Query         gi|254781185|ref|YP_003065598.1| hypothetical protein CLIBASIA_05460 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 42
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 01:46:36 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781185.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1rkl_A Dolichyl-diphosphooligo  13.2      74  0.0031   14.3   1.7   12    6-17      8-19  (36)
  2 1fft_B Ubiquinol oxidase; elec   9.9      53  0.0022   15.1   0.1   22    4-25      8-29  (315)
  3 2glz_A Similar to formylmethan   7.6 1.2E+02  0.0049   13.4   1.1   13   14-26     60-72  (153)
  4 2k1k_A Ephrin type-A receptor    6.9 1.5E+02  0.0063   12.8   1.9   11    8-18     14-24  (38)
  5 1yp8_A Tricyclon A; beta-sheet   5.4 1.1E+02  0.0046   13.5  -0.0   10   19-28     13-22  (33)
  6 2gvi_A Conserved hypothetical    5.0   2E+02  0.0083   12.2   1.1   14   13-26     65-78  (204)
  7 1af7_A Chemotaxis receptor met   4.2 1.7E+02  0.0072   12.5   0.3   18   10-27     19-36  (274)
  8 1rh2_A Interferon-alpha 2B; cy   3.7 2.5E+02   0.011   11.6   2.2   10   31-40    118-127 (165)
  9 3mgj_A Uncharacterized protein   3.7 2.6E+02   0.011   11.6   1.3   24    8-31     18-47  (118)
 10 2ox6_A Hypothetical protein SO   3.6 2.4E+02    0.01   11.7   0.6   18    2-19      1-18  (166)

No 1  
>1rkl_A Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit; membrane protein; NMR {Synthetic} SCOP: f.23.30.1
Probab=13.19  E-value=74  Score=14.35  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             127999999999
Q gi|254781185|r    6 IGINIIFGLVLV   17 (42)
Q Consensus         6 iginiifglvlv   17 (42)
                      -|+-|+||.+..
T Consensus         8 n~~~i~fgi~mm   19 (36)
T 1rkl_A            8 NSLAITFGIVMM   19 (36)
T ss_dssp             GHHHHHHHHHHH
T ss_pred             CCEEEEHHHHHH
T ss_conf             847731357899


No 2  
>1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1
Probab=9.86  E-value=53  Score=15.07  Aligned_cols=22  Identities=32%  Similarity=0.569  Sum_probs=14.6

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             1112799999999992374220
Q gi|254781185|r    4 KNIGINIIFGLVLVLSGCSIGE   25 (42)
Q Consensus         4 kniginiifglvlvlsgcsige   25 (42)
                      |.++.-.++...+.||||+..-
T Consensus         8 r~l~~l~ll~~~~lLsGC~~~~   29 (315)
T 1fft_B            8 KSLGWLSLFAGTVLLSGCNSAL   29 (315)
T ss_dssp             -------------------CCC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCC
T ss_conf             8999999999999996576544


No 3  
>2glz_A Similar to formylmethanofuran dehydrogenase subunit E; ZP_01368882, structural genomics, PSI, protein structure initiative; HET: MSE; 1.45A {Desulfitobacterium hafniense dcb-2} SCOP: d.81.3.1
Probab=7.64  E-value=1.2e+02  Score=13.36  Aligned_cols=13  Identities=31%  Similarity=0.557  Sum_probs=9.9

Q ss_pred             HHHHHHCCCCCCH
Q ss_conf             9999923742201
Q gi|254781185|r   14 LVLVLSGCSIGEQ   26 (42)
Q Consensus        14 lvlvlsgcsigeq   26 (42)
                      -+-+++||++|..
T Consensus        60 avq~~tgcT~Gkg   72 (153)
T 2glz_A           60 AIQVLNKATIGRH   72 (153)
T ss_dssp             HHHHHTCCCTTTT
T ss_pred             HHHHHHCCCCCCC
T ss_conf             8999867765888


No 4  
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A
Probab=6.93  E-value=1.5e+02  Score=12.78  Aligned_cols=11  Identities=45%  Similarity=0.872  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHH
Q ss_conf             79999999999
Q gi|254781185|r    8 INIIFGLVLVL   18 (42)
Q Consensus         8 iniifglvlvl   18 (42)
                      ..+||||.|-+
T Consensus        14 vavifglll~~   24 (38)
T 2k1k_A           14 VAVIFGLLLGA   24 (38)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             89999999999


No 5  
>1yp8_A Tricyclon A; beta-sheet, cystine knot, cyclic backbone, cyclotide, cell cycle; NMR {Viola tricolor}
Probab=5.42  E-value=1.1e+02  Score=13.49  Aligned_cols=10  Identities=60%  Similarity=0.930  Sum_probs=7.6

