BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781184|ref|YP_003065597.1| hypothetical protein
CLIBASIA_05455 [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781184|ref|YP_003065597.1| hypothetical protein CLIBASIA_05455 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 78

 Score =  157 bits (396), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI 60
          MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI
Sbjct: 1  MNEAINHLFINIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWI 60

Query: 61 VFQRRAENCYARFIGIGE 78
          VFQRRAENCYARFIGIGE
Sbjct: 61 VFQRRAENCYARFIGIGE 78


>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 869

 Score = 24.6 bits (52), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 32  SIMISIRGRIIRENPIVKKTAYFVERKWIVFQRRAENC 69
           ++M  +  + I+ +PI K+   F  R W + ++R+  C
Sbjct: 405 AVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGC 442


>gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 411

 Score = 21.6 bits (44), Expect = 2.9,   Method: Composition-based stats.
 Identities = 9/45 (20%), Positives = 22/45 (48%)

Query: 20  TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64
           + PL   + I +S  + +RG +++     K       RK +++++
Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163


>gi|254780929|ref|YP_003065342.1| hypothetical protein CLIBASIA_04140 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 21.6 bits (44), Expect = 3.0,   Method: Composition-based stats.
 Identities = 9/45 (20%), Positives = 22/45 (48%)

Query: 20  TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64
           + PL   + I +S  + +RG +++     K       RK +++++
Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163


>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 21.6 bits (44), Expect = 3.0,   Method: Composition-based stats.
 Identities = 9/45 (20%), Positives = 22/45 (48%)

Query: 20  TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64
           + PL   + I +S  + +RG +++     K       RK +++++
Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163


>gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 21.2 bits (43), Expect = 3.3,   Method: Composition-based stats.
 Identities = 9/45 (20%), Positives = 22/45 (48%)

Query: 20  TFPLMILISIQISIMISIRGRIIRENPIVKKTAYFVERKWIVFQR 64
           + PL   + I +S  + +RG +++     K       RK +++++
Sbjct: 119 SLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ 163


>gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62]
          Length = 723

 Score = 21.2 bits (43), Expect = 3.6,   Method: Composition-based stats.
 Identities = 8/14 (57%), Positives = 11/14 (78%)

Query: 45  NPIVKKTAYFVERK 58
           +PIVKKT ++  RK
Sbjct: 710 DPIVKKTRWWKRRK 723


>gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 478

 Score = 19.6 bits (39), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 11  NIFYPILWYTFPLMILISIQISIMISIRGRIIRENPIVKKTAY 53
           ++F+P+L    P+ + +SI   ++ S+    IR+  + +  AY
Sbjct: 261 SVFWPMLSGLLPIFMCVSIGSMVLGSVVA--IRQKDLKRLMAY 301


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.335    0.148    0.467 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,691
Number of Sequences: 1233
Number of extensions: 1535
Number of successful extensions: 10
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of query: 78
length of database: 328,796
effective HSP length: 48
effective length of query: 30
effective length of database: 269,612
effective search space:  8088360
effective search space used:  8088360
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)