-specific deoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|325682978|ref|ZP_08162494.1| type I site-specific deoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
 gi|183225342|dbj|BAG25859.1| type I restriction-modification system R subunit [Lactobacillus
           reuteri JCM 1112]
 gi|227071194|gb|EEI09509.1| type I site-specific deoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|324977328|gb|EGC14279.1| type I site-specific deoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
          Length = 1111

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVN 67
           +       L      L   +++    ++    +R  GN AVH  +  S++E+  CL+ + 
Sbjct: 59  LRTPYQDKLVTLINTLDFKDIVDPNTWQGLELIRRLGNIAVHTNRKVSLDEAILCLKALF 118

Query: 68  LFCDIV 73
            F D++
Sbjct: 119 SFFDML 124


>gi|227874115|ref|ZP_03992321.1| conserved hypothetical protein [Oribacterium sinus F0268]
 gi|227840027|gb|EEJ50451.1| conserved hypothetical protein [Oribacterium sinus F0268]
          Length = 468

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 7/52 (13%), Positives = 21/52 (40%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVN 67
            L      L +  +I  +  +  + +R  G  A    +S+ +++++    + 
Sbjct: 77  NLESDINQLFEGGIISAKSRDTYHGIRAFGELAELGNESTAQDANDSFSMLR 128


>gi|148544645|ref|YP_001272015.1| type III restriction protein, res subunit [Lactobacillus reuteri
           DSM 20016]
 gi|148531679|gb|ABQ83678.1| type III restriction protein, res subunit [Lactobacillus reuteri
           DSM 20016]
          Length = 1108

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVN 67
           +       L      L   +++    ++    +R  GN AVH  +  S++E+  CL+ + 
Sbjct: 56  LRTPYQDKLVTLINTLDFKDIVDPNTWQGLELIRRLGNIAVHTNRKVSLDEAILCLKALF 115

Query: 68  LFCDIV 73
            F D++
Sbjct: 116 SFFDML 121


>gi|322421465|ref|YP_004200688.1| hypothetical protein GM18_3994 [Geobacter sp. M18]
 gi|320127852|gb|ADW15412.1| hypothetical protein GM18_3994 [Geobacter sp. M18]
          Length = 420

 Score = 35.7 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 22  RYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVNLFCDIVF 74
           + L ++NL+ +  + W+  +R+ GN+  H  +  S +E++  + F+       F
Sbjct: 75  KKLFEYNLLRQSSYYWAKGLRLLGNEVRHVSRSISADEAECAIIFLERILTWYF 128


>gi|300781936|ref|YP_003739171.1| hypothetical protein EbC_pEb10201150 [Erwinia billingiae Eb661]
 gi|299060202|emb|CAX53393.1| uncharacterized protein [Erwinia billingiae Eb661]
          Length = 84

 Score = 35.7 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 25/63 (39%), Gaps = 3/63 (4%)

Query: 9  INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNL 68
          ++  K G L DR    K  ++  +E     + ++  GN   H    + ++ +E    + L
Sbjct: 1  MDVPKAGSLHDRIE--KGLHVFGQESAAI-HALKAVGNAGSHGNAITHKDLEEACLILEL 57

Query: 69 FCD 71
             
Sbjct: 58 IVK 60


>gi|240265383|gb|ACS50137.1| hypothetical protein [Streptomyces hygroscopicus]
          Length = 244

 Score = 35.3 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 9/52 (17%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFV 66
            L      L + ++  + + +  +  R+ GN +VH+G + + +E  +  + +
Sbjct: 193 SLHAVIGDLARLDV-PQSVIDGFHEARLLGNDSVHDGLEYAPDEIADVADLI 243


>gi|50121823|ref|YP_050990.1| hypothetical protein ECA2899 [Pectobacterium atrosepticum SCRI1043]
 gi|49612349|emb|CAG75799.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 300

 Score = 35.3 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 10/76 (13%), Positives = 24/76 (31%), Gaps = 11/76 (14%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           +K+ +  +    +   L  +  +L    +  E++F     +R+  N A H+         
Sbjct: 175 IKNKEETKKVLVRKSSLEQKISFLHSKEIFDEKLFNILTSLRLMRNHAAHD--------- 225