Q ss_pred             HCCCCCCHHH
Q ss_conf             2374220100
Q gi|254781185|r   19 SGCSIGEQKK   28 (42)
Q Consensus        19 sgcsigeqkk   28 (42)
                      .|||-||-|-
T Consensus        13 kgcscgewkl   22 (33)
T 1yp8_A           13 KGCSCGEWKL   22 (33)
T ss_dssp             TTEEEETTTE
T ss_pred             CCCCCCCEEE
T ss_conf             8734663578


No 6  
>2gvi_A Conserved hypothetical protein; 10640422, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.87A {Thermoplasma acidophilum} SCOP: d.81.3.1 g.39.1.18
Probab=5.03  E-value=2e+02  Score=12.18  Aligned_cols=14  Identities=21%  Similarity=0.484  Sum_probs=10.0

Q ss_pred             HHHHHHHCCCCCCH
Q ss_conf             99999923742201
Q gi|254781185|r   13 GLVLVLSGCSIGEQ   26 (42)
Q Consensus        13 glvlvlsgcsigeq   26 (42)
                      .-+-++.||++|..
T Consensus        65 DaIQvlTGCT~Gkg   78 (204)
T 2gvi_A           65 DGAQAATGCTYGKG   78 (204)
T ss_dssp             HHHHHHHSCCTTTT
T ss_pred             HHHHHHHCCEECCC
T ss_conf             05548647502677


No 7  
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*
Probab=4.20  E-value=1.7e+02  Score=12.50  Aligned_cols=18  Identities=22%  Similarity=0.357  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHCCCCCCHH
Q ss_conf             999999999237422010
Q gi|254781185|r   10 IIFGLVLVLSGCSIGEQK   27 (42)
Q Consensus        10 iifglvlvlsgcsigeqk   27 (42)
                      .+-.++.--+|-.+++.|
T Consensus        19 ~l~~~i~~~~Gi~l~~~k   36 (274)
T 1af7_A           19 RICQLIYQRAGIVLADHK   36 (274)
T ss_dssp             HHHHHHHHHHCCCCCGGG
T ss_pred             HHHHHHHHHHCCCCCCCH
T ss_conf             999999998699987022


No 8  
>1rh2_A Interferon-alpha 2B; cytokine, anti-viral, immunomodulator, 4 helix bundle; 2.90A {Homo sapiens} SCOP: a.26.1.3 PDB: 1itf_A 2hym_B 2ksx_A 2kz1_A
Probab=3.71  E-value=2.5e+02  Score=11.63  Aligned_cols=10  Identities=40%  Similarity=1.026  Sum_probs=7.9

Q ss_pred             HHHHHHHHHH
Q ss_conf             4999999983
Q gi|254781185|r   31 SVKKYFNKLI   40 (42)
Q Consensus        31 svkkyfnkli   40 (42)
                      .+|+||..+-
T Consensus       118 ~lkkYF~rI~  127 (165)
T 1rh2_A          118 AVRKYFQRIT  127 (165)
T ss_pred             HHHHHHHHHH
T ss_conf             9999998999


No 9  
>3mgj_A Uncharacterized protein MJ1480; saccharop_DH_N domain, NESG, structural genomics, PSI-2, protein structure initiative; 2.70A {Methanocaldococcus jannaschii}
Probab=3.69  E-value=2.6e+02  Score=11.62  Aligned_cols=24  Identities=29%  Similarity=0.576  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHC------CCCCCHHHHCH
Q ss_conf             7999999999923------74220100024
Q gi|254781185|r    8 INIIFGLVLVLSG------CSIGEQKKNNS   31 (42)
Q Consensus         8 iniifglvlvlsg------csigeqkknns   31 (42)
                      +|-+|.+++-+.|      |.+|++|+..|
T Consensus        18 l~kvlD~I~d~GG~F~V~~f~vGk~k~d~S   47 (118)
T 3mgj_A           18 LPKVFDKILDMGGDYKVLEFEIGKRKTDPS   47 (118)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEECCSSTTSCE
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCC
T ss_conf             899999998449867999970587788864


No 10 
>2ox6_A Hypothetical protein SO3848; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Shewanella oneidensis mr-1} SCOP: a.35.1.6
Probab=3.62  E-value=2.4e+02  Score=11.74  Aligned_cols=18  Identities=50%  Similarity=0.431  Sum_probs=0.0

Q ss_pred             CCCHHHHHHHHHHHHHHH
Q ss_conf             631112799999999992
Q gi|254781185|r    2 VSKNIGINIIFGLVLVLS   19 (42)
Q Consensus         2 vskniginiifglvlvls   19 (42)
                      .|||+|.|-|---.|-+|
T Consensus         1 msk~~glnaiei~ylr~s   18 (166)
T 2ox6_A            1 MSKNIGLNAIEMSYLRQS   18 (166)
T ss_dssp             ----CCCCHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHH
T ss_conf             985546315759999997


Done!