RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781186|ref|YP_003065599.1| hypothetical protein
CLIBASIA_05465 [Candidatus Liberibacter asiaticus str. psy62]
         (45 letters)



>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA.  EngA
           (YfgK, Der) is a ribosome-associated essential GTPase
           with a duplication of its GTP-binding domain. It is
           broadly to universally distributed among bacteria. It
           appears to function in ribosome biogenesis or stability.
          Length = 429

 Score = 25.9 bits (58), Expect = 2.7
 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 5/31 (16%)

Query: 2   AHQ--YNPDAIVLYANGIGAVTANY---LEN 27
           A Q   NP   VL+ N    +  +Y   LEN
Sbjct: 381 ATQVGTNPPTFVLFGNRPELLPFSYKRYLEN 411


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.314    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0869    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 724,710
Number of extensions: 27384
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's gapped: 54
Number of HSP's successfully gapped: 4
Length of query: 45
Length of database: 5,994,473
Length adjustment: 18
Effective length of query: 27
Effective length of database: 5,605,529
Effective search space: 151349283
Effective search space used: 151349283
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (22.8 bits)