RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >gnl|CDD|162870 TIGR02468, sucrsPsyn_pln, sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant. Members of this family are sucrose-phosphate synthases of plants. This enzyme is known to exist in multigene families in several species of both monocots and dicots. The N-terminal domain is the glucosyltransferase domain. Members of this family also have a variable linker region and a C-terminal domain that resembles sucrose phosphate phosphatase (SPP) (EC 3.1.3.24) (see TIGR01485), the next and final enzyme of sucrose biosynthesis. The SPP-like domain likely serves a binding and not a catalytic function, as the reported SPP is always encoded by a distinct protein. Length = 1050 Score = 25.5 bits (56), Expect = 3.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 55 VERKWIVFQRRAENCYARFI 74 +ERK RR +CY RF+ Sbjct: 407 LERKLRARARRGVSCYGRFM 426 >gnl|CDD|184289 PRK13737, PRK13737, conjugal transfer pilus assembly protein TraU; Provisional. Length = 330 Score = 24.7 bits (54), Expect = 4.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 13 FYPILWYTFPLMILISIQISI 33 FY + WY +PL ++I S+ Sbjct: 131 FYHVHWYKYPLTYWLNIITSL 151 >gnl|CDD|148634 pfam07138, DUF1386, Protein of unknown function (DUF1386). This family consists of several hypothetical Nucleopolyhedrovirus proteins of around 350 residues in length. The function of this family is unknown. Length = 324 Score = 24.7 bits (54), Expect = 5.8 Identities = 10/27 (37%), Positives = 11/27 (40%), Gaps = 7/27 (25%) Query: 58 KWIVFQRRAENC-------YARFIGIG 77 K+I NC Y RF GIG Sbjct: 202 KFIKPNDDEYNCAEAIAEVYGRFCGIG 228 >gnl|CDD|184995 PRK15035, PRK15035, cytochrome bd-II oxidase subunit 1; Provisional. Length = 514 Score = 24.2 bits (52), Expect = 8.6 Identities = 12/55 (21%), Positives = 30/55 (54%), Gaps = 7/55 (12%) Query: 15 PILWYTFPLMI------LISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQ 63 P+ W +F +M+ L+ + I+++ ++RG+I + ++K + + WI + Sbjct: 385 PVFW-SFRIMVGCGSLLLLVMLIALVQTLRGKIDQHRWVLKMALWSLPLPWIAIE 438 >gnl|CDD|180760 PRK06934, PRK06934, flavodoxin; Provisional. Length = 221 Score = 24.1 bits (52), Expect = 9.0 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Query: 10 INIFYPILWYTFPLMILISI 29 I I YPI WY P M++ S Sbjct: 133 IFIGYPIWWYKMP-MVMYSF 151 >gnl|CDD|181525 PRK08655, PRK08655, prephenate dehydrogenase; Provisional. Length = 437 Score = 23.8 bits (52), Expect = 9.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 32 SIMISIRGRIIRENP 46 +MI I GRI+ +NP Sbjct: 207 ELMIDIIGRILGQNP 221 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.335 0.148 0.467 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,320,166 Number of extensions: 68625 Number of successful extensions: 270 Number of sequences better than 10.0: 1 Number of HSP's gapped: 269 Number of HSP's successfully gapped: 32 Length of query: 78 Length of database: 5,994,473 Length adjustment: 48 Effective length of query: 30 Effective length of database: 4,957,289 Effective search space: 148718670 Effective search space used: 148718670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.0 bits)