Query gi|254781185|ref|YP_003065598.1| hypothetical protein CLIBASIA_05460 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 42 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 23785 Date Wed Jun 1 01:46:36 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781185.hhm -d /home/congqian_1/database/pdb/pdb70.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 1rkl_A Dolichyl-diphosphooligo 13.2 74 0.0031 14.3 1.7 12 6-17 8-19 (36) 2 1fft_B Ubiquinol oxidase; elec 9.9 53 0.0022 15.1 0.1 22 4-25 8-29 (315) 3 2glz_A Similar to formylmethan 7.6 1.2E+02 0.0049 13.4 1.1 13 14-26 60-72 (153) 4 2k1k_A Ephrin type-A receptor 6.9 1.5E+02 0.0063 12.8 1.9 11 8-18 14-24 (38) 5 1yp8_A Tricyclon A; beta-sheet 5.4 1.1E+02 0.0046 13.5 -0.0 10 19-28 13-22 (33) 6 2gvi_A Conserved hypothetical 5.0 2E+02 0.0083 12.2 1.1 14 13-26 65-78 (204) 7 1af7_A Chemotaxis receptor met 4.2 1.7E+02 0.0072 12.5 0.3 18 10-27 19-36 (274) 8 1rh2_A Interferon-alpha 2B; cy 3.7 2.5E+02 0.011 11.6 2.2 10 31-40 118-127 (165) 9 3mgj_A Uncharacterized protein 3.7 2.6E+02 0.011 11.6 1.3 24 8-31 18-47 (118) 10 2ox6_A Hypothetical protein SO 3.6 2.4E+02 0.01 11.7 0.6 18 2-19 1-18 (166) No 1 >1rkl_A Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit; membrane protein; NMR {Synthetic} SCOP: f.23.30.1 Probab=13.19 E-value=74 Score=14.35 Aligned_cols=12 Identities=33% Similarity=0.769 Sum_probs=9.2 Q ss_pred HHHHHHHHHHHH Q ss_conf 127999999999 Q gi|254781185|r 6 IGINIIFGLVLV 17 (42) Q Consensus 6 iginiifglvlv 17 (42) -|+-|+||.+.. T Consensus 8 n~~~i~fgi~mm 19 (36) T 1rkl_A 8 NSLAITFGIVMM 19 (36) T ss_dssp GHHHHHHHHHHH T ss_pred CCEEEEHHHHHH T ss_conf 847731357899 No 2 >1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1 Probab=9.86 E-value=53 Score=15.07 Aligned_cols=22 Identities=32% Similarity=0.569 Sum_probs=14.6 Q ss_pred CHHHHHHHHHHHHHHHCCCCCC Q ss_conf 1112799999999992374220 Q gi|254781185|r 4 KNIGINIIFGLVLVLSGCSIGE 25 (42) Q Consensus 4 kniginiifglvlvlsgcsige 25 (42) |.++.-.++...+.||||+..- T Consensus 8 r~l~~l~ll~~~~lLsGC~~~~ 29 (315) T 1fft_B 8 KSLGWLSLFAGTVLLSGCNSAL 29 (315) T ss_dssp -------------------CCC T ss_pred HHHHHHHHHHHHHHHHHCCCCC T ss_conf 8999999999999996576544 No 3 >2glz_A Similar to formylmethanofuran dehydrogenase subunit E; ZP_01368882, structural genomics, PSI, protein structure initiative; HET: MSE; 1.45A {Desulfitobacterium hafniense dcb-2} SCOP: d.81.3.1 Probab=7.64 E-value=1.2e+02 Score=13.36 Aligned_cols=13 Identities=31% Similarity=0.557 Sum_probs=9.9 Q ss_pred HHHHHHCCCCCCH Q ss_conf 9999923742201 Q gi|254781185|r 14 LVLVLSGCSIGEQ 26 (42) Q Consensus 14 lvlvlsgcsigeq 26 (42) -+-+++||++|.. T Consensus 60 avq~~tgcT~Gkg 72 (153) T 2glz_A 60 AIQVLNKATIGRH 72 (153) T ss_dssp HHHHHTCCCTTTT T ss_pred HHHHHHCCCCCCC T ss_conf 8999867765888 No 4 >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Probab=6.93 E-value=1.5e+02 Score=12.78 Aligned_cols=11 Identities=45% Similarity=0.872 Sum_probs=7.9 Q ss_pred HHHHHHHHHHH Q ss_conf 79999999999 Q gi|254781185|r 8 INIIFGLVLVL 18 (42) Q Consensus 8 iniifglvlvl 18 (42) ..+||||.