BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781183|ref|YP_003065596.1| hypothetical protein CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781183|ref|YP_003065596.1| hypothetical protein CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62] gi|254040860|gb|ACT57656.1| hypothetical protein CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62] Length = 94 Score = 206 bits (525), Expect = 6e-52, Method: Composition-based stats. Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MLIWNTSKLSIFCRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQ 60 MLIWNTSKLSIFCRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQ Sbjct: 1 MLIWNTSKLSIFCRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQ 60 Query: 61 KWLPTKDINKAIGESQTKEEYFPSYEEFYLSKAS 94 KWLPTKDINKAIGESQTKEEYFPSYEEFYLSKAS Sbjct: 61 KWLPTKDINKAIGESQTKEEYFPSYEEFYLSKAS 94 >gi|315122553|ref|YP_004063042.1| hypothetical protein CKC_04025 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495955|gb|ADR52554.1| hypothetical protein CKC_04025 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 246 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 39/63 (61%) Query: 1 MLIWNTSKLSIFCRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQ 60 MLIW +S I+ HC ++ P+Y M + GV+K K + YAVG C +CG+LSL F+ Sbjct: 1 MLIWESSDSDIWYGHCYEQKPSYDMSYVGVAKYIKDDDDLSAYAVGACRSCGNLSLFLFK 60 Query: 61 KWL 63 + L Sbjct: 61 EML 63 >gi|34499283|ref|NP_903498.1| type 4 fimbrial biogenesis protein [Chromobacterium violaceum ATCC 12472] gi|34105134|gb|AAQ61490.1| type 4 fimbrial biogenesis protein [Chromobacterium violaceum ATCC 12472] Length = 568 Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 12 FCRHCSQ--KNPNYGMCHAGVSKEEKAGNMHPTYAVGICENC 51 C HC Q + P + AG +KE+ AG HP VG CE C Sbjct: 458 LCSHCKQPVEIPKEALLRAGFTKEDLAGGWHPYGPVG-CEEC 498 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.317 0.131 0.419 Lambda K H 0.267 0.0399 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 912,990,645 Number of Sequences: 14124377 Number of extensions: 31422747 Number of successful extensions: 59204 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 59202 Number of HSP's gapped (non-prelim): 3 length of query: 94 length of database: 4,842,793,630 effective HSP length: 64 effective length of query: 30 effective length of database: 3,938,833,502 effective search space: 118165005060 effective search space used: 118165005060 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 75 (33.5 bits)