BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 157 bits (396), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI 60 MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI Sbjct: 1 MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI 60 Query: 61 VFQRRAENCYARFIGIGE 78 VFQRRAENCYARFIGIGE Sbjct: 61 VFQRRAENCYARFIGIGE 78 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 24.6 bits (52), Expect = 0.31, Method: Compositional matrix adjust. Identities = 10/38 (26%), Positives = 21/38 (55%) Query: 32 SIMISIRGRIIRENPIVKKTAYFVERKWIVFQRRAENC 69 ++M + + I+ +PI K+ F R W + ++R+ C Sbjct: 405 AVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGC 442 >gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 9/45 (20%), Positives = 22/45 (48%) Query: 20 TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64 + PL + I +S + +RG +++ K RK +++++ Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163 >gi|254780929|ref|YP_003065342.1| hypothetical protein CLIBASIA_04140 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 9/45 (20%), Positives = 22/45 (48%) Query: 20 TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64 + PL + I +S + +RG +++ K RK +++++ Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163 >gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 9/45 (20%), Positives = 22/45 (48%) Query: 20 TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64 + PL + I +S + +RG +++ K RK +++++ Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163 >gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 21.2 bits (43), Expect = 3.3, Method: Composition-based stats. Identities = 9/45 (20%), Positives = 22/45 (48%) Query: 20 TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64 + PL + I +S + +RG +++ K RK +++++ Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163 >gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62] Length = 723 Score = 21.2 bits (43), Expect = 3.6, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 45 NPIVKKTAYFVERK 58 +PIVKKT ++ RK Sbjct: 710 DPIVKKTRWWKRRK 723 >gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 19.6 bits (39), Expect = 9.8, Method: Compositional matrix adjust. Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 11 NIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAY 53 ++F+P+L P+ + +SI ++ S+ IR+ + + AY Sbjct: 261 SVFWPMLSGLLPIFMCVSIGSMVLGSVVA--IRQKDLKRLMAY 301 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.335 0.148 0.467 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,691 Number of Sequences: 1233 Number of extensions: 1535 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 78 length of database: 328,796 effective HSP length: 48 effective length of query: 30 effective length of database: 269,612 effective search space: 8088360 effective search space used: 8088360 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 31 (16.5 bits)