BLAST/BLAST alignment of GI: 254781186 and GI: 254781215
>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 511
 Score = 42.4 bits (98), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 1   MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43
           +  +Y PDAI++ AN  GA T +YLE L Y  + ++LGQ+ +V
Sbjct: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAV 404