RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781183|ref|YP_003065596.1| hypothetical protein
CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62]
         (94 letters)



>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB,
          transcription factor, DNA-binding, DNA-directed RNA
          polymerase; 4.30A {Saccharomyces cerevisiae}
          Length = 197

 Score = 29.1 bits (65), Expect = 0.25
 Identities = 7/40 (17%), Positives = 12/40 (30%), Gaps = 14/40 (35%)

Query: 13 CRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCG 52
          C  C    P        + +    G++       +C  CG
Sbjct: 24 CPECKVYPPK-------IVERFSEGDV-------VCALCG 49



 Score = 24.9 bits (54), Expect = 4.2
 Identities = 4/22 (18%), Positives = 7/22 (31%), Gaps = 3/22 (13%)

Query: 31 SKEEKAGNMHPTYAVGICENCG 52
              +  N++    V  C  C 
Sbjct: 10 RAGRRGPNLN---IVLTCPECK 28


>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand,
          acetylation, calcium, metal binding protein; 1.95A
          {Gallus gallus}
          Length = 109

 Score = 25.3 bits (55), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 2/33 (6%)

Query: 57 MAFQKWLPTKDINKAIGESQTKEEYFPSYEEFY 89
          MA    L  KDI  A+   Q  + +  +Y+ F+
Sbjct: 1  MAITDILSAKDIESALSSCQAADSF--NYKSFF 31


>1txk_A OPGG, glucans biosynthesis protein G; beta-sandwich, biosynthetic
           protein; 2.50A {Escherichia coli} SCOP: b.1.18.2
           b.30.5.9
          Length = 498

 Score = 25.1 bits (55), Expect = 4.0
 Identities = 7/24 (29%), Positives = 13/24 (54%)

Query: 71  AIGESQTKEEYFPSYEEFYLSKAS 94
           AI  +    E FP ++EF++ +  
Sbjct: 153 AIDTALPSGEEFPRFKEFWIERPK 176


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.131    0.419 

Gapped
Lambda     K      H
   0.267   0.0522    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 822,225
Number of extensions: 31876
Number of successful extensions: 80
Number of sequences better than 10.0: 1
Number of HSP's gapped: 80
Number of HSP's successfully gapped: 11
Length of query: 94
Length of database: 5,693,230
Length adjustment: 61
Effective length of query: 33
Effective length of database: 4,214,346
Effective search space: 139073418
Effective search space used: 139073418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.5 bits)