Query: 61  ECLEFVNLFCDIVFTL 76
             L       +     
Sbjct: 226 --LSLTESIYNETIVE 239


>gi|227889877|ref|ZP_04007682.1| type I site-specific deoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
 gi|227849321|gb|EEJ59407.1| type I site-specific deoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
          Length = 1113

 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVN 67
           +       L      L   +++    ++    +R  GN AVH  +  S++E+  CL+ + 
Sbjct: 59  LKTPYQDKLVTLINTLDFKDIVDPNTWQGLELIRRLGNVAVHTNRKVSLDEAILCLKALF 118

Query: 68  LFCDIV 73
            F D++
Sbjct: 119 SFFDML 124


>gi|144899948|emb|CAM76812.1| Phosphoenolpyruvate carboxylase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 933

 Score = 35.3 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 31/82 (37%), Gaps = 4/82 (4%)

Query: 6   GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65
           G+R+ +   G   D  R LK   +   ++ +  + +R +     H  ++      E    
Sbjct: 103 GERLWY---GSFDDTLRQLKAEGVSAGQLQQMLDALRFQPVFTAHPTEAKRRAVLEAQRR 159

Query: 66  VNLFCDIVFTLPALIKEKKSTH 87
           + +    +   P L + ++ + 
Sbjct: 160 LYVLARRL-NDPNLAEHQRRSL 180


>gi|86146070|ref|ZP_01064397.1| hypothetical protein MED222_14950 [Vibrio sp. MED222]
 gi|85836275|gb|EAQ54406.1| hypothetical protein MED222_14950 [Vibrio sp. MED222]
          Length = 216

 Score = 35.3 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 26/77 (33%), Gaps = 5/77 (6%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE-ESDECLEFVNLFCDIVFT 75
           L+ R   L ++     +I E +N +R  GN   H G    + +  +         + ++ 
Sbjct: 139 LAKRISSLPENY---RKIIEPANAIRWLGNDGTHSGYQVRKSDVVDGYRIFEHILEELYP 195

Query: 76  LPA-LIKEKKSTHPNQS 91
                I+   +      
Sbjct: 196 EKKASIEALVARINEAK 212


>gi|58336806|ref|YP_193391.1| restriction endonuclease [Lactobacillus acidophilus NCFM]
 gi|58254123|gb|AAV42360.1| restriction endonuclease [Lactobacillus acidophilus NCFM]
          Length = 1501

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 25/86 (29%), Gaps = 14/86 (16%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDI-- 72
             +D    LK    I +   +    ++  GN A H    +S EE+   L+ +        
Sbjct: 77  TFNDILNRLKTGAYIDKFAVDLFYAIKGPGNVAAHTLDGASKEEALNSLKNLYSLFVWFV 136

Query: 73  -----------VFTLPALIKEKKSTH 87
                       FT P        T 
Sbjct: 137 GSYYDEKIDITAFTEPKKEDNLYQTT 162


>gi|91224358|ref|ZP_01259620.1| hypothetical protein V12G01_17012 [Vibrio alginolyticus 12G01]
 gi|91190700|gb|EAS76967.1| hypothetical protein V12G01_17012 [Vibrio alginolyticus 12G01]
          Length = 206

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 32/101 (31%), Gaps = 26/101 (25%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD------------ 60
           K   L ++     +  L+   + E  + +R+  NK  HE   SI +++            
Sbjct: 106 KSNSLFEKVNRCVELGLLENLMKERFDSLRVVRNKLAHEWDLSINDAELKNALHALYLLD 165

Query: 61  --ECLEFVNLF------------CDIVFTLPALIKEKKSTH 87
             +  EF+                    T+   I+E +   
Sbjct: 166 HGQLFEFIEDIDFLLQLIFSGSCAKAAITIKTKIEELRKEL 206


>gi|228998271|ref|ZP_04157866.1| hypothetical protein bmyco0003_28360 [Bacillus mycoides Rock3-17]
 gi|229007999|ref|ZP_04165560.1| hypothetical protein bmyco0002_48640 [Bacillus mycoides Rock1-4]
 gi|228753249|gb|EEM02726.1| hypothetical protein bmyco0002_48640 [Bacillus mycoides Rock1-4]
 gi|228761423|gb|EEM10374.1| hypothetical protein bmyco0003_28360 [Bacillus mycoides Rock3-17]
          Length = 232

