RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781183|ref|YP_003065596.1| hypothetical protein
CLIBASIA_05450 [Candidatus Liberibacter asiaticus str. psy62]
         (94 letters)



>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG,
           OpgG), N-terminal domain {Escherichia coli [TaxId: 562]}
          Length = 374

 Score = 25.4 bits (56), Expect = 1.4
 Identities = 7/22 (31%), Positives = 13/22 (59%)

Query: 71  AIGESQTKEEYFPSYEEFYLSK 92
           AI  +    E FP ++EF++ +
Sbjct: 152 AIDTALPSGEEFPRFKEFWIER 173


>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2)
           {Mycobacterium tuberculosis [TaxId: 1773]}
          Length = 395

 Score = 23.2 bits (48), Expect = 6.2
 Identities = 7/77 (9%), Positives = 24/77 (31%)

Query: 12  FCRHCSQKNPNYGMCHAGVSKEEKAGNMHPTYAVGICENCGDLSLMAFQKWLPTKDINKA 71
             +    +N  +       +  E+   ++ ++A G+         +        + +   
Sbjct: 248 LIQRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVRKGELVLVL 307

Query: 72  IGESQTKEEYFPSYEEF 88
           +  +    E+FP+    
Sbjct: 308 LEGANFDPEHFPNPGSI 324


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.317    0.131    0.419 

Gapped
Lambda     K      H
   0.267   0.0645    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 362,807
Number of extensions: 14503
Number of successful extensions: 37
Number of sequences better than 10.0: 1
Number of HSP's gapped: 37
Number of HSP's successfully gapped: 8
Length of query: 94
Length of database: 2,407,596
Length adjustment: 57
Effective length of query: 37
Effective length of database: 1,624,986
Effective search space: 60124482
Effective search space used: 60124482
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.1 bits)