BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] (45 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] gi|254040863|gb|ACT57659.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] Length = 45 Score = 92.8 bits (229), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD 45 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD Sbjct: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD 45 >gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2] gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 516 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 30/42 (71%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSS 42 + ++YNPDAIV+ NGIG +YL N+++ +E ILGQR S Sbjct: 363 LINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRS 404 >gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1] gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 511 Score = 42.4 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43 + +Y PDAI++ AN GA T +YLE L Y + ++LGQ+ +V Sbjct: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAV 404 >gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Score = 33.9 bits (76), Expect = 6.7, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYS 31 + ++Y PDA+V+ ANGIG T YL + YS Sbjct: 363 LINKYKPDAVVVDANGIGVQTYYYLADEGYS 393 >gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Score = 33.9 bits (76), Expect = 6.9, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYS 31 + ++Y PDA+V+ ANGIG T YL + YS Sbjct: 363 LINKYKPDAVVVDANGIGVQTYYYLADEGYS 393 Searching..................................................done Results from round 2 CONVERGED! >gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2] gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 516 Score = 79.3 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 30/42 (71%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSS 42 + ++YNPDAIV+ NGIG +YL N+++ +E ILGQR S Sbjct: 363 LINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRS 404 >gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] gi|254040863|gb|ACT57659.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62] Length = 45 Score = 70.8 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD 45 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD Sbjct: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD 45 >gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1] gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 511 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43 + +Y PDAI++ AN GA T +YLE L Y + ++LGQ+ +V Sbjct: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGY-HVYRVLGQKRAV 404 >gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSS 42 + ++Y PDA+V+ ANGIG T YL + Y + GQ + Sbjct: 363 LINKYKPDAVVVDANGIGVQTYYYLADEGY-SVHAEKGQNRA 403 >gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 1 MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSS 42 + ++Y PDA+V+ ANGIG T YL + Y + GQ + Sbjct: 363 LINKYKPDAVVVDANGIGVQTYYYLADEGY-SVHPEKGQNRA 403 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.319 0.140 0.386 Lambda K H 0.267 0.0434 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 857,656,692 Number of Sequences: 14124377 Number of extensions: 20768330 Number of successful extensions: 39124 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 39114 Number of HSP's gapped (non-prelim): 10 length of query: 45 length of database: 4,842,793,630 effective HSP length: 19 effective length of query: 26 effective length of database: 4,574,430,467 effective search space: 118935192142 effective search space used: 118935192142 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.2 bits) S2: 76 (33.8 bits)