 Score = 35.0 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 22/98 (22%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-------- 52
           +K   G++ N +    LS +   L ++  + + I +  + V        H          
Sbjct: 139 LKHFLGEKSNGQ---TLSQQFEQLPKYIDLTKPIQDVGHLV--------HPDSPLYEMLE 187

Query: 53  ---QSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTH 87
              +   E      E + +    +F LP  I+      
Sbjct: 188 LKQEIDDETVALLTELLEVLIQYLFVLPEKIESVHDKI 225


>gi|254487766|ref|ZP_05100971.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214044635|gb|EEB85273.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 26/60 (43%), Gaps = 3/60 (5%)

Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFT 75
           L+ R ++L++      +  +  + +RI GN   H  + S E   + LE        +++
Sbjct: 13 DLNGRIQHLEKE---SPDQAQTFHALRIIGNIGSHTTELSREVLLDALELYEDALLEIYS 69


>gi|222526644|ref|YP_002571115.1| phosphoenolpyruvate carboxylase [Chloroflexus sp. Y-400-fl]
 gi|222450523|gb|ACM54789.1| Phosphoenolpyruvate carboxylase [Chloroflexus sp. Y-400-fl]
          Length = 933

 Score = 35.0 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 22/66 (33%), Gaps = 1/66 (1%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEFVNL 68
              +   ++D    LK+H +    I EW +   I      H  +S       +     + 
Sbjct: 109 PAPRAESIADAIELLKRHGVPAPAIQEWLDHALIMPVLTAHPTESRRRTILIKLRRIFDT 168

Query: 69  FCDIVF 74
             D+ F
Sbjct: 169 LVDLTF 174


>gi|163848702|ref|YP_001636746.1| phosphoenolpyruvate carboxylase [Chloroflexus aurantiacus J-10-fl]
 gi|163669991|gb|ABY36357.1| Phosphoenolpyruvate carboxylase [Chloroflexus aurantiacus J-10-fl]
          Length = 939

 Score = 35.0 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 22/66 (33%), Gaps = 1/66 (1%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD-ECLEFVNL 68
              +   ++D    LK+H +    I EW +   I      H  +S       +     + 
Sbjct: 109 PAPRAESIADAIELLKRHGVPAPAIQEWLDHALIMPVLTAHPTESRRRTILIKLRRIFDT 168

Query: 69  FCDIVF 74
             D+ F
Sbjct: 169 LVDLTF 174


>gi|288934689|ref|YP_003438748.1| hypothetical protein Kvar_1815 [Klebsiella variicola At-22]
 gi|288889398|gb|ADC57716.1| hypothetical protein Kvar_1815 [Klebsiella variicola At-22]
          Length = 181

 Score = 35.0 bits (79), Expect = 4.1,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 19/54 (35%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLF 69
            L  R     +  LI + + +     R   N+  H  ++   +S   L  +N  
Sbjct: 70  SLESRIAMAYRLGLITKSVAKSLGVFRKLRNEFAHRIETVNFDSPSALNRLNEI 123


>gi|291460993|ref|ZP_06026314.2| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291379501|gb|EFE87019.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 235

 Score = 34.6 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 29/81 (35%), Gaps = 13/81 (16%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-------QSSIEESDECLEFVNL 68
            L D    ++    +  +IF   + +R  GN   H         +    E+ + ++F+ L
Sbjct: 143 NLVDEINAIQND--LGIDIFNALHNLRSIGNIGAHPESDINLIVEIDEGEAQKLIKFIEL 200

Query: 69  FCDIVF----TLPALIKEKKS 85
             D  +        +++E   
Sbjct: 201 LMDKWYIKREEERKMLEEINQ 221


>gi|255505940|ref|ZP_05349028.3| type I restriction-modification system, R subunit [Bryantella
           formatexigens DSM 14469]
 gi|255264983|gb|EET58188.1| type I restriction-modification system, R subunit [Bryantella
           formatexigens DSM 14469]
          Length = 1132

 Score = 34.6 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 11/66 (16%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-QSSIEESDECLEFVN 67
           +       L       +  +++  ++++  +++R  GN A H   +   +E+  CLE + 
Sbjct: 75  LEMPYQDNLQSLMNAEEYRHIVGPDLWKRMDYIRRCGNNAAHSNKKLGKDEAMLCLENLF 134

