RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781182|ref|YP_003065595.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >gnl|CDD|183141 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional. Length = 1123 Score = 40.3 bits (95), Expect = 1e-04 Identities = 17/57 (29%), Positives = 25/57 (43%) Query: 9 INFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEF 65 I C D R L + + +EI + + +R GNKAVHE E+ L+ Sbjct: 55 IYEPPCENQHDLLRRLGKEGFLPDEILDVFHKLRKIGNKAVHEFHGDHREALMGLKL 111 >gnl|CDD|130502 TIGR01435, glu_cys_lig_rel, glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type. gamma-glutamyltripeptides of the form gamma-Glu-Cys-X(aa). The N-terminal region is similar to proteobacterial glutamate-cysteine ligase. The C-terminal region is homologous to cyanophycin synthetase of cyanobacteria and, more distantly, to D-alanine-D-alanine ligases. Members of this family are found in Listeria and Enterococcus, Gram-positive lineages in which glutathione is produced (see PUBMED:8606174), and in Pasteurella multocida, a Proteobacterium. In Clostridium acetobutylicum, adjacent genes include separate proteins rather than a fusion protein. Length = 737 Score = 24.9 bits (54), Expect = 4.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Query: 16 MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDE 61 + T LK+ L I+ I + V + N V G SI+ +DE Sbjct: 617 TGPEETLMLKEQGLTIDSIPKKEQIVYLRENSNVSTGGDSIDMTDE 662 >gnl|CDD|147830 pfam05892, Tricho_coat, Trichovirus coat protein. This family consists of several coat proteins which are specific to the ssRNA positive-strand, no DNA stage viruses such as the Trichovirus and Vitivirus. Length = 195 Score = 24.6 bits (54), Expect = 5.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 42 RIEGNKAVHEGQSSIEESDECL 63 R EG K+V E QSS+ E + Sbjct: 174 RTEGAKSVFEAQSSVVEQALEI 195 >gnl|CDD|184121 PRK13534, PRK13534, 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional. Length = 639 Score = 24.6 bits (54), Expect = 5.9 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 6/34 (17%) Query: 19 DRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEG 52 +RTR L +HNL + IFE N ++ +A+ EG Sbjct: 292 ERTRLLAEHNLYV--IFEEINRIK----QAIKEG 319 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0591 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,488,321 Number of extensions: 76659 Number of successful extensions: 122 Number of sequences better than 10.0: 1 Number of HSP's gapped: 122 Number of HSP's successfully gapped: 10 Length of query: 94 Length of database: 5,994,473 Length adjustment: 62 Effective length of query: 32 Effective length of database: 4,654,777 Effective search space: 148952864 Effective search space used: 148952864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)