RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781183|ref|YP_003065596.1| hypothetical protein CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >gnl|CDD|184743 PRK14559, PRK14559, putative protein serine/threonine phosphatase; Provisional. Length = 645 Score = 29.3 bits (66), Expect = 0.21 Identities = 23/103 (22%), Positives = 33/103 (32%), Gaps = 25/103 (24%) Query: 1 MLIWNTSKLSIFCRHCSQKNPN-YGMC-HAGVSKEEKA----GNMHPTYAVGICENCGDL 54 MLI C C +NPN C G S K G P C NCG Sbjct: 1 MLI---------CPQCQFENPNNNRFCQKCGTSLTHKPCPQCGTEVP-VDEAHCPNCGAE 50 Query: 55 SLMAFQ----KWLPTKDINKAIGESQTKEEYF-----PSYEEF 88 + + + P ++ ++ +Q E P Y + Sbjct: 51 TGTIWWAIIAQASPNSEVLESGEATQQSESSLTPSSSPLYGSY 93 >gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional. Length = 1307 Score = 28.6 bits (64), Expect = 0.37 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 38 NMHPTYAVGICENCGDLSLMAFQKWLPTKDINKAIG 73 N T+++G+C C LMA W+P + +G Sbjct: 1123 NRPDTFSLGVCNGC---QLMALLGWVPGPQVGGGLG 1155 >gnl|CDD|151125 pfam10596, U6-snRNA_bdg, U6-snRNA interacting domain of PrP8. This domain incorporates the interacting site for the U6-snRNA as part of the U4/U6.U5 tri-snRNPs complex of the spliceosome, and is the prime candidate for the role of cofactor for the spliceosome's RNA core. The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor. Length = 160 Score = 25.1 bits (55), Expect = 4.0 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 7/36 (19%) Query: 66 KDINKAIG-------ESQTKEEYFPSYEEFYLSKAS 94 D+ +A+G + K FPS+E + KAS Sbjct: 31 TDVIQALGGVETILEHTLFKATGFPSWEGLFWEKAS 66 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.131 0.419 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,434,271 Number of extensions: 69543 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's gapped: 136 Number of HSP's successfully gapped: 9 Length of query: 94 Length of database: 5,994,473 Length adjustment: 62 Effective length of query: 32 Effective length of database: 4,654,777 Effective search space: 148952864 Effective search space used: 148952864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)