Query: 68  LFCDIV 73
           ++ D +
Sbjct: 135 IYLDFI 140


>gi|333026822|ref|ZP_08454886.1| hypothetical protein STTU_4326 [Streptomyces sp. Tu6071]
 gi|332746674|gb|EGJ77115.1| hypothetical protein STTU_4326 [Streptomyces sp. Tu6071]
          Length = 271

 Score = 34.6 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 26/72 (36%)

Query: 3   DDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDEC 62
           D  G          L ++T++LKQ  ++  +  E  + +    N A H      +   + 
Sbjct: 45  DHVGPERRKAIDDRLHEKTKFLKQKGVLTAQEREVLDRLHQYRNAAYHRDTLESDLISDL 104

Query: 63  LEFVNLFCDIVF 74
           +    +  + + 
Sbjct: 105 VLAYRVLANELI 116


>gi|315923743|ref|ZP_07919975.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315622958|gb|EFV02907.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 416

 Score = 34.6 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 8/60 (13%), Positives = 24/60 (40%), Gaps = 2/60 (3%)

Query: 16  MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDIVF 74
              +  + L+  +   +++ +    ++  GN+A H   Q +  E+ + +  +       F
Sbjct: 87  TFHENLKALRGTDT-PKKVMDVFFAIKRWGNRATHNLDQGTQAEALKAIRAIYALLGWQF 145


>gi|253578023|ref|ZP_04855295.1| type III restriction protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850341|gb|EES78299.1| type III restriction protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 1109

 Score = 34.6 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 19  DRTRYL----KQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVNLFCDIV 73
           DR   L    +  ++I  ++ +   F+R  GN A H GQ    E+++ CL+ + +F D V
Sbjct: 62  DRLVSLMSTDEFRDIIDADLLKRMEFIRKTGNFAAHTGQKVKKEQAELCLQNLYIFLDFV 121


>gi|229523507|ref|ZP_04412912.1| type I restriction-modification system R subunit [Vibrio cholerae
           bv. albensis VL426]
 gi|229337088|gb|EEO02105.1| type I restriction-modification system R subunit [Vibrio cholerae
           bv. albensis VL426]
          Length = 1124

 Score = 34.6 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 3/60 (5%)

Query: 17  LSDRTRYLKQHNLII---EEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIV 73
            +     LK    I      + +  +F+RIEGN+  H    S+ ++   L   +     +
Sbjct: 68  QASFMDLLKNDAFIDVTEPRLRDQLHFLRIEGNETAHGSHGSLSKAYAALGTAHSLSQYL 127


>gi|182412875|ref|YP_001817941.1| hypothetical protein Oter_1053 [Opitutus terrae PB90-1]
 gi|177840089|gb|ACB74341.1| conserved hypothetical protein [Opitutus terrae PB90-1]
          Length = 223

 Score = 34.6 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 11/89 (12%), Positives = 27/89 (30%), Gaps = 4/89 (4%)

Query: 7   QRINFEKCGMLSD---RTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS-IEESDEC 62
           +    +K G            +    I ++  E    +   G+ ++H       E+    
Sbjct: 135 EHTMIDKVGDQKSFTANLNKFEAQGFIGKKHREVVGSMLEAGHASIHRAFVPAKEDLITL 194

Query: 63  LEFVNLFCDIVFTLPALIKEKKSTHPNQS 91
           ++ +     +V+       E K   P + 
Sbjct: 195 VDILEGVLQVVYVQVPKADEMKKRIPKRK 223


>gi|311742874|ref|ZP_07716682.1| type I restriction-modification system [Aeromicrobium marinum DSM
           15272]
 gi|311313554|gb|EFQ83463.1| type I restriction-modification system [Aeromicrobium marinum DSM
           15272]
          Length = 1116

 Score = 34.6 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 10/64 (15%), Positives = 21/64 (32%), Gaps = 2/64 (3%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES--DECLEFV 66
           ++      L+ +         + + I +    +R   N AVHE +    +       E  
Sbjct: 53  LSIPYRNDLAAKISDPAFKARVPQGITQKLTAIRRIANTAVHENRQIRPDVSLAVLRELF 112

Query: 67  NLFC 70
           N+  
Sbjct: 113 NVVV 116


>gi|56750491|ref|YP_171192.1| hypothetical protein syc0482_c [Synechococcus elongatus PCC 6301]
 gi|81299876|ref|YP_400084.1| hypothetical protein Synpcc7942_1067 [Synechococcus elongatus PCC
           7942]
 gi|56685450|dbj|BAD78672.1| unknown protein [Synechococcus elongatus PCC 6301]
 gi|81168757|gb|ABB57097.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 182

