RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781183|ref|YP_003065596.1| hypothetical protein
CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62]
         (94 letters)



>3fcs_A Integrin, alpha 2B; beta propeller, rossmann fold, EGF
           domain, alternative splicing, cell adhesion, disease
           mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo
           sapiens} (A:18-165)
          Length = 148

 Score = 28.0 bits (62), Expect = 0.52
 Identities = 2/20 (10%), Positives = 6/20 (30%)

Query: 16  CSQKNPNYGMCHAGVSKEEK 35
           C     +        S +++
Sbjct: 129 CRGNTLSRIYVENDFSWDKR 148


>1txk_A OPGG, glucans biosynthesis protein G; beta-sandwich,
           biosynthetic protein; 2.50A {Escherichia coli} (A:)
          Length = 498

 Score = 24.7 bits (54), Expect = 4.2
 Identities = 7/22 (31%), Positives = 13/22 (59%)

Query: 71  AIGESQTKEEYFPSYEEFYLSK 92
           AI  +    E FP ++EF++ +
Sbjct: 153 AIDTALPSGEEFPRFKEFWIER 174


>3k6s_A Integrin alpha-X; hetero dimer, cell receptor, adhesion
          molecule, calcium, cell adhesion, disulfide bond,
          glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A
          {Homo sapiens} PDB: 3k71_A* 3k72_A*
          (A:76-124,A:316-436)
          Length = 170

 Score = 24.1 bits (52), Expect = 7.3
 Identities = 4/21 (19%), Positives = 5/21 (23%)

Query: 11 IFCRHCSQKNPNYGMCHAGVS 31
                S  +    M   G S
Sbjct: 52 EGTETTSSSSFELEMAQEGFS 72


>3fvy_A Dipeptidyl-peptidase 3; SGC, DPP3, alternative splicing,
          aminopeptidase, cytoplasm, hydrolase, metal-binding,
          metalloprotease, phosphoprotein; 1.90A {Homo sapiens}
          (A:53-164,A:693-728)
          Length = 148

 Score = 23.7 bits (51), Expect = 8.1
 Identities = 10/37 (27%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 28 AGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQKWLP 64
           G+++EE    +   YA G+  N G+       K++P
Sbjct: 32 EGLTEEEYQAFL--VYAAGVYSNMGNYKSFGDTKFVP 66


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.317    0.131    0.419 

Gapped
Lambda     K      H
   0.267   0.0608    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 726,950
Number of extensions: 28139
Number of successful extensions: 58
Number of sequences better than 10.0: 1
Number of HSP's gapped: 58
Number of HSP's successfully gapped: 6
Length of query: 94
Length of database: 4,956,049
Length adjustment: 54
Effective length of query: 40
Effective length of database: 3,130,579
Effective search space: 125223160
Effective search space used: 125223160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.3 bits)