BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781182|ref|YP_003065595.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781182|ref|YP_003065595.1| hypothetical protein CLIBASIA_05445 [Candidatus Liberibacter asiaticus str. psy62] Length = 94 Score = 196 bits (499), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60 MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD Sbjct: 1 MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60 Query: 61 ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94 ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG Sbjct: 61 ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG 94 >gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 21.2 bits (43), Expect = 3.7, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 14 CGMLSDRTRYLKQHNLIIEEIFEWS 38 G D+T + + IIE IF+WS Sbjct: 325 AGEGGDKTVVVFRRGNIIEHIFDWS 349 >gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Score = 20.0 bits (40), Expect = 8.5, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 19 DRTRYLKQHNLIIEEIFEWSNF-VRIEGNK 47 D T + + +IE +F+WS +R NK Sbjct: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359 >gi|254780928|ref|YP_003065341.1| histidyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 496 Score = 19.6 bits (39), Expect = 9.5, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 23 YLKQHNLIIEEIFEWSNFVRIEGNKAVHE 51 + K NL E+I +F+ I+ K++HE Sbjct: 226 FTKGANLTSEQIDIMVSFLSIDLEKSMHE 254 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.402 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,765 Number of Sequences: 1233 Number of extensions: 2230 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 94 length of database: 328,796 effective HSP length: 60 effective length of query: 34 effective length of database: 254,816 effective search space: 8663744 effective search space used: 8663744 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)