 Score = 34.2 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 5/41 (12%), Positives = 14/41 (34%)

Query: 15  GMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSS 55
           G  + +     +  L+   + +  + +R   N   H    +
Sbjct: 67  GSFAAKITLAARLGLLDPTVEKALHGIRAVRNDFAHSASDT 107


>gi|152999415|ref|YP_001365096.1| hypothetical protein Shew185_0879 [Shewanella baltica OS185]
 gi|151364033|gb|ABS07033.1| hypothetical protein Shew185_0879 [Shewanella baltica OS185]
          Length = 97

 Score = 34.2 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query: 1  MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVH-EGQSSIEES 59
          M  D  +  +    G      + L++ N I   +      +R+ GN A H EG    +++
Sbjct: 1  MMLDVLEVPDKCDNGNFMPLAKRLEKINDISLPLKNKLTALRLLGNAATHGEGLLCRKDN 60

Query: 60 DECLEFVNLFCDIVF 74
           +  + +    D +F
Sbjct: 61 VDAYKLLAHVFDKLF 75


>gi|294141200|ref|YP_003557178.1| hypothetical protein SVI_2429 [Shewanella violacea DSS12]
 gi|293327669|dbj|BAJ02400.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 350

 Score = 34.2 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 14  CGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ-SSIEESDECLEFVNLFCDI 72
            G+++D    L       +EI +  + VR   NK VH+G  ++ +E  E L+  +   + 
Sbjct: 288 NGLINDAFTKLFGEE--SDEIKDKIHEVRKVRNKIVHDGYQATPQECSESLKICDEAFNY 345

Query: 73  V 73
           +
Sbjct: 346 I 346


>gi|311113523|ref|YP_003984745.1| type I restriction-modification system R subunit [Rothia
           dentocariosa ATCC 17931]
 gi|310945017|gb|ADP41311.1| type I restriction-modification system R subunit [Rothia
           dentocariosa ATCC 17931]
          Length = 1141

 Score = 34.2 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 16  MLSDRTRYLKQHNLI-IEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDI 72
            L DR R  +  NL+    + +    +R+ GNKA H  + S + + + +  ++     
Sbjct: 63  TLVDRLRNPEFQNLVRHPALHDKMRLIRLAGNKAAHGNRISGDVAMQTVRDLHHLLVW 120


>gi|116251952|ref|YP_767790.1| hypothetical protein RL2195 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256600|emb|CAK07687.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score = 34.2 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 23/73 (31%), Gaps = 7/73 (9%)

Query: 11  FEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEESDECL 63
            ++   L+ R         +  E  E  + VR  GN   H  +           E+   +
Sbjct: 144 IDEIKELNKRLNEGTAPRGVEPESVEAIDAVRDIGNIGAHMEKDINLIVDVDPGEAQALI 203

Query: 64  EFVNLFCDIVFTL 76
           E + +  D  +  
Sbjct: 204 ELIEMLFDEWYVA 216


>gi|295693569|ref|YP_003602179.1| hypothetical protein LCRIS_01707 [Lactobacillus crispatus ST1]
 gi|295031675|emb|CBL51154.1| conserved protein [Lactobacillus crispatus ST1]
          Length = 228

 Score = 34.2 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFC 70
           +   L + T YL+        I +  + +R  GN AVH+ Q   +  ++  C+  ++   
Sbjct: 66  EHRNLRNNTHYLRNELDYPLSIMDLFDEIRRMGNAAVHDNQIEPDQKQAWHCICDLHDIL 125

Query: 71  DIVF 74
             + 
Sbjct: 126 VFLI 129


>gi|228992217|ref|ZP_04152150.1| hypothetical protein bpmyx0001_29610 [Bacillus pseudomycoides DSM
           12442]
 gi|228767470|gb|EEM16100.1| hypothetical protein bpmyx0001_29610 [Bacillus pseudomycoides DSM
           12442]
          Length = 231

 Score = 34.2 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 22/98 (22%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG-------- 52
           +K   G++ N +    LS +   L ++  + + I +  + V        H          
Sbjct: 138 LKHFLGEKSNGQP---LSQQFEQLPKYIDLTKPIQDVGHLV--------HPDSPLYEMLE 186

