RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781182|ref|YP_003065595.1| hypothetical protein
CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62]
         (94 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 29.9 bits (67), Expect = 0.15
 Identities = 23/109 (21%), Positives = 32/109 (29%), Gaps = 47/109 (43%)

Query: 16  MLSDR--TR-----YLKQHNLIIEE-----IFEWS------NFV-------------RIE 44
           MLS    T+     Y+ + N  +       I   S      N V              + 
Sbjct: 338 MLSISNLTQEQVQDYVNKTNSHLPAGKQVEI---SLVNGAKNLVVSGPPQSLYGLNLTLR 394

Query: 45  GNKA-VHEGQSSIEESDECLEFVNLFCDIVFTLP----------ALIKE 82
             KA     QS I  S+  L+F N F  +    P           LI +
Sbjct: 395 KAKAPSGLDQSRIPFSERKLKFSNRFLPV--ASPFHSHLLVPASDLINK 441


>1h4a_X Gamma crystallin D; eye lens protein; 1.15A {Homo sapiens} SCOP:
           b.11.1.1 b.11.1.1 PDB: 1hk0_X 2g98_A 2kfb_A 2klj_A
           1elp_A 1a45_A 1zir_A 1a5d_A 1zgt_A 1ziq_A 1zie_A 1m8u_A
           1amm_A 1gcs_A 4gcr_A 1i5i_A 2v2u_A 2jdf_A 1dsl_A 1gam_A
          Length = 173

 Score = 27.7 bits (61), Expect = 0.55
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 2   KDDQGQRINF-EKCGMLSDRTRYLKQHNLIIEE----IFEWSNF 40
           +D +GQ I F E C  L DR R+ + H+L + E    ++E SN+
Sbjct: 95  EDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNY 138


>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB,
          transcription factor, DNA-binding, DNA-directed RNA
          polymerase; 4.30A {Saccharomyces cerevisiae}
          Length = 197

 Score = 27.6 bits (61), Expect = 0.76
 Identities = 9/39 (23%), Positives = 16/39 (41%), Gaps = 11/39 (28%)

Query: 3  DDQGQRINFEKCGM-LSDRTRYLKQHNLIIEEIFEWSNF 40
            +G  +    CG+ LSD+         +++   EW  F
Sbjct: 38 FSEGDVV-CALCGLVLSDK---------LVDTRSEWRTF 66


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 24.8 bits (53), Expect = 5.3
 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 9/61 (14%)

Query: 15   GMLSDRTRYLKQHNLIIEEIF-----EWSNFVRIEGN----KAVHEGQSSIEESDECLEF 65
            GM  DR +     N I++E F      W N + I  +      V    +S+E  D  +E 
Sbjct: 1060 GMFKDRFKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATSVESVDIGVET 1119

Query: 66   V 66
            +
Sbjct: 1120 I 1120


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0545    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 805,892
Number of extensions: 31401
Number of successful extensions: 76
Number of sequences better than 10.0: 1
Number of HSP's gapped: 76
Number of HSP's successfully gapped: 17
Length of query: 94
Length of database: 5,693,230
Length adjustment: 61
Effective length of query: 33
Effective length of database: 4,214,346
Effective search space: 139073418
Effective search space used: 139073418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.5 bits)