|-+ T Consensus 14 vavifglll~~ 24 (38) T 2k1k_A 14 VAVIFGLLLGA 24 (38) T ss_dssp HHHHHHHHHHH T ss_pred HHHHHHHHHHH T ss_conf 89999999999 No 5 >1yp8_A Tricyclon A; beta-sheet, cystine knot, cyclic backbone, cyclotide, cell cycle; NMR {Viola tricolor} Probab=5.42 E-value=1.1e+02 Score=13.49 Aligned_cols=10 Identities=60% Similarity=0.930 Sum_probs=7.6 Q ss_pred HCCCCCCHHH Q ss_conf 2374220100 Q gi|254781185|r 19 SGCSIGEQKK 28 (42) Q Consensus 19 sgcsigeqkk 28 (42) .|||-||-|- T Consensus 13 kgcscgewkl 22 (33) T 1yp8_A 13 KGCSCGEWKL 22 (33) T ss_dssp TTEEEETTTE T ss_pred CCCCCCCEEE T ss_conf 8734663578 No 6 >2gvi_A Conserved hypothetical protein; 10640422, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.87A {Thermoplasma acidophilum} SCOP: d.81.3.1 g.39.1.18 Probab=5.03 E-value=2e+02 Score=12.18 Aligned_cols=14 Identities=21% Similarity=0.484 Sum_probs=10.0 Q ss_pred HHHHHHHCCCCCCH Q ss_conf 99999923742201 Q gi|254781185|r 13 GLVLVLSGCSIGEQ 26 (42) Q Consensus 13 glvlvlsgcsigeq 26 (42) .-+-++.||++|.. T Consensus 65 DaIQvlTGCT~Gkg 78 (204) T 2gvi_A 65 DGAQAATGCTYGKG 78 (204) T ss_dssp HHHHHHHSCCTTTT T ss_pred HHHHHHHCCEECCC T ss_conf 05548647502677 No 7 >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Probab=4.20 E-value=1.7e+02 Score=12.50 Aligned_cols=18 Identities=22% Similarity=0.357 Sum_probs=7.6 Q ss_pred HHHHHHHHHHCCCCCCHH Q ss_conf 999999999237422010 Q gi|254781185|r 10 IIFGLVLVLSGCSIGEQK 27 (42) Q Consensus 10 iifglvlvlsgcsigeqk 27 (42) .+-.++.--+|-.+++.| T Consensus 19 ~l~~~i~~~~Gi~l~~~k 36 (274) T 1af7_A 19 RICQLIYQRAGIVLADHK 36 (274) T ss_dssp HHHHHHHHHHCCCCCGGG T ss_pred HHHHHHHHHHCCCCCCCH T ss_conf 999999998699987022 No 8 >1rh2_A Interferon-alpha 2B; cytokine, anti-viral, immunomodulator, 4 helix bundle; 2.90A {Homo sapiens} SCOP: a.26.1.3 PDB: 1itf_A 2hym_B 2ksx_A 2kz1_A Probab=3.71 E-value=2.5e+02 Score=11.63 Aligned_cols=10 Identities=40% Similarity=1.026 Sum_probs=7.9 Q ss_pred HHHHHHHHHH Q ss_conf 4999999983 Q gi|254781185|r 31 SVKKYFNKLI 40 (42) Q Consensus 31 svkkyfnkli 40 (42) .+|+||..+- T Consensus 118 ~lkkYF~rI~ 127 (165) T 1rh2_A 118 AVRKYFQRIT 127 (165) T ss_pred HHHHHHHHHH T ss_conf 9999998999 No 9 >3mgj_A Uncharacterized protein MJ1480; saccharop_DH_N domain, NESG, structural genomics, PSI-2, protein structure initiative; 2.70A {Methanocaldococcus jannaschii} Probab=3.69 E-value=2.6e+02 Score=11.62 Aligned_cols=24 Identities=29% Similarity=0.576 Sum_probs=0.0 Q ss_pred HHHHHHHHHHHHC------CCCCCHHHHCH Q ss_conf 7999999999923------74220100024 Q gi|254781185|r 8 INIIFGLVLVLSG------CSIGEQKKNNS 31 (42) Q Consensus 8 iniifglvlvlsg------csigeqkknns 31 (42) +|-+|.+++-+.| |.+|++|+..| T Consensus 18 l~kvlD~I~d~GG~F~V~~f~vGk~k~d~S 47 (118) T 3mgj_A 18 LPKVFDKILDMGGDYKVLEFEIGKRKTDPS 47 (118) T ss_dssp HHHHHHHHHHTTCEEEEEEEECCSSTTSCE T ss_pred HHHHHHHHHHCCCCEEEEEEECCCCCCCCC T ss_conf 899999998449867999970587788864 No 10 >2ox6_A Hypothetical protein SO3848; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Shewanella oneidensis mr-1} SCOP: a.35.1.6 Probab=3.62 E-value=2.4e+02 Score=11.74 Aligned_cols=18 Identities=50% Similarity=0.431 Sum_probs=0.0 Q ss_pred CCCHHHHHHHHHHHHHHH Q ss_conf 631112799999999992 Q gi|254781185|r 2 VSKNIGINIIFGLVLVLS 19 (42) Q Consensus 2 vskniginiifglvlvls 19 (42) .|||+|.|-|---.|-+| T Consensus 1 msk~~glnaiei~ylr~s 18 (166) T 2ox6_A 1 MSKNIGLNAIEMSYLRQS 18 (166) T ss_dssp ----CCCCHHHHHHHHHH T ss_pred CCCCCCCCHHHHHHHHHH T ss_conf 985546315759999997 Done!