Query: 53  ---QSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTH 87
              +   E      E + +    +F LP  I+      
Sbjct: 187 LKQEIDDETVALLTELLEVLIQYLFVLPEKIESVHDKI 224


>gi|262047790|ref|ZP_06020741.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|260571919|gb|EEX28489.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
          Length = 228

 Score = 34.2 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFC 70
           +   L + T YL+        I +  + +R  GN AVH+ Q   +  ++  C+  ++   
Sbjct: 66  EHRNLRNNTHYLRNELDYPLSIMDLFDEIRRMGNAAVHDNQIEPDQKQAWHCICDLHDIL 125

Query: 71  DIVF 74
             + 
Sbjct: 126 VFLI 129


>gi|319652684|ref|ZP_08006794.1| hypothetical protein HMPREF1013_03408 [Bacillus sp. 2_A_57_CT2]
 gi|317395589|gb|EFV76317.1| hypothetical protein HMPREF1013_03408 [Bacillus sp. 2_A_57_CT2]
          Length = 486

 Score = 34.2 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGN 46
            ++  EK G   D+ R L Q +L+ E+  +  + +  EGN
Sbjct: 66  PKLAAEKDGTAKDKLRILFQADLVTEKSIDDLSLLLFEGN 105


>gi|31795391|ref|NP_857844.1| hypothetical protein Y1061 [Yersinia pestis KIM]
 gi|40787983|ref|NP_955503.1| hypothetical protein YPKMT077 [Yersinia pestis KIM]
 gi|52788137|ref|YP_093965.1| hypothetical protein pG8786_085 [Yersinia pestis]
 gi|108793834|ref|YP_636651.1| hypothetical protein YPN_MT0102 [Yersinia pestis Nepal516]
 gi|145597320|ref|YP_001154737.1| hypothetical protein YPDSF_4156 [Yersinia pestis Pestoides F]
 gi|166214489|ref|ZP_02240524.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167426909|ref|ZP_02318662.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229896927|ref|ZP_04512086.1| hypothetical protein YPS_4770 [Yersinia pestis Pestoides A]
 gi|229904764|ref|ZP_04519874.1| hypothetical protein YP516_4604 [Yersinia pestis Nepal516]
 gi|3883061|gb|AAC82721.1| unknown [Yersinia pestis KIM 10]
 gi|52538066|emb|CAG27491.1| hypothetical protein [Yersinia pestis]
 gi|108777898|gb|ABG20416.1| hypothetical protein YPN_MT0102 [Yersinia pestis Nepal516]
 gi|145213088|gb|ABP42493.1| hypothetical protein YPDSF_4156 [Yersinia pestis Pestoides F]
 gi|166204337|gb|EDR48817.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167054076|gb|EDR63903.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229678079|gb|EEO74185.1| hypothetical protein YP516_4604 [Yersinia pestis Nepal516]
 gi|229699963|gb|EEO88003.1| hypothetical protein YPS_4770 [Yersinia pestis Pestoides A]
 gi|320017634|gb|ADW01204.1| hypothetical protein YPC_4876 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 240

 Score = 34.2 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 22/75 (29%), Gaps = 1/75 (1%)

Query: 8   RINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES-DECLEFV 66
            I       +  + + +     + E   +    V   GN A H G    + + +  L   
Sbjct: 141 HIGIPNAYTMEQKVKDVFVKGYVSETERDQLRIVIEAGNAAAHRGWRPDKSAFESLLHVA 200

Query: 67  NLFCDIVFTLPALIK 81
             F   V      I+
Sbjct: 201 EKFIQQVILRDLEIE 215


>gi|291483378|dbj|BAI84453.1| hypothetical protein BSNT_01575 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 262

 Score = 34.2 bits (77), Expect = 6.8,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 25/68 (36%), Gaps = 1/68 (1%)

Query: 10  NFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES-DECLEFVNL 68
           N +K   L  +   L  +  I+         +R  GN+A+HE     +    + +  V  
Sbjct: 179 NPKKRESLEGKFFGLYDNGYILFNQALILQKIRGIGNEAIHEVVEPDKLVSKKIIIIVES 238

Query: 69  FCDIVFTL 76
             +  + L
Sbjct: 239 ILENTYEL 246


>gi|227894415|ref|ZP_04012220.1| conserved hypothetical protein [Lactobacillus ultunensis DSM 16047]
 gi|227863785|gb|EEJ71206.1| conserved hypothetical protein [Lactobacillus ultunensis DSM 16047]
          Length = 229

 Score = 33.8 bits (76), Expect = 7.8,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFC 70
           +   L + T YL+        I +  + VR  GN A+H+ Q   +  ++  C+  ++   
Sbjct: 67  EYRNLRNDTHYLRSEVNYPLSIMDLFDEVRRMGNAAIHDSQIEPDKKQAWRCICDLHDIL 126

Query: 71  DIVFTLPALIKEKKSTHPNQSRDG 94
             +       ++     P+ S + 
Sbjct: 127 VFLINS-YEGQDLYYIRPDISMEA 149


>gi|323467205|gb|ADX70892.1| Putative uncharacterized protein [Lactobacillus helveticus H10]
          Length = 223

 Score = 33.8 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 13  KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFVNLFC 70
           +   L + T YL+        I +  + VR  GN A+H+ +   +  ++  C+  ++   
Sbjct: 67  EYRNLRNDTHYLRSELDYPLSIMDIFDEVRRMGNAAIHDSKIEPDKKQAWRCICDLHDIL 126

Query: 71  DIVF 74
             + 
Sbjct: 127 VFLI 130


>gi|258543347|ref|YP_003188780.1| hypothetical protein APA01_22870 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634425|dbj|BAI00401.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256637483|dbj|BAI03452.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256640535|dbj|BAI06497.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643592|dbj|BAI09547.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646647|dbj|BAI12595.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649700|dbj|BAI15641.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652688|dbj|BAI18622.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655744|dbj|BAI21671.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 203

 Score = 33.8 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 26/86 (30%), Gaps = 15/86 (17%)

Query: 13  KCGMLSDRTRYLKQ-------HNLIIEEIFEWSNFVRIEGNKAVHEGQS-------SIEE 58
           + G L+     LK+          I  E  E  + +R  GN   H  +           E
Sbjct: 98  QKGTLNKEITDLKEAVETGTADRSITAESVEAIDHIRTIGNIGAHMEKDINTIIDVDPNE 157

Query: 59  SDECLEFVNLFCDIVF-TLPALIKEK 83
           ++  ++   +  +  +       +  
Sbjct: 158 AEILIQVTEMLFEEWYGDRHKRAERL 183


>gi|326407903|gb|ADZ64973.1| type II restriction-modification system restriction subunit
           [Lactococcus lactis subsp. lactis CV56]
          Length = 1452

 Score = 33.8 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 28/69 (40%), Gaps = 4/69 (5%)

Query: 7   QRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ---SSIEESDECL 63
           + I   +    +D  R LK ++ I + I E    ++  GN + H      ++ E + + L
Sbjct: 54  EHIVLSERSSFNDILRELK-NDSIDQFIIESFYEIKRLGNDSAHNLNSRSATQENAKQAL 112

Query: 64  EFVNLFCDI 72
             + +    
Sbjct: 113 HKIFIILVW 121


>gi|227903363|ref|ZP_04021168.1| restriction endonuclease [Lactobacillus acidophilus ATCC 4796]
 gi|227868839|gb|EEJ76260.1| restriction endonuclease [Lactobacillus acidophilus ATCC 4796]
          Length = 1501

 Score = 33.8 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 25/85 (29%), Gaps = 14/85 (16%)

Query: 17  LSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVNLFCDI--- 72
            +D    LK    I +   +    ++  GN A H    +S EE+   L+ +         
Sbjct: 78  FNDILNRLKTGAYIDKFAVDLFYAIKGPGNVAAHTLDGASKEEALNSLKNLYSLFVWFVG 137

Query: 73  ----------VFTLPALIKEKKSTH 87
                      FT P        T 
Sbjct: 138 SYYDEKIDITAFTEPKKEDNLYQTT 162


>gi|58337940|ref|YP_194525.1| hypothetical protein LBA1682 [Lactobacillus acidophilus NCFM]
 gi|227902893|ref|ZP_04020698.1| conserved hypothetical protein [Lactobacillus acidophilus ATCC
           4796]
 gi|58255257|gb|AAV43494.1| hypothetical protein LBA1682 [Lactobacillus acidophilus NCFM]
 gi|227869309|gb|EEJ76730.1| conserved hypothetical protein [Lactobacillus acidophilus ATCC
           4796]
          Length = 228

 Score = 33.8 bits (76), Expect = 8.6,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 2/68 (2%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIE--ESDECLEFV 66
           I+  +   L + T YL+ H      I +  + VR  GN A+H+ Q   +  ++  C+  +
Sbjct: 62  ISAGEYRNLRNNTHYLRSHINYPLSIMDLFDEVRRMGNAAIHDAQIEPDKKQAWRCICDL 121

Query: 67  NLFCDIVF 74
           +     + 
Sbjct: 122 HDILVFLI 129


>gi|297205857|ref|ZP_06923252.1| conserved hypothetical protein [Lactobacillus jensenii JV-V16]
 gi|297148983|gb|EFH29281.1| conserved hypothetical protein [Lactobacillus jensenii JV-V16]
          Length = 151

 Score = 33.8 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 4   DQGQRINFEKCG-MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE----GQSSIEE 58
           +Q   ++ E  G  LS++ + L+Q+ +    I    + +R  G+ AVH      + + + 
Sbjct: 54  EQAHLVSDENRGFGLSEKIKTLRQNAIYPATIMRLFDRLRTYGSIAVHSSMNIDEYTAQL 113

Query: 59  SDE-CLEFVNLFCDI 72
           + +   + +    + 
Sbjct: 114 ALQNYHDLLVFLANY 128


>gi|229826008|ref|ZP_04452077.1| hypothetical protein GCWU000182_01372 [Abiotrophia defectiva ATCC
           49176]
 gi|229789750|gb|EEP25864.1| hypothetical protein GCWU000182_01372 [Abiotrophia defectiva ATCC
           49176]
          Length = 944

 Score = 33.4 bits (75), Expect = 9.1,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG--QSSIEESDECLEFV 66
           +       L           ++  ++++  +++RI GNK  H    +  ++E+  CLE +
Sbjct: 57  LEMPYKDNLYSLMDSEDYKQIVGYDLWKRMDYIRITGNKTAHNNKKKLGMDEAMLCLENL 116

Query: 67  NLFCDIV 73
            ++ D +
Sbjct: 117 FIYLDYI 123


>gi|303230100|ref|ZP_07316870.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515226|gb|EFL57198.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 951

 Score = 33.4 bits (75), Expect = 9.3,   Method: Composition-based stats.
 Identities = 8/66 (12%), Positives = 25/66 (37%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHE-GQSSIEESDECLEFVN 67
           +          + +  +   ++  +I +  + +R+ GN   H+  +   +  + CL+   
Sbjct: 55  LPNNPNENFCSKLQKYEFSRVVPHDIIKKLHLLRVNGNDMAHKVIECDQKVVNHCLKESY 114

Query: 68  LFCDIV 73
           L    +
Sbjct: 115 LLSKWL 120


>gi|317506904|ref|ZP_07964676.1| type III restriction enzyme [Segniliparus rugosus ATCC BAA-974]
 gi|316254832|gb|EFV14130.1| type III restriction enzyme [Segniliparus rugosus ATCC BAA-974]
          Length = 1120

 Score = 33.4 bits (75), Expect = 9.8,   Method: Composition-based stats.
 Identities = 10/66 (15%), Positives = 21/66 (31%), Gaps = 1/66 (1%)

Query: 9   INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEES-DECLEFVN 67
           +       L+ +         + + I +    +R  GN AVHE +    +   + L  + 
Sbjct: 53  LQAPYSNKLAAKIGDTAFKAKVPQTITQKMTVIRHIGNAAVHENRKVRPDISLQVLRELF 112

Query: 68  LFCDIV 73
                 
Sbjct: 113 HIVVWT 118


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.309    0.142    0.364 

Lambda     K      H
   0.267   0.0436    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 717,038,233
Number of Sequences: 14124377
Number of extensions: 20524175
Number of successful extensions: 68582
Number of sequences better than 10.0: 432
Number of HSP's better than 10.0 without gapping: 340
Number of HSP's successfully gapped in prelim test: 92
Number of HSP's that attempted gapping in prelim test: 68117
Number of HSP's gapped (non-prelim): 438
length of query: 94
length of database: 4,842,793,630
effective HSP length: 64
effective length of query: 30
effective length of database: 3,938,833,502
effective search space: 118165005060
effective search space used: 118165005060
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.1 bits)
S2: 76 (33.8 bits)